neuropeptide y suppliers USA

Find where to buy products from suppliers in the USA, including: distributors, industrial manufacturers in America, bulk supplies and wholesalers of raw ingredients & finished goods.

Search for products or services, then visit the American suppliers website for prices, SDS or more information. You can also view suppliers in Australia, NZ or the UK.

Product
Neuropeptide Y (13-36), amide, human Neuropeptide Y (13-36), amide, human is a selective neuropeptide Y2 receptor agonist. Synonyms: Neuropeptide Y (13-36), human; Pro-Ala-Glu-Asp-Met-Ala-Arg-Tyr-Tyr-Ser-Ala-Leu-Arg-His-Tyr-Ile-Asn-Leu-Ile-Thr-Arg-Gln-Arg-Tyr-NH2; Neuropeptide Y (13-36) (human, rat); L-prolyl-L-alanyl-L-alpha-glutamyl-L-alpha-aspartyl-L-methionyl-L-alanyl-L-arginyl-L-tyrosyl-L-tyrosyl-L-seryl-L-alanyl-L-leucyl-L-arginyl-L-histidyl-L-tyrosyl-L-isoleucyl-L-asparagyl-L-leucyl-L-isoleucyl-L-threonyl-L-arginyl-L-glutaminyl-L-arginyl-L-tyrosinamide. Grade: 95%. CAS No. 122341-40-6. Molecular formula: C134H207N41O36S. Mole weight: 3000.39. BOC Sciences
Neuropeptide Y (13-36), porcine Neuropeptide Y (13-36), porcine is a selective neuropeptide Y 2 receptor agonist [1]. Uses: Scientific research. Group: Peptides. Alternative Names: NPY 13-36. CAS No. 113662-54-7. Pack Sizes: 1 mg; 5 mg; 10 mg. Product ID: HY-P1011. MedChemExpress MCE
Neuropeptide Y 13-36 (porcine) Neuropeptide Y 13-36 (porcine) is a selective neuropeptide Y2 receptor agonist (Ki = 0.18 nM). It mimics the effects of NPY at presynaptic receptors in vas deferens. Synonyms: H-Pro-Ala-Glu-Asp-Leu-Ala-Arg-Tyr-Tyr-Ser-Ala-Leu-Arg-His-Tyr-Ile-Asn-Leu-Ile-Thr-Arg-Gln-Arg-Tyr-NH2. CAS No. 113662-54-7. Molecular formula: C135H209N41O36. Mole weight: 2982.36. BOC Sciences
Neuropeptide Y 22-36 Neuropeptide Y(22-36) is a fragment of neuropeptide Y containing 15 amino acids. Synonyms: Neuropeptide Y (22-36) pig; Ser-Ala-Leu-Arg-His-Tyr-Ile-Asn-Leu-Ile-Thr-Arg-Gln-Arg-Tyr-NH2; L-Seryl-L-alanyl-L-leucyl-L-arginyl-L-histidyl-L-tyrosyl-L-isoleucyl-L-asparaginyl-L-leucyl-L-isoleucyl-L-threonyl-L-arginyl-L-glutaminyl-L-arginyl-L-tyrosinamide; NPY 22-36, porcine. Grade: 95%. CAS No. 119019-65-7. Molecular formula: C85H139N29O21. Mole weight: 1903.19. BOC Sciences
Neuropeptide y(2-36)(human,rat) Neuropeptide y(2-36)(human,rat). Uses: Designed for use in research and industrial production. Additional or Alternative Names: H-PRO-SER-LYS-PRO-ASP-ASN-PRO-GLY-GLU-ASP-ALA-PRO-ALA-GLU-ASP-MET-ALA-ARG-TYR-TYR-SER-ALA-LEU-ARG-HIS-TYR-ILE-ASN-LEU-ILE-THR-ARG-GLN-ARG-TYR-NH2;PRO-SER-LYS-PRO-ASP-ASN-PRO-GLY-GLU-ASP-ALA-PRO-ALA-GLU-ASP-MET-ALA-ARG-TYR-TYR-SER-ALA-LEU-ARG-HIS-TYR-ILE-. Product Category: Heterocyclic Organic Compound. CAS No. 123139-39-9. Molecular formula: C180H276N54O55S. Product ID: ACM123139399. Alfa Chemistry — ISO 9001:2015 Certified. Alfa Chemistry. 4
Neuropeptide Y (29-64) Neuropeptide Y is a 36 amino-acid neuropeptide that is involved in various physiological and homeostatic processes in both the central and peripheral nervous systems. Synonyms: Tyr-Pro-Ser-Lys-Pro-Asp-Asn-Pro-Gly-Glu-Asp-Ala-Pro-Ala-Glu-Asp-Met-Ala-Arg-Tyr-Tyr-Ser-Ala-Leu-Arg-His-Tyr-Ile-Asn-Leu-Ile-Thr-Arg-Gln-Arg-Tyr; L-tyrosyl-L-prolyl-L-seryl-L-lysyl-L-prolyl-L-alpha-aspartyl-L-asparagyl-L-prolyl-glycyl-L-alpha-glutamyl-L-alpha-aspartyl-L-alanyl-L-prolyl-L-alanyl-L-alpha-glutamyl-L-alpha-aspartyl-L-methionyl-L-alanyl-L-arginyl-L-tyrosyl-L-tyrosyl-L-seryl-L-alanyl-L-leucyl-L-arginyl-L-histidyl-L-tyrosyl-L-isoleucyl-L-asparagyl-L-leucyl-L-isoleucyl-L-threonyl-L-arginyl-L-glutaminyl-L-arginyl-L-tyrosine. Grade: ≥95%. CAS No. 303052-45-1. Molecular formula: C189H284N54O58S. Mole weight: 4272.66. BOC Sciences 8
Neuropeptide Y(29-64) Neuropeptide Y(29-64) is a 36 amino acid peptide, a fragment of Neuropeptide Y. Uses: Scientific research. Group: Peptides. CAS No. 303052-45-1. Pack Sizes: 1 mg; 5 mg; 10 mg. Product ID: HY-P1601. MedChemExpress MCE
Neuropeptide Y (29-64), amide, human TFA It is a widely distributed endogenous neuropeptide involved in the control of food intake, sexual behavior and blood pressure. NPY has also been shown to interact with the immune system, promote gastrointestinal inflammation and exhibit antimicrobial effect against several gut bacteria. Synonyms: Tyr-Pro-Ser-Lys-Pro-Asp-Asn-Pro-Gly-Glu-Asp-Ala-Pro-Ala-Glu-Asp-Met-Ala-Arg-Tyr-Tyr-Ser-Ala-Leu-Arg-His-Tyr-Ile-Asn-Leu-Ile-Thr-Arg-Gln-Arg-Tyr-NH2.TFA; Neuropeptide Y (13-36), human trifluoroacetic acid; Neuropeptide Y (13-36) (human,rat) trifluoroacetic acid; L-prolyl-L-alanyl-L-alpha-glutamyl-L-alpha-aspartyl-L-methionyl-L-alanyl-L-arginyl-L-tyrosyl-L-tyrosyl-L-seryl-L-alanyl-L-leucyl-L-arginyl-L-histidyl-L-tyrosyl-L-isoleucyl-L-asparagyl-L-leucyl-L-isoleucyl-L-threonyl-L-arginyl-L-glutaminyl-L-arginyl-L-tyrosinamide trifluoroacetic acid. Grade: ≥98%. Molecular formula: C189H285N55O57S.C2HF3O2. Mole weight: 4385.70. BOC Sciences 11
Neuropeptide Y (3-36) (human, rat) Neuropeptide Y (3-36) (human, rat) is a neuropeptide Y (NPY) metabolite formed by dipeptidyl peptidase-4 (DPP4) and is a selective Y2/Y5 receptor agonist. It is a major degradation product of NPY in serum, and reduces norepinephrine release through the Y2 receptor. Synonyms: Neuropeptide Y Fragment 3-36 human, rat; H-Ser-Lys-Pro-Asp-Asn-Pro-Gly-Glu-Asp-Ala-Pro-Ala-Glu-Asp-Met-Ala-Arg-Tyr-Tyr-Ser-Ala-Leu-Arg-His-Tyr-Ile-Asn-Leu-Ile-Thr-Arg-Gln-Arg-Tyr-NH2; NPY 3-36 human, rat; L-seryl-L-lysyl-L-prolyl-L-alpha-aspartyl-L-asparagyl-L-prolyl-glycyl-L-alpha-glutamyl-L-alpha-aspartyl-L-alanyl-L-prolyl-L-alanyl-L-alpha-glutamyl-L-alpha-aspartyl-L-methionyl-L-alanyl-L-arginyl-L-tyrosyl-L-tyrosyl-L-seryl-L-alanyl-L-leucyl-L-arginyl-L-histidyl-L-tyrosyl-L-isoleucyl-L-asparagyl-L-leucyl-L-isoleucyl-L-threonyl-L-arginyl-L-glutaminyl-L-arginyl-L-tyrosinamide. Grade: ≥95%. CAS No. 150138-78-6. Molecular formula: C175H269N53O54S. Mole weight: 4011.45. BOC Sciences
Neuropeptide Y (free acid) (human, rat) Neuropeptide Y is a 36 amino-acid neuropeptide that is involved in various physiological and homeostatic processes in both the central and peripheral nervous systems. Synonyms: H-Tyr-Pro-Ser-Lys-Pro-Asp-Asn-Pro-Gly-Glu-Asp-Ala-Pro-Ala-Glu-Asp-Met-Ala-Arg-Tyr-Tyr-Ser-Ala-Leu-Arg-His-Tyr-Ile-Asn-Leu-Ile-Thr-Arg-Gln-Arg-Tyr-NH2; NPY (free acid) (human, rat); Neuropeptide Y, human, rat. Grade: ≥95%. CAS No. 99575-89-0. Molecular formula: C189H285N55O57S. Mole weight: 4271.74. BOC Sciences 11
Neuropeptide Y, Human - CAS 90880-35-6 A potent vasoconstrictor. Group: Fluorescence/luminescence spectroscopy. Alfa Chemistry Analytical Products 3
Neuropeptide Y (human, rat) Neuropeptide Y (human, rat) is a widely distributed endogenous neuropeptide involved in the control of food intake, sexual behavior and blood pressure. NPY has also been shown to interact with the immune system, promoting gastrointestinal inflammation, as well as exhibiting an antimicrobial effect against several gut bacteria. Synonyms: NPY (human, rat). CAS No. 90880-35-6. Molecular formula: C189H285N55O57S. Mole weight: 4271.7. BOC Sciences
Neuropeptide Y (human,rat,mouse) Neuropeptide Y (human,rat,mouse) is involved in Alzheimer's disease (AD) and protects rat cortical neurons against β-Amyloid toxicity. Uses: Scientific research. Group: Peptides. Alternative Names: Neuropeptide Y (29-64), amide. CAS No. 90880-35-6. Pack Sizes: 1 mg; 5 mg; 10 mg. Product ID: HY-P0198. MedChemExpress MCE
Neuropeptide Y-Lys(biotinyl) (free acid) (human, rat) Neuropeptide Y-Lys(biotinyl) (free acid) (human, rat). Synonyms: NPY-Lys(biotinyl) (human, rat); H-Tyr-Pro-Ser-Lys-Pro-Asp-Asn-Pro-Gly-Glu-Asp-Ala-Pro-Ala-Glu-Asp-Met-Ala-Arg-Tyr-Tyr-Ser-Ala-Leu-Arg-His-Tyr-Ile-Asn-Leu-Ile-Thr-Arg-Gln-Arg-Tyr-Lys(biotinyl)-OH. Grade: ≥95%. CAS No. 1927927-12-5. Molecular formula: C205H310N58O61S2. Mole weight: 4627.14. BOC Sciences
Neuropeptide Y (porcine) Neuropeptide Y (porcine) is a widely distributed endogenous neuropeptide involved in regulation of circadian rhythms, sexual functioning, anxiety and stress response, and regulation of food intake (Ki= 0.17, 0.04 nM at human and Y2 respectively). It inhibits cholecystokinin- and secretin-stimulated pancreatic secretion. Synonyms: H-Tyr-Pro-Ser-Lys-Pro-Asp-Asn-Pro-Gly-Glu-Asp-Ala-Pro-Ala-Glu-Asp-Leu-Ala-Arg-Tyr-Tyr-Ser-Ala-Leu-Arg-His-Tyr-Ile-Asn-Leu-Ile-Thr-Arg-Gln-Arg-Tyr-NH2. CAS No. 83589-17-7. Molecular formula: C190H287N55O57. Mole weight: 4254. BOC Sciences
Biotinyl-Neuropeptide Y (human, rat) Biotinyl-Neuropeptide Y (human, rat). Synonyms: BIOTIN-TYR-PRO-SER-LYS-PRO-ASP-ASN-PRO-GLY-GLU-ASP-ALA-PRO-ALA-GLU-ASP-MET-ALA-ARG-TYR-TYR-SER-ALA-LEU-ARG-HIS-TYR-ILE-ASN-LEU-ILE-THR-ARG-GLN-ARG-TYR-NH2; BIOTINYL-TYR-PRO-SER-LYS-PRO-ASP-ASN-PRO-GLY-GLU-ASP-ALA-PRO-ALA-GLU-ASP-MET-ALA-ARG-TYR-TYR-SER-AL. Grade: 95%. CAS No. 213779-13-6. Molecular formula: C199H299N57O59S2. BOC Sciences
((Cys31,nva34)-neuropeptide y(27-36))2 ((Cys31,nva34)-neuropeptide y(27-36))2. Uses: Designed for use in research and industrial production. Additional or Alternative Names: ((CYS31,NVA34)-NEUROPEPTIDE Y (27-36))2;((CYS31,NVA34)-NPY (27-36))2;BWX 46;(H-TYR-ILE-ASN-LEU-CYS-THR-ARG-NVA-ARG-TYR-NH2)2;(H-Tyr-Ile-Asn-Leu-Cys-Thr-Arg-Nva-Arg-Tyr-NH2)2, (Disulfide bond). Product Category: Heterocyclic Organic Compound. CAS No. 172997-92-1. Molecular formula: C116H186N36O28S2. Mole weight: 2597.07. Product ID: ACM172997921. Alfa Chemistry — ISO 9001:2015 Certified. Alfa Chemistry. 5
((Cys31,Nva34)-Neuropeptide Y (27-36))2 A potent Neuropeptide Y Y5 receptor agonist. Synonyms: ((Cys31,Nva34)-NPY (27-36))2; BWX 46; (H-Tyr-Ile-Asn-Leu-Cys-Thr-Arg-Nva-Arg-Tyr-NH2)2; (H-Tyr-Ile-Asn-Leu-Cys-Thr-Arg-Nva-Arg-Tyr-NH2)2, (Disulfide bond). Grade: 98%. CAS No. 172997-92-1. Molecular formula: C116H186N36O28S2. Mole weight: 2597.07. BOC Sciences
(d-Trp32)-neuropeptide y(human,rat) (d-Trp32)-neuropeptide y(human,rat). Uses: Designed for use in research and industrial production. Additional or Alternative Names: YPSKPDNPGEDAPAEDMARYYSALRHYINLIWRQRY-NH2;TYR-PRO-SER-LYS-PRO-ASP-ASN-PRO-GLY-GLU-ASP-ALA-PRO-ALA-GLU-ASP-MET-ALA-ARG-TYR-TYR-SER-ALA-LEU-ARG-HIS-TYR-ILE-ASN-LEU-ILE-D-TRP-ARG-GLN-ARG-TYR-NH2;(D-TRP32)-NEUROPEPTIDE Y (HUMAN, RAT);[DTRP32]NEUROPEPTIDE Y (1. Product Category: Heterocyclic Organic Compound. CAS No. 178861-83-1. Molecular formula: C196H288N56O56S. Product ID: ACM178861831. Alfa Chemistry — ISO 9001:2015 Certified. Alfa Chemistry. 3
[D-Trp34]-Neuropeptide Y [D-Trp34]-Neuropeptide Y is a potent and selective neuropeptide Y (NPY) Y 5 receptor agonist. [D-Trp34]-Neuropeptide Y is a significantly less potent agonist at the NPY Y 1 , Y 2 , Y 4 , and y 6 receptors. [D-Trp34]-Neuropeptide Y markedly increases food intake in rats [1] [2]. Uses: Scientific research. Group: Peptides. CAS No. 153549-84-9. Pack Sizes: 5 mg; 10 mg. Product ID: HY-P1322. MedChemExpress MCE
[D-Trp34]-Neuropeptide Y [D-Trp34]-Neuropeptide Y is a potent and selective NPY Y(5) receptor agonist (pEC50= 7.82, 6.28, 6.44 and > 6 at rat Y5, Y4, Y1 and Y2 receptors respectively), with > 26-fold, > 1000-fold and > 1000-fold selectivity over Y1, Y2 and Y4 receptors respectively. Unlike the prototype selective NPY Y(5) receptor agonist [D-Trp(32)]NPY, [D-Trp(34)]NPY markedly increases food intake in rats, an effect that is blocked by the selective NPY Y(5) receptor antagonist CGP 71683A. Synonyms: Tyr-Pro-Ser-Lys-Pro-Asp-Asn-Pro-Gly-Glu-Asp-Ala-Pro-Ala-Glu-Asp-Met-Ala-Arg-Tyr-Tyr-Ser-Ala-Leu-Arg-His-Tyr-Ile-Asn-Leu-Ile-Thr-Arg-D-Trp-Arg-Tyr-NH2. CAS No. 153549-84-9. Molecular formula: C196H289N55O56. Mole weight: 4311.77. BOC Sciences 3
Galanin (1-13)-Neuropeptide Y (25-36) amide The chimeric peptide M32 is a high affinity galanin receptor antagonist (IC50= 0.1 nM in rat hypothalamus membranes and Kd= 0.01 nM in rat spinal cord membranes). Synonyms: H-Gly-Trp-Thr-Leu-Asn-Ser-Ala-Gly-Tyr-Leu-Leu-Gly-Pro-Arg-His-Tyr-Ile-Asn-Leu-Ile-Thr-Arg-Gln-D-Arg-Tyr-NH2; M32; M 88 peptide; galanin-NPY chimeric peptide M88. Grade: 95%. CAS No. 147138-51-0. Molecular formula: C136H209N41O34. Mole weight: 2962.37. BOC Sciences 10
(His32,leu34)-neuropeptide y(32-36) (His32,leu34)-neuropeptide y(32-36). Uses: Designed for use in research and industrial production. Additional or Alternative Names: H-HIS-ARG-LEU-ARG-TYR-NH2;(HIS32,LEU34)-NEUROPEPTIDE Y (32-36);(HIS32,LEU34)-NPY (32-36);HIS-ARG-LEU-ARG-TYR-NH2. Product Category: Heterocyclic Organic Compound. CAS No. 168916-68-5. Molecular formula: C33H54N14O6. Mole weight: 742.87. Purity: 0.96. IUPACName: (2S)-N-[(2S)-1-[[(2S)-1-amino-3-(4-hydroxyphenyl)-1-oxopropan-2-yl]amino]-5-(diaminomethylideneamino)-1-oxopentan-2-yl]-2-[[(2S)-2-[[(2S)-2-amino-3-(1H-imidazol-5-yl)propanoyl]amino]-5-(diaminomethylideneamino)pentanoyl]amino]-4-methylpentanamide. Canonical SMILES: CC(C)CC(C(=O)NC(CCCN=C(N)N)C(=O)NC(CC1=CC=C(C=C1)O)C(=O)N)NC(=O)C(CCCN=C(N)N)NC(=O)C(CC2=CN=CN2)N. Product ID: ACM168916685. Alfa Chemistry — ISO 9001:2015 Certified. Alfa Chemistry. 3
[Leu31,Pro34]-Neuropeptide Y (human, rat) [Leu31,Pro34]-Neuropeptide Y (human, rat) is a high affinity neuropeptide Y Y1 receptor agonist (Ki = 0.39 nM). Synonyms: [Leu31,Pro34]-NPY (human, rat); H-Tyr-Pro-Ser-Lys-Pro-Asp-Asn-Pro-Gly-Glu-Asp-Ala-Pro-Ala-Glu-Asp-Met-Ala-Arg-Tyr-Tyr-Ser-Ala-Leu-Arg-His-Tyr-Ile-Asn-Leu-Leu-Thr-Arg-Pro-Arg-Tyr-NH2; L-tyrosyl-L-prolyl-L-seryl-L-lysyl-L-prolyl-L-alpha-aspartyl-L-asparagyl-L-prolyl-glycyl-L-alpha-glutamyl-L-alpha-aspartyl-L-alanyl-L-prolyl-L-alanyl-L-alpha-glutamyl-L-alpha-aspartyl-L-methionyl-L-alanyl-L-arginyl-L-tyrosyl-L-tyrosyl-L-seryl-L-alanyl-L-leucyl-L-arginyl-L-histidyl-L-tyrosyl-L-isoleucyl-L-asparagyl-L-leucyl-L-leucyl-L-threonyl-L-arginyl-L-prolyl-L-arginyl-L-tyrosinamide. Grade: ≥95%. CAS No. 132699-73-1. Molecular formula: C189H284N54O56S. Mole weight: 4240.67. BOC Sciences
[Leu31,Pro34] Neuropeptide Y (human) trifluoroacetate salt [Leu31,Pro34] Neuropeptide Y (NPY) is an agonist of the NPY receptors Y1 and Y5. Synonyms: [Leu31,Pro34] NPY; [Leu31,Pro34]-NPY (human). Grade: ≥95%. Molecular formula: C189H284N54O56S·xCF3COOH. Mole weight: 4240.67. BOC Sciences 3
[Leu31,Pro34]-Neuropeptide Y (porcine) [Leu31,Pro34]- Neuropeptide Y (porcine), a Neuropeptide Y (NPY) analog, is a selective NPY Y1 receptor agonist. [Leu31,Pro34]- Neuropeptide Y (porcine) exhibits anxiolytic effects [1] [2]. Uses: Scientific research. Group: Peptides. CAS No. 125580-28-1. Pack Sizes: 5 mg; 10 mg. Product ID: HY-P0208. MedChemExpress MCE
[Leu31,Pro34]-Neuropeptide Y (porcine) [Leu31,Pro34]-Neuropeptide Y (porcine) is a high affinity neuropeptide Y Y1 receptor agonist (Ki = 0.54 nM). Synonyms: (Leu(31),pro(34))npy; 31-Leu-34-pro-neuropeptide Y; Pancreatic polypeptide (chicken), 1-L-tyrosine-4-L-lysine-6-L-aspartic acid-7-L-asparagine-10-L-glutamic acid-14-L-alanine-18-L-alanine-20-L-tyrosine-22-L-serine-23-L-alanine-25-L-arginine-26-L-histidine-28-L-isoleucine-30-L-leucine-31-L-leucine-34-L-proline. CAS No. 125580-28-1. Molecular formula: C190H286N54O56. Mole weight: 4222.63. BOC Sciences
Neuropeptidey(swine),31-L-Leucine-34-l-proline- Neuropeptidey(swine),31-L-Leucine-34-l-proline-. Uses: Designed for use in research and industrial production. Additional or Alternative Names: [LEU31,PRO34] NEUROPEPTIDE Y (1-36), PORCINE;[LEU31, PRO34]-NEUROPEPTIDE Y, HUMAN, PORCINE;(LEU31,PRO34)-NEUROPEPTIDE Y (PORCINE);[LEU31, PRO34]-NEUROPEPTIDE Y (PORCINE) (BOVINE);(LEU31,PRO34)-NPY (PORCINE);[LEU31, PRO34]-NPY (PORCINE) (BOVINE);ANTI-NSEC. Product Category: Heterocyclic Organic Compound. CAS No. 125580-28-1. Molecular formula: C190H286N54O56. Mole weight: 4222.63. Purity: 0.96. Canonical SMILES: CCC(C)C(C(=O)NC(CC(=O)N)C(=O)NC(CC(C)C)C(=O)NC(CC(C)C)C(=O)NC(C(C)O)C(=O)NC(CCCNC(=N)N)C(=O)N1CCCC1C(=O)NC(CCCNC(=N)N)C(=O)NC(CC2=CC=C(C=C2)O)C(=O)N)NC(=O)C(CC3=CC=C(C=C3)O)NC(=O)C(CC4=CNC=N4)NC(=O)C(CCCNC(=N)N)NC(=O)C(CC(C)C)NC(=O)C(C)NC(=O)C(CO)NC(=O)C(CC5=CC=C(C=C5)O)NC(=O)C(CC6=CC=C(C=C6)O)NC(=O)C(CCCNC(=N)N)NC(=O)C(C)NC(=O)C(CC(C)C)NC(=O)C(CC(=O)O)NC(=O)C(CCC(=O)O)NC(=O)C(C)NC(=O)C7CCCN7C(=O)C(C)NC(=O)C(CC(=O)O)NC(=O)C(CCC(=O)O)NC(=O)CNC(=O)C8CCCN8C(=O)C(CC(=O)N)NC(=O)C(CC(=O)O)NC(=O)C9CCCN9C(=O)C(CCCCN)NC(=O)C(CO)NC(=O)C1CCCN1C(=O)C(CC1=CC=C(C=C1)O)N. Product ID: ACM125580281. Alfa Chemistry — ISO 9001:2015 Certified. Alfa Chemistry. 3
[O-Methyl-Tyr21]-Neuropeptide Y human ?97% (HPLC). Group: Fluorescence/luminescence spectroscopy. Alfa Chemistry Analytical Products
(Pro30,tyr32,leu34)-neuropeptide y(28-36) (Pro30,tyr32,leu34)-neuropeptide y(28-36). Uses: Designed for use in research and industrial production. Additional or Alternative Names: (PRO30,TYR32,LEU34)-NEUROPEPTIDE Y (28-36);(PRO30,TYR32,LEU34)-NPY (28-36);H-ILE-ASN-PRO-ILE-TYR-ARG-LEU-ARG-TYR-NH2;ILE-ASN-PRO-ILE-TYR-ARG-LEU-ARG-TYR-NH2. Product Category: Heterocyclic Organic Compound. CAS No. 161650-01-7. Molecular formula: C57H91N17O12. Mole weight: 1206.44. Purity: 0.96. IUPACName: (2S)-1-[(2S)-4-amino-2-[[(2S,3S)-2-amino-3-methylpentanoyl]amino]-4-oxobutanoyl]-N-[(2S,3S)-1-[[(2S)-1-[[(2S)-1-[[(2S)-1-[[(2S)-1-[[(2S)-1-amino-3-(4-hydroxyphenyl)-1-oxopropan-2-yl]amino]-5-(diaminomethylideneamino)-1-oxopentan-2-yl]amino]-4-methyl-1-oxo. Canonical SMILES: CCC(C)C(C(=O)NC(CC(=O)N)C(=O)N1CCCC1C(=O)NC(C(C)CC)C(=O)NC(CC2=CC=C(C=C2)O)C(=O)NC(CCCN=C(N)N)C(=O)NC(CC(C)C)C(=O)NC(CCCN=C(N)N)C(=O)NC(CC3=CC=C(C=C3)O)C(=O)N)N. Product ID: ACM161650017. Alfa Chemistry — ISO 9001:2015 Certified. Alfa Chemistry. 4
1-Methyl-3-azetidinemethanamine 1-Methyl-3-azetidinemethanamine is a derivative of Azetidine (A813000); a useful building block in the synthesis of polypeptides and other nitrogen containing compounds with potential biological properties. 1-Methyl-3-azetidinemethanamine is also used as a reagent in the synthesis of amidinourea derivatives as neuropeptide Y ligands. Group: Biochemicals. Grades: Highly Purified. CAS No. 1359656-98-6. Pack Sizes: 250mg, 2.5g. Molecular Formula: C5H12N2, Molecular Weight: 100.16. US Biological Life Sciences. USBiological 9
Worldwide
2-Oxopiperidine-4-carboxylic Acid 2-Oxopiperidine-4-carboxylic Acid can be synthesized from 2-Hydroxyisonicitonic Acid (H942895), a compound used in the synthesis of selective inhibitors of neuropeptide Y Y5 inhibiting food intake. 2-Hydroxyisonicitonic Acid is also used in the optimization of p-subsite residues of HIV protease inhibitors. Group: Biochemicals. Grades: Highly Purified. CAS No. 24537-50-6. Pack Sizes: 100mg, 250mg. Molecular Formula: C6H9NO3, Molecular Weight: 143.139999999999. US Biological Life Sciences. USBiological 10
Worldwide
2-Oxopropanoic Acid Chloride 2-Oxopropanoic Acid Chloride is a reactant used to derive a series of neuropeptide Y (NPY) Y5 receptor antagonists from the biphenylurea, which exhibits excellent pharmacokinetic parameters in rats and dogs. Group: Biochemicals. Grades: Highly Purified. CAS No. 5704-66-5. Pack Sizes: 100mg, 250mg. Molecular Formula: C3H3ClO2, Molecular Weight: 106.51. US Biological Life Sciences. USBiological 10
Worldwide
2-(Phenoxymethyl)-4-[3-(1-piperidinyl)propoxy]-1-[3-(4-piperidinyl)propyl]- A diaminoalkyl substituted benzimidazole as neuropeptide Y Y1 receptor antagonists. Group: Biochemicals. Grades: Highly Purified. CAS No. 226416-58-6. Pack Sizes: 10mg. US Biological Life Sciences. USBiological 2
Worldwide
Apelin-13 Apelin-13, an endogenous neuropeptide, is the ligand for the G-protein-coupled receptor APJ, an alternative coreceptor with CD4 for HIV-1 infection. Apelin-13 is generated from apelin-36, which is a putative receptor protein related to the angiotensin receptor (AT1). Apelin-13 exerted an acidification-rate-promoting activity in the CHO cells expressing the APJ receptor with EC50 value of 0.37 nM. Apelin-13 is a 13 amino acid polypeptide encoded by the apelin gene which yields a pre-proprotein that is processed to generate bioactive peptides. Apelin-13 is also involved in the learning and memory process. Synonyms: Apelin-13 (human, bovine, mouse, rat); H-Gln-Arg-Pro-Arg-Leu-Ser-His-Lys-Gly-Pro-Met-Pro-Phe-OH; L-glutaminyl-L-arginyl-L-prolyl-L-arginyl-L-leucyl-L-seryl-L-histidyl-L-lysyl-glycyl-L-prolyl-L-methionyl-L-prolyl-L-phenylalanine. Grade: ≥95%. CAS No. 217082-58-1. Molecular formula: C69H111N23O16S. Mole weight: 1550.85. BOC Sciences
BIBP 3226 BIBP 3226 is a mixed non-peptide neuropeptide Y Y1 (NPY Y1) and neuropeptide FF (NPFF) receptor antagonist (Ki = 1.1, 79, 108, >1000, >1000 and >1000 for rNPY Y1, hNPFF2, rNPFF, rNPY Y2, rNPY Y4 and rNPY Y5, respectively). It exhibits an anxiogenic-like effect in rats following i.c.v. administration. Synonyms: BIBP3226; BIBP-3226; N2-(Diphenylacetyl)-N-[(4-hydroxyphenyl)methyl]-D-arginine amide; (R)-2-Diphenylacetylamino-5-guanidino-pentanoic acid 4-hydroxy-benzylamide; N5-(Diaminomethylene)-N2-(2,2-diphenylacetyl)-N-(4-hydroxybenzyl)-D-ornithinamide; N-[(1R)]-4-[(Aminoiminomethyl)amino-1-[[[(4-hydroxyphenyl)methyl]amino]carbonyl]butyl-α-phenylbenzeneacetamide; Diphenylacetyl-D-Arg-4-hydroxybenzylamide. Grade: ≥98%. CAS No. 159013-54-4. Molecular formula: C27H31N5O3. Mole weight: 473.57. BOC Sciences
BIBP 3226 TFA BIBP 3226 trifluoroacetate is a mixed non-peptide neuropeptide Y Y1 (NPY Y1) and neuropeptide FF (NPFF) receptor antagonist (Ki = 1.1, 79, 108, > 1000, > 1000 and >1000 for rNPY Y1, hNPFF2, rNPFF, rNPY Y2, rNPY Y4 and rNPY Y5, respectively). BIBP 3226 exhibits an anxiogenic-like effect in rats following i.c.v. administration. Synonyms: BIBP 3226 trifluoroacetate; BIBP3226 trifluoroacetate; BIBP-3226 trifluoroacetate; N-[(1R)]-4-[(Aminoiminomethyl)amino-1-[[[(4-hydroxyphenyl)methyl]amino]carbonyl]butyl-α-phenylbenzeneacetamide trifluoroacetate; N5-(Diaminomethylene)-N2-(2,2-diphenylacetyl)-N-(4-hydroxybenzyl)-D-ornithinamide trifluoroacetate; Diphenylacetyl-D-Arg-4-hydroxybenzylamide trifluoroacetate. Grade: ≥98% by HPLC. CAS No. 1068148-47-9. Molecular formula: C27H31N5O3.C2HF3O2. Mole weight: 587.59. BOC Sciences
BIBP3226 TFA BIBP3226 TFA is a potent and selective neuropeptide Y Y1 (NPY Y1) and neuropeptide FF (NPFF) receptor antagonist, with K i s of 1.1, 79, and 108 nM for rNPY Y1, hNPFF2, and rNPFF, respectively. BIBP3226 TFA displays anxiogenic-like effect [1] [2]. Uses: Scientific research. Group: Signaling pathways. CAS No. 1068148-47-9. Pack Sizes: 5 mg; 10 mg; 25 mg; 50 mg; 100 mg. Product ID: HY-107726. MedChemExpress MCE
BIIE 0246 BIIE 0246 is a potent, selective and non-peptide antagonist which binds to the neuropeptide Y Y2 receptor (IC50 = 15 nM) with > 650-fold selectivity over Y1, Y4 and Y5 receptors. Synonyms: (2S)-5-(diaminomethylideneamino)-N-[2-(3,5-dioxo-1,2-diphenyl-1,2,4-triazolidin-4-yl)ethyl]-2-[[2-[1-[2-oxo-2-[4-(6-oxo-5,11-dihydrobenzo[c][1]benzazepin-11-yl)piperazin-1-yl]ethyl]cyclopentyl]acetyl]amino]pentanamide; BIIE-0246; BIIE 0246; BIIE-0246; CHEMBL540989; GTPL1547; CTK8E9439; BIIE0246. Grade: >98 %. CAS No. 246146-55-4. Molecular formula: C49H57N11O6. Mole weight: 896.05. BOC Sciences 6
BIIE-0246 BIIE-0246 (AR-H 053591) is a potent and selective NPY2R (neuropeptide Y receptor 2) antagonist with an IC 50 value of 15 nM for rat [ 125 I]PYY 3-36. BIIE-0246 decreases the expression of p-AKT S473, P-p44/42 MAPK under the NPY-stimulated. BIIE-0246 reduces albuminuria in ADR nephropathy [1] [2] [3]. Uses: Scientific research. Group: Signaling pathways. Alternative Names: AR-H 053591. CAS No. 246146-55-4. Pack Sizes: 10 mM * 1 mL; 5 mg; 10 mg; 25 mg; 50 mg; 100 mg. Product ID: HY-101986. MedChemExpress MCE
BIIE 0246 hydrochloride BIIE 0246 hydrochloride is a potent, selective, and competitive nonpeptide antagonist for the neuropeptide Y Y2 receptor with an IC50 of 15 nM. Synonyms: (2S)-5-((diaminomethylene)amino)-N-(2-(3,5-dioxo-1,2-diphenyl-1,2,4-triazolidin-4-yl)ethyl)-2-(2-(1-(2-oxo-2-(4-(6-oxo-6,11-dihydro-5H-dibenzo[b,e]azepin-11-yl)piperazin-1-yl)ethyl)cyclopentyl)acetamido)pentanamide dihydrochloride; N-[(1S)-4-[(Aminoiminomethyl)amino]-1-[[[2-(3,5-dioxo-1,2-diphenyl-1,2,4-triazolidin-4-yl)ethyl]amino]carbonyl]butyl]-1-[2-[4-(6,11-dihydro-6-oxo-5H-dibenz[b,e]azepin-11-yl)-1-piperazinyl]-2-oxoethyl]-cyclopentaneacetamide dihydrochloride; Cyclopentaneacetamide, N-[(1S)-4-[(aminoiminomethyl)amino]-1-[[[2-(3,5-dioxo-1,2-diphenyl-1,2,4-triazolidin-4-yl)ethyl]amino]carbonyl]butyl]-1-[2-[4-(6,11-dihydro-6-oxo-5H-dibenz[b,e]azepin-11-yl)-1-piperazinyl]-2-oxoethyl]-, hydrochloride (1:2). Grade: ≥95%. CAS No. 246146-31-6. Molecular formula: C49H57N11O6.2HCl. Mole weight: 968.98. BOC Sciences 6
BMS-192548 BMS-192548 is a neuropeptide Y (NPY) receptor binding inhibitor produced by Aspergillus niger WB2346. It also has weak cytotoxicity, with an IC50 of 240 μmol/L for murine tumor cells M-109. Synonyms: TAN-1612. CAS No. 156368-93-3. Molecular formula: C21H18O9. Mole weight: 414.36. BOC Sciences 12
BMS-193885 BMS-193885 is a potent and selective neuropeptide Y1 receptor antagonist with IC50=5.9nM, Ki=3.3 nM. BMS-193885 displays > 47, > 100, > 160, > 160 and > 160-fold selectivity over σ1, α1, Y2, Y4 and Y5 receptors respectively. Synonyms: dimethyl 4-[3-[3-[4-(3-methoxyphenyl)piperidin-1-yl]propylcarbamoylamino]phenyl]-2,6-dimethyl-1,4-dihydropyridine-3,5-dicarboxylate; BMS 193885; 679839-66-8BMS-193885; BMS193885; BMS 193885. Grade: >98%. CAS No. 186185-03-5. Molecular formula: C33H42N4O6. Mole weight: 590.71. BOC Sciences 6
BMS-193885 BMS-193885 is a selective neuropeptide Y1 receptor antagonist (Ki=3.3 nM) that competitively blocks the receptor to inhibit NPY-mediated appetite regulation signaling pathways, reduce food intake and inhibit weight gain. BMS-193885 has good blood-brain barrier penetration and is mainly used in the study of obesity and related metabolic diseases[1][2][3]. Uses: Scientific research. Group: Signaling pathways. CAS No. 186185-03-5. Pack Sizes: 10 mM * 1 mL; 5 mg; 10 mg; 25 mg; 50 mg; 100 mg. Product ID: HY-120619. MedChemExpress MCE
BMS-193885 salt BMS-193885 is a potent and selective neuropeptide Y1 receptor antagonist with IC50=5.9nM, Ki=3.3 nM. BMS-193885 displays > 47, > 100, > 160, > 160 and > 160-fold selectivity over σ1, α1, Y2, Y4 and Y5 receptors respectively. Synonyms: BMS 193885; BMS193885; 1,4-dihydro-4-[3-[[[[3-[4-(3-methoxyphenyl)-1-piperidinyl]propyl]amino]carbonyl]amino]phenyl]-2,6-dimethyl-3,5-dimethyl ester-3,5-pyridinedicarboxylic acid. Grade: >98%. CAS No. 679839-66-8. Molecular formula: C36H48N4O9. Mole weight: 680.79. BOC Sciences 6
BWX 46 Acetate BWX 46 Acetate is a potent, highly selective neuropeptide Y (NPY) receptor agonist with IC50 of 0.5 nM. Synonyms: ((Cys31,Nva34)-NPY (27-36))2 Acetate. Molecular formula: C118H190N36O30S2. Mole weight: 2657.12. BOC Sciences 6
CART (55-102) (human) Cocaine- and amphetamine-regulated transcript (CART) is a neuropeptide protein with potent appetite-suppressing activity. It inhibits normal and starvation-induced feeding and blocks the neuropeptide Y-induced feeding response. Synonyms: H-Val-Pro-Ile-Tyr-Glu-Lys-Lys-Tyr-Gly-Gln-Val-Pro-Met-Cys-Asp-Ala-Gly-Glu-Gln-Cys-Ala-Val-Arg-Lys-Gly-Ala-Arg-Ile-Gly-Lys-Leu-Cys-Asp-Cys-Pro-Arg-Gly-Thr-Ser-Cys-Asn-Ser-Phe-Leu-Leu-Lys-Cys-Leu-OH (Disulfide bridge: Cys14-Cys32, Cys20-Cys40, Cys34-Cys47); L-valyl-L-prolyl-L-isoleucyl-L-tyrosyl-L-alpha-glutamyl-L-lysyl-L-lysyl-L-tyrosyl-glycyl-L-glutaminyl-L-valyl-L-prolyl-L-methionyl-L-cysteinyl-L-alpha-aspartyl-L-alanyl-glycyl-L-alpha-glutamyl-L-glutaminyl-L-cysteinyl-L-alanyl-L-valyl-L-arginyl-L-lysyl-glycyl-L-alanyl-L-arginyl-L-isoleucyl-glycyl-L-lysyl-L-leucyl-L-cysteinyl-L-alpha-aspartyl-L-cysteinyl-L-prolyl-L-arginyl-glycyl-L-threonyl-L-seryl-L-cysteinyl-L-asparagyl-L-seryl-L-phenylalanyl-L-leucyl-L-leucyl-L-lysyl-L-cysteinyl-L-leucine (14->32),(20->40),(34->47)-tris(disulfide). Grade: ≥95%. CAS No. 214050-22-3. Molecular formula: C225H365N65O65S7. Mole weight: 5245.18. BOC Sciences
CART(55-102)(human) CART(55-102)(human) is an endogenous satiety factor with potent appetite-suppressing activity. CART(55-102)(human) is closely associated with leptin and neuropeptide Y [1] [2]. Uses: Scientific research. Group: Peptides. CAS No. 214050-22-3. Pack Sizes: 1 mg; 5 mg; 10 mg. Product ID: HY-P1304. MedChemExpress MCE
CART (55-102) (rat) Cocaine- and amphetamine-regulated transcript (CART) is a neuropeptide protein with potent appetite-suppressing activity. It inhibits normal and starvation-induced feeding and blocks the neuropeptide Y-induced feeding response. Uses: Appetite suppressant. Synonyms: H-Ile-Pro-Ile-Tyr-Glu-Lys-Lys-Tyr-Gly-Gln-Val-Pro-Met-Cys-Asp-Ala-Gly-Glu-Gln-Cys-Ala-Val-Arg-Lys-Gly-Ala-Arg-Ile-Gly-Lys-Leu-Cys-Asp-Cys-Pro-Arg-Gly-Thr-Ser-Cys-Asn-Ser-Phe-Leu-Leu-Lys-Cys-Leu-OH (Disulfide bridge: Cys14-Cys32, Cys20-Cys40, Cys34-Cys37); L-isoleucyl-L-prolyl-L-isoleucyl-L-tyrosyl-L-alpha-glutamyl-L-lysyl-L-lysyl-L-tyrosyl-glycyl-L-glutaminyl-L-valyl-L-prolyl-L-methionyl-L-cysteinyl-L-alpha-aspartyl-L-alanyl-glycyl-L-alpha-glutamyl-L-glutaminyl-L-cysteinyl-L-alanyl-L-valyl-L-arginyl-L-lysyl-glycyl-L-alanyl-L-arginyl-L-isoleucyl-glycyl-L-lysyl-L-leucyl-L-cysteinyl-L-alpha-aspartyl-L-cysteinyl-L-prolyl-L-arginyl-glycyl-L-threonyl-L-seryl-L-cysteinyl-L-asparagyl-L-seryl-L-phenylalanyl-L-leucyl-L-leucyl-L-lysyl-L-cysteinyl-L-leucine (14->32),(20->40),(34->47)-tris(disulfide). Grade: ≥95%. CAS No. 209615-79-2. Molecular formula: C226H367N65O65S7. Mole weight: 5259.21. BOC Sciences
CART (62-76) (rat, human) Cocaine- and amphetamine-regulated transcript (CART) is a neuropeptide protein with potent appetite-suppressing activity. It inhibits normal and starvation-induced feeding and blocks the neuropeptide Y-induced feeding response. Synonyms: H-Tyr-Gly-Gln-Val-Pro-Met-Cys-Asp-Ala-Gly-Glu-Gln-Cys-Ala-Val-OH; L-tyrosyl-glycyl-L-glutaminyl-L-valyl-L-prolyl-L-methionyl-L-cysteinyl-L-alpha-aspartyl-L-alanyl-glycyl-L-alpha-glutamyl-L-glutaminyl-L-cysteinyl-L-alanyl-L-valine; Cocaine and amphetamine-regulated transcript (62-76) (rat, human). Grade: ≥90%. CAS No. 210978-19-1. Molecular formula: C64H99N17O23S3. Mole weight: 1570.77. BOC Sciences
Casopitant Casopitant mesylate is the mesylate salt of a centrally-acting neurokinin 1 (NK1) receptor antagonist with antidepressant and antiemetic activities. Casopitant competitively binds to and blocks the activity of the NK1 receptor, thereby inhibiting NK1-receptor binding of the endogenous tachykinin neuropeptide substance P (SP), which may result in antiemetic effects. SP is found in neurons of vagal afferent fibers innervating the brain-stem nucleus tractus solitarii and the area postrema, which contains the chemoreceptor trigger zone (CTZ), and may be elevated in response to chemotherapy. The NK1 receptor is a G-protein receptor coupled to the inositol phosphate signal-transduction pathway and is found in both the nucleus tractus solitarii and the area postrema. Uses: Antiemetics. Synonyms: GW679769; GW 679769; GW-679769; Zunrisa; Rezonic; 4-(4-Acetylpiperazin-1-yl)-N-{1-[3,5-bis(trifluoromethyl)phenyl]ethyl}-2-(4-fluoro-2-methylphenyl)-N-methylpiperidine-1-carboxamide. CAS No. 414910-27-3. Molecular formula: C30H35F7N4O2. Mole weight: 616.62. BOC Sciences 6
Casopitant Mesylate Casopitant Mesylate is a potent, selective and orally active neurokinin 1 (NK1) receptor antagonist binding of the endogenous tachykinin neuropeptide substance P (SP), which may result in antiemetic effects. Uses: Active tachykinin nk1 receptor antagonist. Synonyms: (2R,4S)-4-(4-acetylpiperazin-1-yl)-N-[(1R)-1-[3,5-bis(trifluoromethyl)phenyl]ethyl]-2-(4-fluoro-2-methylphenyl)-N-methylpiperidine-1-carboxamide; methanesulfonic acid. Grade: ≥98%. CAS No. 414910-30-8. Molecular formula: C31H39F7N4O5S. Mole weight: 712.72. BOC Sciences 6
CGP71683 hydrochloride CGP71683 hydrochloride is a competitive neuropeptide Y5 receptor antagonist with a K i of 1.3 nM, and shows no obvious activity at Y1 receptor ( K i , >4000 nM) and Y2 receptor ( K i , 200 nM) in cell membranes. Uses: Scientific research. Group: Signaling pathways. Alternative Names: CGP71683A. CAS No. 192322-50-2. Pack Sizes: 10 mM * 1 mL; 5 mg; 10 mg; 25 mg; 50 mg. Product ID: HY-107723. MedChemExpress MCE
Clenbuterol Impurity A 4-Amino-3,5-dichlorobenzaldehyde is an impurity of Clenbuterol and is used as a reagent in the synthesis of pyrazolopyridine derivatives as inhibitors of phosphodiesterase-4 (PDE-IV) and production of tumor necrosis factor-α (TNF-α). 4-Amino-3,5-dichlorobenzaldehyde is also used as a reagent in the synthesis of amino acid derivatives as neuropeptide Y antagonists. Synonyms: 4-Amino-3,5-dichlorobenzaldehyde. Grade: > 95%. CAS No. 62909-66-4. Molecular formula: C7H5Cl2NO. Mole weight: 190.03. BOC Sciences 7
CP-671906-01 CP-671906-01 is a neuropeptide Y1 receptor antagonists, increasing blood pressure and food intake in rat models. Uses: Npy y1r antagonist. Synonyms: CP-671906; CP 671906; CP671906; UNII-GLZ1WA47Q8; CP-671906-01.N'-[3-(2,6-dichloro-4-methoxyphenyl)-2,5-dimethylpyrazolo[1,5-a]pyrimidin-7-yl]-N-(oxan-4-yl)ethane-1,2-diamine. Grade: ≥98%. CAS No. 332178-44-6. Molecular formula: C22H27Cl2N5O2. Mole weight: 464.39. BOC Sciences 7
CYM 50769 CYM 50769 has been found to be a non-peptide antagonist of neuropeptide W/B receptor 1. Synonyms: CYM 50769; CYM50769; CYM-50769; 5-Chloro-2-(9H-fluoren-9-yl)-4-(4-methoxyphenoxy)-3(2H)-pyridazinone. Grade: ≥98% by HPLC. CAS No. 1421365-63-0. Molecular formula: C24H17ClN2O3. Mole weight: 416.86. BOC Sciences 7
CYM 9484 CYM 9484 has been found to be an effective neuropeptide Y (NPY) Y2 receptor antagonist. Synonyms: CYM 9484; CYM9484; CYM-9484; N-[4-[(Dimethylamino)sulfonyl]phenyl]-4-(hydroxydiphenylmethyl)-1-piperidinecarbothioamide. Grade: ≥98% by HPLC. CAS No. 1383478-94-1. Molecular formula: C27H31N3O3S2. Mole weight: 509.63. BOC Sciences 7
Des-Gly9-Oxytocin Des-Gly9-Oxytocin is a modified version of oxytocin, a hormone and neuropeptide that plays key roles in childbirth, lactation, and social behaviors. Synonyms: Cys-Tyr-Ile-Gln-Asn-Cys-Pro-Leu-NH2(Cys1&Cys6 bridge); L-Cysteinyl-L-tyrosyl-L-isoleucyl-L-glutaminyl-L-asparagyl-L-cysteinyl-L-prolyl-L-leucinamide (1->6)-disulfide; [Des-Gly9]-Oxytocin; 8-L-Leucinamide-1-8-oxytocin; 8-L-Leucinamide-9-deglycinamide-oxytocin; 8-Leucinamide-9-deglycinamide-oxytocin; (S)-N-((S)-1-Amino-4-methyl-1-oxopentan-2-yl)-1-((4R,7S,10S,13S,16S,19R)-19-amino-7-(2-amino-2-oxoethyl)-10-(3-amino-3-oxopropyl)-13-((S)-sec-butyl)-16-(4-hydroxybenzyl)-6,9,12,15,18-pentaoxo-1,2-dithia-5,8,11,14,17-pentaazacycloicosane-4-carbonyl)pyrrolidine-2-carboxamide. Grade: >90%. CAS No. 13018-25-2. Molecular formula: C41H63N11O11S2. Mole weight: 950.14. BOC Sciences 7
Ethyl α-Bromoethylglyoxalate Ethyl α-Bromoethylglyoxalate is used in the preparations of potential positron emission tomography tracers for neuropeptide Y Y1 receptors. Group: Biochemicals. Alternative Names: 3-Bromo-2-oxobutanoic Acid Ethyl Ester; 3-Bromo-2-oxobutyric Acid Ethyl Ester; Ethyl 3-bromo-2-oxobutanoate; Ethyl 3-bromo-2-oxobutyrate; 3-Bromo-2-oxo-butanoic Acid Ethyl Ester. Grades: Highly Purified. CAS No. 57332-84-0. Pack Sizes: 1g. US Biological Life Sciences. USBiological 3
Worldwide
FAS Inhibitor, C75 (Trans-4-carboxy-5-octyl-3-methylene-butyrolactone) Inhibitor of fatty acid synthase (FAS) reducing food intake and body weight in mice. Exhibits irreversible slow-binding biphasic inactivation of FAS. Down regulates neuropeptide Y and Agouti-related protein expression. Has been proposed to activiate CPT-1 activity in liver and adipose tissue, leading to increased fatty acid oxidation and energy production. Shows significant in vivo antitumor activity in human breast cancer cells.Suppresses DNA replication and induces apoptosis. FAS inhibition by C75 leads to dramatic accumulation of the CDK inhibitor p27KIP1 from cytosol to cell nuclei. Group: Biochemicals. Alternative Names: [Trans-4-carboxy-5-octyl-3-methylene-butyrolactone]. Grades: Highly Purified. CAS No. 191282-48-1. Pack Sizes: 1mg. US Biological Life Sciences. USBiological 1
Worldwide
FR252384 FR252384 is novel potent antagonists of human neuropeptide Y-Y5 receptor (IC50= 2.3 nM). Synonyms: FR252384; FR 252384; FR-252384; 9-methyl-2-pyridin-3-yl-3,4,5,6-tetrahydrobenzo[2,3]cyclohepta[2,4-b]imidazole; Benzo[3,4]cyclohept[1,2-d]imidazole, 1,4,5,6-tetrahydro-9-methyl-2-(3-pyridinyl)-. CAS No. 447405-11-0. Molecular formula: C18H17N3. Mole weight: 275.35. BOC Sciences 8
Glu4,Asp5,Gly9-Oxytocin Glu4,Asp5,Gly9-Oxytocin is a modified analog of oxytocin with specific amino acid substitutions and modifications. Oxytocin is a peptide hormone and neuropeptide that plays crucial roles in various physiological processes. Oxytocin is best known for its functions in childbirth and lactation, where it helps to stimulate uterine contractions during labor and milk ejection during breastfeeding. Synonyms: Cys-Tyr-Ile-Glu-Asp-Cys-Pro-Leu-Gly(Cys1&Cys6 bridge); Glu4,Asp5,Gly9-OH-Oxytocin; 4-Glu-5-Asp-9-Gly-OH-oxytocin; L-Cysteinyl-L-tyrosyl-L-isoleucyl-L-alpha-glutamyl-L-alpha-aspartyl-L-cysteinyl-L-prolyl-L-leucyl-glycine (1->6)-disulfide; Oxytocin, 4-glutamic acid-5-aspartic acid-9-glycine; 3-((4R,7S,10S,13S,16S,19R)-19-Amino-13-((S)-sec-butyl)-7-(carboxymethyl)-4-((S)-2-(((S)-1-((carboxymethyl)amino)-4-methyl-1-oxopentan-2-yl)carbamoyl)pyrrolidine-1-carbonyl)-16-(4-hydroxybenzyl)-6,9,12,15,18-pentaoxo-1,2-dithia-5,8,11,14,17-pentaazacycloicosan-10-yl)propanoic acid; [Glu4,Asp5,Gly9]-Oxytocin. Grade: >95%. Molecular formula: C43H63N9O15S2. Mole weight: 1010.15. BOC Sciences 8
GR 231118 GR 231118 is a potent neuropeptide Y (NPY) Y1 receptor antagonist (pA2 = 10 and 10.5 at rY1 and hY1 receptors, respectively) and an NPY Y4 receptor agonist (pEC50 = 6.0, 8.6 and 6.1 for rY2, hY4 and rY5 receptors, respectively). GR 231118 inhibits food intake in rats in vivo. Synonyms: GR-231118; GR 231118; GR231118. Grade: >99%. CAS No. 158859-98-4. Molecular formula: C110H170N34O24. Mole weight: 2352.77. BOC Sciences
H-Phe-Met-Arg-Phe-NH2 H-Phe-Met-Arg-Phe-NH2 is a molluscan neuropeptide isolated from the ganglia of Macrocallista nimbosa. Synonyms: Fmrfamide; FMRF amide; (S)-N-((S)-1-Amino-1-oxo-3-phenylpropan-2-yl)-2-((S)-2-((S)-2-amino-3-phenylpropanamido)-4-(methylthio)butanamido)-5-guanidinopentanamide; Molluscan Cardioexcitatory Neuropeptide. CAS No. 152165-14-5. Molecular formula: C29H42N8O4S. Mole weight: 598.76. BOC Sciences 10
L 152804 L 152804 is an orally active and selective neuropeptide Y Y5 receptor (NPY5-R) antagonist, with a K i of 26 nM for hY5. L 152804 causes weight loss in diet-induced obese mice by modulating food intake and energy expenditure [1] [2]. Uses: Scientific research. Group: Signaling pathways. CAS No. 6508-43-6. Pack Sizes: 10 mM * 1 mL; 5 mg; 10 mg; 50 mg; 100 mg. Product ID: HY-107734. MedChemExpress MCE
L-Phenylalaninamide,l-prolyl-L-a-aspartyl-L-valyl-L-a-aspartyl-L-histidyl-L-valyl-L-phenylalanyl-L-Leucyl-l-arginyl- L-Phenylalaninamide,l-prolyl-L-a-aspartyl-L-valyl-L-a-aspartyl-L-histidyl-L-valyl-L-phenylalanyl-L-Leucyl-l-arginyl-. Uses: Designed for use in research and industrial production. Additional or Alternative Names: H-PRO-ASP-VAL-ASP-HIS-VAL-PHE-LEU-ARG-PHE-NH2;FMRF-LIKE PEPTIDE;FMRF-LIKE NEUROPEPTIDE;SCHISTOFLRFAMIDE;PRO-ASP-VAL-ASP-HIS-VAL-PHE-LEU-ARG-PHE AMIDE;PRO-ASP-VAL-ASP-HIS-VAL-PHE-LEU-ARG-PHE-NH2;pro-asp-val-asp-his-val-phe-leu-arg-phe-amidefromlocust;FMRF. Product Category: Heterocyclic Organic Compound. Appearance: White powder. CAS No. 121801-61-4. Molecular formula: C59H86N16O14. Mole weight: 1243.4129. Purity: 0.96. IUPACName: 4-[[1-[[1-[[1-[[1-[[1-[[1-[[1-[(1-amino-1-oxo-3-phenylpropan-2-yl)amino]-5-(diaminomethylideneamino)-1-oxopentan-2-yl]amino]-4-methyl-1-oxopentan-2-yl]amino]-1-oxo-3-phenylpropan-2-yl]amino]-3-methyl-1-oxobutan-2-yl]amino]-3-(1H-imidazol-5-yl)-1-oxopropan. Canonical SMILES: CC(C)CC(C(=O)NC(CCCN=C(N)N)C(=O)NC(CC1=CC=CC=C1)C(=O)N)NC(=O)C(CC2=CC=CC=C2)NC(=O)C(C(C)C)NC(=O)C(CC3=CN=CN3)NC(=O)C(CC(=O)O)NC(=O)C(C(C)C)NC(=O)C(CC(=O)O)NC(=O)C4CCCN4. Density: 1.42g/cm³. Product ID: ACM121801614. Alfa Chemistry — ISO 9001:2015 Certified. Alfa Chemistry. 5
L-Tyrosinamide,N-acetyl-L-Leucyl-L-arginyl-L-histidyl-L-tyrosyl-L-Leucyl-L-asparaginyl-L-Leucyl-L-Leucyl-l-threonyl-l-arginyl-l-glutaminyl-l-arginyl- L-Tyrosinamide,N-acetyl-L-Leucyl-L-arginyl-L-histidyl-L-tyrosyl-L-Leucyl-L-asparaginyl-L-Leucyl-L-Leucyl-l-threonyl-l-arginyl-l-glutaminyl-l-arginyl-. Uses: Designed for use in research and industrial production. Additional or Alternative Names: N-ACETYL-[LEU28, LEU31]NEUROPEPTIDE Y (24-36);N-ACETYL-[LEU28, LEU31]-NEUROPEPTIDE Y FRAGMENT 24-36;ACETYL-(LEU28,31)-NEUROPEPTIDE Y (24-36);ACETYL-(LEU28,31)-NPY (24-36);AC-[LEU28,31] NEUROPEPTIDE Y (24-36), HUMAN;AC-LEU-ARG-HIS-TYR-LEU-ASN-LEU-LEU-THR-. Product Category: Heterocyclic Organic Compound. CAS No. 155709-24-3. Molecular formula: C81H131N27O19. Mole weight: 1787.08. Product ID: ACM155709243. Alfa Chemistry — ISO 9001:2015 Certified. Alfa Chemistry. 3
Lu AA33810 Lu AA33810 is a potent and selective antagonist of neuropeptide Y5 receptor with a K i of 1.5 nM for the human receptor. Lu AA33810 exhibts antianxiolytic-like and antidepressant-like effects [1]. Uses: Scientific research. Group: Signaling pathways. CAS No. 304008-29-5. Pack Sizes: 1 mg. Product ID: HY-107729. MedChemExpress MCE
Neuropeptide S (human) Neuropeptide S (human), one of the "youngest" members among the biologically active peptides, is a potent endogenous neuropeptide S receptor agonist (EC50 = 9.4 nM), which modulates arousal, wakefulness, anxiety, fear-extinction, and fear memory consolidation. Synonyms: NPS (human); H-Ser-Phe-Arg-Asn-Gly-Val-Gly-Thr-Gly-Met-Lys-Lys-Thr-Ser-Phe-Gln-Arg-Ala-Lys-Ser-OH; L-seryl-L-phenylalanyl-L-arginyl-L-asparagyl-glycyl-L-valyl-glycyl-L-threonyl-glycyl-L-methionyl-L-lysyl-L-lysyl-L-threonyl-L-seryl-L-phenylalanyl-L-glutaminyl-L-arginyl-L-alanyl-L-lysyl-L-serine. Grade: ≥95%. CAS No. 412938-67-1. Molecular formula: C93H155N31O28S. Mole weight: 2187.48. BOC Sciences
NTNCB hydrochloride NTNCB (Compound 11) hydrochloride is a potent and selective neuropeptide Y Y5 (NPY Y5) receptor antagonist with a K i of 8 nM against human Y5 [1]. Uses: Scientific research. Group: Signaling pathways. CAS No. 191931-56-3. Pack Sizes: 5 mg; 10 mg; 25 mg; 50 mg; 100 mg. Product ID: HY-107733. MedChemExpress MCE

Would you like to list your products on USA Chemical Suppliers?

Our database is helping our users find suppliers everyday.

Add Your Products