Find where to buy products from suppliers in the USA, including: distributors, industrial manufacturers in America, bulk supplies and wholesalers of raw ingredients & finished goods.
Search for products or services, then visit the American suppliers website for prices, SDS or more information. You can also view suppliers in Australia, NZ or the UK.
| Product | Description | |
|---|---|---|
| Neuropeptide Y (13-36), amide, human | Neuropeptide Y (13-36), amide, human is a selective neuropeptide Y2 receptor agonist. Synonyms: Neuropeptide Y (13-36), human; Pro-Ala-Glu-Asp-Met-Ala-Arg-Tyr-Tyr-Ser-Ala-Leu-Arg-His-Tyr-Ile-Asn-Leu-Ile-Thr-Arg-Gln-Arg-Tyr-NH2; Neuropeptide Y (13-36) (human, rat); L-prolyl-L-alanyl-L-alpha-glutamyl-L-alpha-aspartyl-L-methionyl-L-alanyl-L-arginyl-L-tyrosyl-L-tyrosyl-L-seryl-L-alanyl-L-leucyl-L-arginyl-L-histidyl-L-tyrosyl-L-isoleucyl-L-asparagyl-L-leucyl-L-isoleucyl-L-threonyl-L-arginyl-L-glutaminyl-L-arginyl-L-tyrosinamide. Grades: 95%. CAS No. 122341-40-6. Molecular formula: C134H207N41O36S. Mole weight: 3000.39. |  |
| Neuropeptide Y (13-36), porcine | Neuropeptide Y (13-36), porcine is a selective neuropeptide Y 2 receptor agonist [1]. Uses: Scientific research. Group: Peptides. Alternative Names: NPY 13-36. CAS No. 113662-54-7. Pack Sizes: 1 mg; 5 mg; 10 mg. Product ID: HY-P1011. |  |
| Neuropeptide Y 13-36 (porcine) | Neuropeptide Y 13-36 (porcine) is a selective neuropeptide Y2 receptor agonist (Ki = 0.18 nM). It mimics the effects of NPY at presynaptic receptors in vas deferens. Synonyms: H-Pro-Ala-Glu-Asp-Leu-Ala-Arg-Tyr-Tyr-Ser-Ala-Leu-Arg-His-Tyr-Ile-Asn-Leu-Ile-Thr-Arg-Gln-Arg-Tyr-NH2. CAS No. 113662-54-7. Molecular formula: C135H209N41O36. Mole weight: 2982.36. | |
| Neuropeptide Y 22-36 | Neuropeptide Y(22-36) is a fragment of neuropeptide Y containing 15 amino acids. Synonyms: Neuropeptide Y (22-36) pig; Ser-Ala-Leu-Arg-His-Tyr-Ile-Asn-Leu-Ile-Thr-Arg-Gln-Arg-Tyr-NH2; L-Seryl-L-alanyl-L-leucyl-L-arginyl-L-histidyl-L-tyrosyl-L-isoleucyl-L-asparaginyl-L-leucyl-L-isoleucyl-L-threonyl-L-arginyl-L-glutaminyl-L-arginyl-L-tyrosinamide; NPY 22-36, porcine. Grades: 95%. CAS No. 119019-65-7. Molecular formula: C85H139N29O21. Mole weight: 1903.19. | |
| Neuropeptide y(2-36)(human,rat) | Neuropeptide y(2-36)(human,rat). Uses: Designed for use in research and industrial production. Additional or Alternative Names: H-PRO-SER-LYS-PRO-ASP-ASN-PRO-GLY-GLU-ASP-ALA-PRO-ALA-GLU-ASP-MET-ALA-ARG-TYR-TYR-SER-ALA-LEU-ARG-HIS-TYR-ILE-ASN-LEU-ILE-THR-ARG-GLN-ARG-TYR-NH2;PRO-SER-LYS-PRO-ASP-ASN-PRO-GLY-GLU-ASP-ALA-PRO-ALA-GLU-ASP-MET-ALA-ARG-TYR-TYR-SER-ALA-LEU-ARG-HIS-TYR-ILE-. Product Category: Heterocyclic Organic Compound. CAS No. 123139-39-9. Molecular formula: C180H276N54O55S. Product ID: ACM123139399. Alfa Chemistry ISO 9001:2015 Certified. |  |
| Neuropeptide Y (29-64) | Neuropeptide Y is a 36 amino-acid neuropeptide that is involved in various physiological and homeostatic processes in both the central and peripheral nervous systems. Synonyms: Tyr-Pro-Ser-Lys-Pro-Asp-Asn-Pro-Gly-Glu-Asp-Ala-Pro-Ala-Glu-Asp-Met-Ala-Arg-Tyr-Tyr-Ser-Ala-Leu-Arg-His-Tyr-Ile-Asn-Leu-Ile-Thr-Arg-Gln-Arg-Tyr; L-tyrosyl-L-prolyl-L-seryl-L-lysyl-L-prolyl-L-alpha-aspartyl-L-asparagyl-L-prolyl-glycyl-L-alpha-glutamyl-L-alpha-aspartyl-L-alanyl-L-prolyl-L-alanyl-L-alpha-glutamyl-L-alpha-aspartyl-L-methionyl-L-alanyl-L-arginyl-L-tyrosyl-L-tyrosyl-L-seryl-L-alanyl-L-leucyl-L-arginyl-L-histidyl-L-tyrosyl-L-isoleucyl-L-asparagyl-L-leucyl-L-isoleucyl-L-threonyl-L-arginyl-L-glutaminyl-L-arginyl-L-tyrosine. Grades: ≥95%. CAS No. 303052-45-1. Molecular formula: C189H284N54O58S. Mole weight: 4272.66. | |
| Neuropeptide Y (3-36) (human, rat) | Neuropeptide Y (3-36) (human, rat) is a neuropeptide Y (NPY) metabolite formed by dipeptidyl peptidase-4 (DPP4) and is a selective Y2/Y5 receptor agonist. It is a major degradation product of NPY in serum, and reduces norepinephrine release through the Y2 receptor. Synonyms: Neuropeptide Y Fragment 3-36 human, rat; H-Ser-Lys-Pro-Asp-Asn-Pro-Gly-Glu-Asp-Ala-Pro-Ala-Glu-Asp-Met-Ala-Arg-Tyr-Tyr-Ser-Ala-Leu-Arg-His-Tyr-Ile-Asn-Leu-Ile-Thr-Arg-Gln-Arg-Tyr-NH2; NPY 3-36 human, rat; L-seryl-L-lysyl-L-prolyl-L-alpha-aspartyl-L-asparagyl-L-prolyl-glycyl-L-alpha-glutamyl-L-alpha-aspartyl-L-alanyl-L-prolyl-L-alanyl-L-alpha-glutamyl-L-alpha-aspartyl-L-methionyl-L-alanyl-L-arginyl-L-tyrosyl-L-tyrosyl-L-seryl-L-alanyl-L-leucyl-L-arginyl-L-histidyl-L-tyrosyl-L-isoleucyl-L-asparagyl-L-leucyl-L-isoleucyl-L-threonyl-L-arginyl-L-glutaminyl-L-arginyl-L-tyrosinamide. Grades: ≥95%. CAS No. 150138-78-6. Molecular formula: C175H269N53O54S. Mole weight: 4011.45. | |
| Neuropeptide Y (free acid) (human, rat) | Neuropeptide Y is a 36 amino-acid neuropeptide that is involved in various physiological and homeostatic processes in both the central and peripheral nervous systems. Synonyms: H-Tyr-Pro-Ser-Lys-Pro-Asp-Asn-Pro-Gly-Glu-Asp-Ala-Pro-Ala-Glu-Asp-Met-Ala-Arg-Tyr-Tyr-Ser-Ala-Leu-Arg-His-Tyr-Ile-Asn-Leu-Ile-Thr-Arg-Gln-Arg-Tyr-NH2; NPY (free acid) (human, rat); Neuropeptide Y, human, rat. Grades: ≥95%. CAS No. 99575-89-0. Molecular formula: C189H285N55O57S. Mole weight: 4271.74. | |
| Neuropeptide Y, Human - CAS 90880-35-6 | A potent vasoconstrictor. Group: Fluorescence/luminescence spectroscopy. |  |
| Neuropeptide Y (human, rat) | Neuropeptide Y (human, rat) is a widely distributed endogenous neuropeptide involved in the control of food intake, sexual behavior and blood pressure. NPY has also been shown to interact with the immune system, promoting gastrointestinal inflammation, as well as exhibiting an antimicrobial effect against several gut bacteria. Synonyms: NPY (human, rat). CAS No. 90880-35-6. Molecular formula: C189H285N55O57S. Mole weight: 4271.7. | |
| Neuropeptide Y (human,rat,mouse) | Neuropeptide Y (human,rat,mouse) is involved in Alzheimer's disease (AD) and protects rat cortical neurons against β-Amyloid toxicity. Uses: Scientific research. Group: Peptides. Alternative Names: Neuropeptide Y (29-64), amide. CAS No. 90880-35-6. Pack Sizes: 1 mg; 5 mg; 10 mg. Product ID: HY-P0198. | |
| Neuropeptide Y-Lys(biotinyl) (free acid) (human, rat) | Synonyms: NPY-Lys(biotinyl) (human, rat); H-Tyr-Pro-Ser-Lys-Pro-Asp-Asn-Pro-Gly-Glu-Asp-Ala-Pro-Ala-Glu-Asp-Met-Ala-Arg-Tyr-Tyr-Ser-Ala-Leu-Arg-His-Tyr-Ile-Asn-Leu-Ile-Thr-Arg-Gln-Arg-Tyr-Lys(biotinyl)-OH. Grades: ≥95%. CAS No. 1927927-12-5. Molecular formula: C205H310N58O61S2. Mole weight: 4627.14. | |
| Neuropeptide Y (porcine) | Neuropeptide Y (porcine) is a widely distributed endogenous neuropeptide involved in regulation of circadian rhythms, sexual functioning, anxiety and stress response, and regulation of food intake (Ki= 0.17, 0.04 nM at human and Y2 respectively). It inhibits cholecystokinin- and secretin-stimulated pancreatic secretion. Synonyms: H-Tyr-Pro-Ser-Lys-Pro-Asp-Asn-Pro-Gly-Glu-Asp-Ala-Pro-Ala-Glu-Asp-Leu-Ala-Arg-Tyr-Tyr-Ser-Ala-Leu-Arg-His-Tyr-Ile-Asn-Leu-Ile-Thr-Arg-Gln-Arg-Tyr-NH2. CAS No. 83589-17-7. Molecular formula: C190H287N55O57. Mole weight: 4254. | |
| Neuropeptide Y (scrambled) | Neuropeptide Y (scrambled) is the control peptide for neuropeptide Y (NPY). Neuropeptide Y is a widely distributed endogenous neuropeptide involved in the control of food intake, sexual behavior and blood pressure. Synonyms: SKPQRDANREPTRYAIYDYSNPDIELHYLRPAYALG-NH2. Molecular formula: C190H287N55O57. Mole weight: 4253.7. | |
| ((Cys31,nva34)-neuropeptide y(27-36))2 | ((Cys31,nva34)-neuropeptide y(27-36))2. Uses: Designed for use in research and industrial production. Additional or Alternative Names: ((CYS31,NVA34)-NEUROPEPTIDE Y (27-36))2;((CYS31,NVA34)-NPY (27-36))2;BWX 46;(H-TYR-ILE-ASN-LEU-CYS-THR-ARG-NVA-ARG-TYR-NH2)2;(H-Tyr-Ile-Asn-Leu-Cys-Thr-Arg-Nva-Arg-Tyr-NH2)2, (Disulfide bond). Product Category: Heterocyclic Organic Compound. CAS No. 172997-92-1. Molecular formula: C116H186N36O28S2. Mole weight: 2597.07. Product ID: ACM172997921. Alfa Chemistry ISO 9001:2015 Certified. | |
| ((Cys31,Nva34)-Neuropeptide Y (27-36))2 | A potent Neuropeptide Y Y5 receptor agonist. Synonyms: ((Cys31,Nva34)-NPY (27-36))2; BWX 46; (H-Tyr-Ile-Asn-Leu-Cys-Thr-Arg-Nva-Arg-Tyr-NH2)2; (H-Tyr-Ile-Asn-Leu-Cys-Thr-Arg-Nva-Arg-Tyr-NH2)2, (Disulfide bond). Grades: 98%. CAS No. 172997-92-1. Molecular formula: C116H186N36O28S2. Mole weight: 2597.07. | |
| (d-Trp32)-neuropeptide y(human,rat) | (d-Trp32)-neuropeptide y(human,rat). Uses: Designed for use in research and industrial production. Additional or Alternative Names: YPSKPDNPGEDAPAEDMARYYSALRHYINLIWRQRY-NH2;TYR-PRO-SER-LYS-PRO-ASP-ASN-PRO-GLY-GLU-ASP-ALA-PRO-ALA-GLU-ASP-MET-ALA-ARG-TYR-TYR-SER-ALA-LEU-ARG-HIS-TYR-ILE-ASN-LEU-ILE-D-TRP-ARG-GLN-ARG-TYR-NH2;(D-TRP32)-NEUROPEPTIDE Y (HUMAN, RAT);[DTRP32]NEUROPEPTIDE Y (1. Product Category: Heterocyclic Organic Compound. CAS No. 178861-83-1. Molecular formula: C196H288N56O56S. Product ID: ACM178861831. Alfa Chemistry ISO 9001:2015 Certified. | |
| [D-Trp34]-Neuropeptide Y | [D-Trp34]-Neuropeptide Y is a potent and selective neuropeptide Y (NPY) Y 5 receptor agonist. [D-Trp34]-Neuropeptide Y is a significantly less potent agonist at the NPY Y 1 , Y 2 , Y 4 , and y 6 receptors. [D-Trp34]-Neuropeptide Y markedly increases food intake in rats [1] [2]. Uses: Scientific research. Group: Peptides. CAS No. 153549-84-9. Pack Sizes: 5 mg; 10 mg. Product ID: HY-P1322. | |
| [D-Trp34]-Neuropeptide Y | [D-Trp34]-Neuropeptide Y is a potent and selective NPY Y(5) receptor agonist (pEC50= 7.82, 6.28, 6.44 and > 6 at rat Y5, Y4, Y1 and Y2 receptors respectively), with > 26-fold, > 1000-fold and > 1000-fold selectivity over Y1, Y2 and Y4 receptors respectively. Unlike the prototype selective NPY Y(5) receptor agonist [D-Trp(32)]NPY, [D-Trp(34)]NPY markedly increases food intake in rats, an effect that is blocked by the selective NPY Y(5) receptor antagonist CGP 71683A. Synonyms: Tyr-Pro-Ser-Lys-Pro-Asp-Asn-Pro-Gly-Glu-Asp-Ala-Pro-Ala-Glu-Asp-Met-Ala-Arg-Tyr-Tyr-Ser-Ala-Leu-Arg-His-Tyr-Ile-Asn-Leu-Ile-Thr-Arg-D-Trp-Arg-Tyr-NH2. CAS No. 153549-84-9. Molecular formula: C196H289N55O56. Mole weight: 4311.77. | |
| (His32,leu34)-neuropeptide y(32-36) | (His32,leu34)-neuropeptide y(32-36). Uses: Designed for use in research and industrial production. Additional or Alternative Names: H-HIS-ARG-LEU-ARG-TYR-NH2;(HIS32,LEU34)-NEUROPEPTIDE Y (32-36);(HIS32,LEU34)-NPY (32-36);HIS-ARG-LEU-ARG-TYR-NH2. Product Category: Heterocyclic Organic Compound. CAS No. 168916-68-5. Molecular formula: C33H54N14O6. Mole weight: 742.87. Purity: 0.96. IUPACName: (2S)-N-[(2S)-1-[[(2S)-1-amino-3-(4-hydroxyphenyl)-1-oxopropan-2-yl]amino]-5-(diaminomethylideneamino)-1-oxopentan-2-yl]-2-[[(2S)-2-[[(2S)-2-amino-3-(1H-imidazol-5-yl)propanoyl]amino]-5-(diaminomethylideneamino)pentanoyl]amino]-4-methylpentanamide. Canonical SMILES: CC(C)CC(C(=O)NC(CCCN=C(N)N)C(=O)NC(CC1=CC=C(C=C1)O)C(=O)N)NC(=O)C(CCCN=C(N)N)NC(=O)C(CC2=CN=CN2)N. Product ID: ACM168916685. Alfa Chemistry ISO 9001:2015 Certified. | |
| [Leu31,Pro34]-Neuropeptide Y (human, rat) | [Leu31,Pro34]-Neuropeptide Y (human, rat) is a high affinity neuropeptide Y Y1 receptor agonist (Ki = 0.39 nM). Synonyms: [Leu31,Pro34]-NPY (human, rat); H-Tyr-Pro-Ser-Lys-Pro-Asp-Asn-Pro-Gly-Glu-Asp-Ala-Pro-Ala-Glu-Asp-Met-Ala-Arg-Tyr-Tyr-Ser-Ala-Leu-Arg-His-Tyr-Ile-Asn-Leu-Leu-Thr-Arg-Pro-Arg-Tyr-NH2; L-tyrosyl-L-prolyl-L-seryl-L-lysyl-L-prolyl-L-alpha-aspartyl-L-asparagyl-L-prolyl-glycyl-L-alpha-glutamyl-L-alpha-aspartyl-L-alanyl-L-prolyl-L-alanyl-L-alpha-glutamyl-L-alpha-aspartyl-L-methionyl-L-alanyl-L-arginyl-L-tyrosyl-L-tyrosyl-L-seryl-L-alanyl-L-leucyl-L-arginyl-L-histidyl-L-tyrosyl-L-isoleucyl-L-asparagyl-L-leucyl-L-leucyl-L-threonyl-L-arginyl-L-prolyl-L-arginyl-L-tyrosinamide. Grades: ≥95%. CAS No. 132699-73-1. Molecular formula: C189H284N54O56S. Mole weight: 4240.67. | |
| [Leu31,Pro34] Neuropeptide Y (human) trifluoroacetate salt | [Leu31,Pro34] Neuropeptide Y (NPY) is an agonist of the NPY receptors Y1 and Y5. Synonyms: [Leu31,Pro34] NPY; [Leu31,Pro34]-NPY (human). Grades: ≥95%. Molecular formula: C189H284N54O56S·xCF3COOH. Mole weight: 4240.67. | |
| [Leu31,Pro34]-Neuropeptide Y (porcine) | [Leu31,Pro34]- Neuropeptide Y (porcine), a Neuropeptide Y (NPY) analog, is a selective NPY Y1 receptor agonist. [Leu31,Pro34]- Neuropeptide Y (porcine) exhibits anxiolytic effects [1] [2]. Uses: Scientific research. Group: Peptides. CAS No. 125580-28-1. Pack Sizes: 5 mg; 10 mg. Product ID: HY-P0208. | |
| [Leu31,Pro34]-Neuropeptide Y (porcine) | [Leu31,Pro34]-Neuropeptide Y (porcine) is a high affinity neuropeptide Y Y1 receptor agonist (Ki = 0.54 nM). Synonyms: (Leu(31),pro(34))npy; 31-Leu-34-pro-neuropeptide Y; Pancreatic polypeptide (chicken), 1-L-tyrosine-4-L-lysine-6-L-aspartic acid-7-L-asparagine-10-L-glutamic acid-14-L-alanine-18-L-alanine-20-L-tyrosine-22-L-serine-23-L-alanine-25-L-arginine-26-L-histidine-28-L-isoleucine-30-L-leucine-31-L-leucine-34-L-proline. CAS No. 125580-28-1. Molecular formula: C190H286N54O56. Mole weight: 4222.63. | |
| Neuropeptidey(swine),31-L-Leucine-34-l-proline- | Neuropeptidey(swine),31-L-Leucine-34-l-proline-. Uses: Designed for use in research and industrial production. Additional or Alternative Names: [LEU31,PRO34] NEUROPEPTIDE Y (1-36), PORCINE;[LEU31, PRO34]-NEUROPEPTIDE Y, HUMAN, PORCINE;(LEU31,PRO34)-NEUROPEPTIDE Y (PORCINE);[LEU31, PRO34]-NEUROPEPTIDE Y (PORCINE) (BOVINE);(LEU31,PRO34)-NPY (PORCINE);[LEU31, PRO34]-NPY (PORCINE) (BOVINE);ANTI-NSEC. Product Category: Heterocyclic Organic Compound. CAS No. 125580-28-1. Molecular formula: C190H286N54O56. Mole weight: 4222.63. Purity: 0.96. Canonical SMILES: CCC(C)C(C(=O)NC(CC(=O)N)C(=O)NC(CC(C)C)C(=O)NC(CC(C)C)C(=O)NC(C(C)O)C(=O)NC(CCCNC(=N)N)C(=O)N1CCCC1C(=O)NC(CCCNC(=N)N)C(=O)NC(CC2=CC=C(C=C2)O)C(=O)N)NC(=O)C(CC3=CC=C(C=C3)O)NC(=O)C(CC4=CNC=N4)NC(=O)C(CCCNC(=N)N)NC(=O)C(CC(C)C)NC(=O)C(C)NC(=O)C(CO)NC(=O)C(CC5=CC=C(C=C5)O)NC(=O)C(CC6=CC=C(C=C6)O)NC(=O)C(CCCNC(=N)N)NC(=O)C(C)NC(=O)C(CC(C)C)NC(=O)C(CC(=O)O)NC(=O)C(CCC(=O)O)NC(=O)C(C)NC(=O)C7CCCN7C(=O)C(C)NC(=O)C(CC(=O)O)NC(=O)C(CCC(=O)O)NC(=O)CNC(=O)C8CCCN8C(=O)C(CC(=O)N)NC(=O)C(CC(=O)O)NC(=O)C9CCCN9C(=O)C(CCCCN)NC(=O)C(CO)NC(=O)C1CCCN1C(=O)C(CC1=CC=C(C=C1)O)N. Product ID: ACM125580281. Alfa Chemistry ISO 9001:2015 Certified. | |
| [O-Methyl-Tyr21]-Neuropeptide Y human | ?97% (HPLC). Group: Fluorescence/luminescence spectroscopy. | |
| (Pro30,tyr32,leu34)-neuropeptide y(28-36) | (Pro30,tyr32,leu34)-neuropeptide y(28-36). Uses: Designed for use in research and industrial production. Additional or Alternative Names: (PRO30,TYR32,LEU34)-NEUROPEPTIDE Y (28-36);(PRO30,TYR32,LEU34)-NPY (28-36);H-ILE-ASN-PRO-ILE-TYR-ARG-LEU-ARG-TYR-NH2;ILE-ASN-PRO-ILE-TYR-ARG-LEU-ARG-TYR-NH2. Product Category: Heterocyclic Organic Compound. CAS No. 161650-01-7. Molecular formula: C57H91N17O12. Mole weight: 1206.44. Purity: 0.96. IUPACName: (2S)-1-[(2S)-4-amino-2-[[(2S,3S)-2-amino-3-methylpentanoyl]amino]-4-oxobutanoyl]-N-[(2S,3S)-1-[[(2S)-1-[[(2S)-1-[[(2S)-1-[[(2S)-1-[[(2S)-1-amino-3-(4-hydroxyphenyl)-1-oxopropan-2-yl]amino]-5-(diaminomethylideneamino)-1-oxopentan-2-yl]amino]-4-methyl-1-oxo. Canonical SMILES: CCC(C)C(C(=O)NC(CC(=O)N)C(=O)N1CCCC1C(=O)NC(C(C)CC)C(=O)NC(CC2=CC=C(C=C2)O)C(=O)NC(CCCN=C(N)N)C(=O)NC(CC(C)C)C(=O)NC(CCCN=C(N)N)C(=O)NC(CC3=CC=C(C=C3)O)C(=O)N)N. Product ID: ACM161650017. Alfa Chemistry ISO 9001:2015 Certified. | |
| 1-Methyl-3-azetidinemethanamine | 1-Methyl-3-azetidinemethanamine is a derivative of Azetidine (A813000); a useful building block in the synthesis of polypeptides and other nitrogen containing compounds with potential biological properties. 1-Methyl-3-azetidinemethanamine is also used as a reagent in the synthesis of amidinourea derivatives as neuropeptide Y ligands. Group: Biochemicals. Grades: Highly Purified. CAS No. 1359656-98-6. Pack Sizes: 250mg, 2.5g. Molecular Formula: C5H12N2, Molecular Weight: 100.16. US Biological Life Sciences. |  Worldwide |
| 2-Oxopiperidine-4-carboxylic Acid | 2-Oxopiperidine-4-carboxylic Acid can be synthesized from 2-Hydroxyisonicitonic Acid (H942895), a compound used in the synthesis of selective inhibitors of neuropeptide Y Y5 inhibiting food intake. 2-Hydroxyisonicitonic Acid is also used in the optimization of p-subsite residues of HIV protease inhibitors. Group: Biochemicals. Grades: Highly Purified. CAS No. 24537-50-6. Pack Sizes: 100mg, 250mg. Molecular Formula: C6H9NO3, Molecular Weight: 143.139999999999. US Biological Life Sciences. | Worldwide |
| 2-Oxopropanoic Acid Chloride | 2-Oxopropanoic Acid Chloride is a reactant used to derive a series of neuropeptide Y (NPY) Y5 receptor antagonists from the biphenylurea, which exhibits excellent pharmacokinetic parameters in rats and dogs. Group: Biochemicals. Grades: Highly Purified. CAS No. 5704-66-5. Pack Sizes: 100mg, 250mg. Molecular Formula: C3H3ClO2, Molecular Weight: 106.51. US Biological Life Sciences. | Worldwide |
| 2-(Phenoxymethyl)-4-[3-(1-piperidinyl)propoxy]-1-[3-(4-piperidinyl)propyl]- | A diaminoalkyl substituted benzimidazole as neuropeptide Y Y1 receptor antagonists. Group: Biochemicals. Grades: Highly Purified. CAS No. 226416-58-6. Pack Sizes: 10mg. US Biological Life Sciences. | Worldwide |
| Apelin-13 | Apelin-13, an endogenous neuropeptide, is the ligand for the G-protein-coupled receptor APJ, an alternative coreceptor with CD4 for HIV-1 infection. Apelin-13 is generated from apelin-36, which is a putative receptor protein related to the angiotensin receptor (AT1). Apelin-13 exerted an acidification-rate-promoting activity in the CHO cells expressing the APJ receptor with EC50 value of 0.37 nM. Apelin-13 is a 13 amino acid polypeptide encoded by the apelin gene which yields a pre-proprotein that is processed to generate bioactive peptides. Apelin-13 is also involved in the learning and memory process. Synonyms: Apelin-13 (human, bovine, mouse, rat); H-Gln-Arg-Pro-Arg-Leu-Ser-His-Lys-Gly-Pro-Met-Pro-Phe-OH; L-glutaminyl-L-arginyl-L-prolyl-L-arginyl-L-leucyl-L-seryl-L-histidyl-L-lysyl-glycyl-L-prolyl-L-methionyl-L-prolyl-L-phenylalanine. Grades: ≥95%. CAS No. 217082-58-1. Molecular formula: C69H111N23O16S. Mole weight: 1550.85. | |
| BIBP 3226 | BIBP 3226 is a mixed non-peptide neuropeptide Y Y1 (NPY Y1) and neuropeptide FF (NPFF) receptor antagonist (Ki = 1.1, 79, 108, >1000, >1000 and >1000 for rNPY Y1, hNPFF2, rNPFF, rNPY Y2, rNPY Y4 and rNPY Y5, respectively). It exhibits an anxiogenic-like effect in rats following i.c.v. administration. Synonyms: BIBP3226; BIBP-3226; N2-(Diphenylacetyl)-N-[(4-hydroxyphenyl)methyl]-D-arginine amide; (R)-2-Diphenylacetylamino-5-guanidino-pentanoic acid 4-hydroxy-benzylamide; N5-(Diaminomethylene)-N2-(2,2-diphenylacetyl)-N-(4-hydroxybenzyl)-D-ornithinamide; N-[ (1R) ]-4-[ (Aminoiminomethyl) amino-1-[[[ (4-hydroxyphenyl) methyl]amino]carbonyl]butyl-α -phenylbenzeneacetamide; Diphenylacetyl-D-Arg-4-hydroxybenzylamide. Grades: ≥98%. CAS No. 159013-54-4. Molecular formula: C27H31N5O3. Mole weight: 473.57. | |
| BIBP 3226 TFA | BIBP 3226 trifluoroacetate is a mixed non-peptide neuropeptide Y Y1 (NPY Y1) and neuropeptide FF (NPFF) receptor antagonist (Ki = 1.1, 79, 108, > 1000, > 1000 and >1000 for rNPY Y1, hNPFF2, rNPFF, rNPY Y2, rNPY Y4 and rNPY Y5, respectively). BIBP 3226 exhibits an anxiogenic-like effect in rats following i.c.v. administration. Synonyms: BIBP 3226 trifluoroacetate; BIBP3226 trifluoroacetate; BIBP-3226 trifluoroacetate; N-[ (1R) ]-4-[ (Aminoiminomethyl) amino-1-[[[ (4-hydroxyphenyl) methyl]amino]carbonyl]butyl-α -phenylbenzeneacetamide trifluoroacetate; N5-(Diaminomethylene)-N2-(2,2-diphenylacetyl)-N-(4-hydroxybenzyl)-D-ornithinamide trifluoroacetate; Diphenylacetyl-D-Arg-4-hydroxybenzylamide trifluoroacetate. Grades: ≥98% by HPLC. CAS No. 1068148-47-9. Molecular formula: C27H31N5O3.C2HF3O2. Mole weight: 587.59. | |
| BIBP3226 TFA | BIBP3226 TFA is a potent and selective neuropeptide Y Y1 (NPY Y1) and neuropeptide FF (NPFF) receptor antagonist, with K i s of 1.1, 79, and 108 nM for rNPY Y1, hNPFF2, and rNPFF, respectively. BIBP3226 TFA displays anxiogenic-like effect [1] [2]. Uses: Scientific research. Group: Signaling pathways. CAS No. 1068148-47-9. Pack Sizes: 5 mg; 10 mg; 25 mg; 50 mg; 100 mg. Product ID: HY-107726. | |
| BIIE 0246 | BIIE 0246 is a potent, selective and non-peptide antagonist which binds to the neuropeptide Y Y2 receptor (IC50 = 15 nM) with > 650-fold selectivity over Y1, Y4 and Y5 receptors. Synonyms: (2S) -5- (diaminomethylideneamino) -N- [2- (3, 5-dioxo-1, 2-diphenyl-1, 2, 4-triazolidin-4-yl) ethyl] -2- [ [2- [1- [2-oxo-2- [4- (6-oxo-5, 11-dihydrobenzo [c] [1] benzazepin-11-yl) piperazin-1-yl] ethyl] cyclopentyl] acetyl] amino] pentanamide; BIIE-0246; BIIE 0246; BIIE-0246; CHEMBL540989; GTPL1547; CTK8E9439; BIIE0246. Grades: >98 %. CAS No. 246146-55-4. Molecular formula: C49H57N11O6. Mole weight: 896.05. | |
| BIIE-0246 | BIIE-0246 (AR-H 053591) is a potent and selective NPY2R (neuropeptide Y receptor 2) antagonist with an IC 50 value of 15 nM for rat [ 125 I]PYY 3-36. BIIE-0246 decreases the expression of p-AKT S473, P-p44/42 MAPK under the NPY-stimulated. BIIE-0246 reduces albuminuria in ADR nephropathy [1] [2] [3]. Uses: Scientific research. Group: Signaling pathways. Alternative Names: AR-H 053591. CAS No. 246146-55-4. Pack Sizes: 10 mM * 1 mL; 5 mg; 10 mg; 25 mg; 50 mg; 100 mg. Product ID: HY-101986. | |
| BMS-192548 | BMS-192548 is a neuropeptide Y (NPY) receptor binding inhibitor produced by Aspergillus niger WB2346. It also has weak cytotoxicity, with an IC50 of 240 μmol/L for murine tumor cells M-109. Synonyms: TAN-1612. CAS No. 156368-93-3. Molecular formula: C21H18O9. Mole weight: 414.36. | |
| BMS-193885 | BMS-193885 is a potent and selective neuropeptide Y1 receptor antagonist with IC50=5.9nM, Ki=3.3 nM. BMS-193885 displays > 47, > 100, > 160, > 160 and > 160-fold selectivity over σ1, α1, Y2, Y4 and Y5 receptors respectively. Synonyms: dimethyl 4-[3-[3-[4-(3-methoxyphenyl)piperidin-1-yl]propylcarbamoylamino]phenyl]-2,6-dimethyl-1,4-dihydropyridine-3,5-dicarboxylate; BMS 193885; 679839-66-8BMS-193885; BMS193885; BMS 193885. Grades: >98%. CAS No. 186185-03-5. Molecular formula: C33H42N4O6. Mole weight: 590.71. | |
| BMS-193885 salt | BMS-193885 is a potent and selective neuropeptide Y1 receptor antagonist with IC50=5.9nM, Ki=3.3 nM. BMS-193885 displays > 47, > 100, > 160, > 160 and > 160-fold selectivity over σ1, α1, Y2, Y4 and Y5 receptors respectively. Synonyms: BMS 193885; BMS193885; 1, 4-dihydro-4- [3- [ [ [ [3- [4- (3-methoxyphenyl) -1-piperidinyl] propyl] amino] carbonyl] amino] phenyl] -2, 6-dimethyl-3, 5-dimethyl ester-3,5-pyridinedicarboxylic acid. Grades: >98%. CAS No. 679839-66-8. Molecular formula: C36H48N4O9. Mole weight: 680.79. | |
| CART (55-102) (human) | Cocaine- and amphetamine-regulated transcript (CART) is a neuropeptide protein with potent appetite-suppressing activity. It inhibits normal and starvation-induced feeding and blocks the neuropeptide Y-induced feeding response. Synonyms: H-Val-Pro-Ile-Tyr-Glu-Lys-Lys-Tyr-Gly-Gln-Val-Pro-Met-Cys-Asp-Ala-Gly-Glu-Gln-Cys-Ala-Val-Arg-Lys-Gly-Ala-Arg-Ile-Gly-Lys-Leu-Cys-Asp-Cys-Pro-Arg-Gly-Thr-Ser-Cys-Asn-Ser-Phe-Leu-Leu-Lys-Cys-Leu-OH (Disulfide bridge: Cys14-Cys32, Cys20-Cys40, Cys34-Cys47); L-valyl-L-prolyl-L-isoleucyl-L-tyrosyl-L-alpha-glutamyl-L-lysyl-L-lysyl-L-tyrosyl-glycyl-L-glutaminyl-L-valyl-L-prolyl-L-methionyl-L-cysteinyl-L-alpha-aspartyl-L-alanyl-glycyl-L-alpha-glutamyl-L-glutaminyl-L-cysteinyl-L-alanyl-L-valyl-L-arginyl-L-lysyl-glycyl-L-alanyl-L-arginyl-L-isoleucyl-glycyl-L-lysyl-L-leucyl-L-cysteinyl-L-alpha-aspartyl-L-cysteinyl-L-prolyl-L-arginyl-glycyl-L-threonyl-L-seryl-L-cysteinyl-L-asparagyl-L-seryl-L-phenylalanyl-L-leucyl-L-leucyl-L-lysyl-L-cysteinyl-L-leucine (14->32),(20->40),(34->47)-tris(disulfide). Grades: ≥95%. CAS No. 214050-22-3. Molecular formula: C225H365N65O65S7. Mole weight: 5245.18. | |
| CART(55-102)(human) | CART(55-102)(human) is an endogenous satiety factor with potent appetite-suppressing activity. CART(55-102)(human) is closely associated with leptin and neuropeptide Y [1] [2]. Uses: Scientific research. Group: Peptides. CAS No. 214050-22-3. Pack Sizes: 1 mg; 5 mg; 10 mg. Product ID: HY-P1304. | |
| CART (55-102) (rat) | Cocaine- and amphetamine-regulated transcript (CART) is a neuropeptide protein with potent appetite-suppressing activity. It inhibits normal and starvation-induced feeding and blocks the neuropeptide Y-induced feeding response. Uses: Appetite suppressant. Synonyms: H-Ile-Pro-Ile-Tyr-Glu-Lys-Lys-Tyr-Gly-Gln-Val-Pro-Met-Cys-Asp-Ala-Gly-Glu-Gln-Cys-Ala-Val-Arg-Lys-Gly-Ala-Arg-Ile-Gly-Lys-Leu-Cys-Asp-Cys-Pro-Arg-Gly-Thr-Ser-Cys-Asn-Ser-Phe-Leu-Leu-Lys-Cys-Leu-OH (Disulfide bridge: Cys14-Cys32, Cys20-Cys40, Cys34-Cys37); L-isoleucyl-L-prolyl-L-isoleucyl-L-tyrosyl-L-alpha-glutamyl-L-lysyl-L-lysyl-L-tyrosyl-glycyl-L-glutaminyl-L-valyl-L-prolyl-L-methionyl-L-cysteinyl-L-alpha-aspartyl-L-alanyl-glycyl-L-alpha-glutamyl-L-glutaminyl-L-cysteinyl-L-alanyl-L-valyl-L-arginyl-L-lysyl-glycyl-L-alanyl-L-arginyl-L-isoleucyl-glycyl-L-lysyl-L-leucyl-L-cysteinyl-L-alpha-aspartyl-L-cysteinyl-L-prolyl-L-arginyl-glycyl-L-threonyl-L-seryl-L-cysteinyl-L-asparagyl-L-seryl-L-phenylalanyl-L-leucyl-L-leucyl-L-lysyl-L-cysteinyl-L-leucine (14->32),(20->40),(34->47)-tris(disulfide). Grades: ≥95%. CAS No. 209615-79-2. Molecular formula: C226H367N65O65S7. Mole weight: 5259.21. | |
| CART (62-76) (rat, human) | Cocaine- and amphetamine-regulated transcript (CART) is a neuropeptide protein with potent appetite-suppressing activity. It inhibits normal and starvation-induced feeding and blocks the neuropeptide Y-induced feeding response. Synonyms: H-Tyr-Gly-Gln-Val-Pro-Met-Cys-Asp-Ala-Gly-Glu-Gln-Cys-Ala-Val-OH; L-tyrosyl-glycyl-L-glutaminyl-L-valyl-L-prolyl-L-methionyl-L-cysteinyl-L-alpha-aspartyl-L-alanyl-glycyl-L-alpha-glutamyl-L-glutaminyl-L-cysteinyl-L-alanyl-L-valine; Cocaine and amphetamine-regulated transcript (62-76) (rat, human). Grades: ≥90%. CAS No. 210978-19-1. Molecular formula: C64H99N17O23S3. Mole weight: 1570.77. | |
| Casopitant | Casopitant mesylate is the mesylate salt of a centrally-acting neurokinin 1 (NK1) receptor antagonist with antidepressant and antiemetic activities. Casopitant competitively binds to and blocks the activity of the NK1 receptor, thereby inhibiting NK1-receptor binding of the endogenous tachykinin neuropeptide substance P (SP), which may result in antiemetic effects. SP is found in neurons of vagal afferent fibers innervating the brain-stem nucleus tractus solitarii and the area postrema, which contains the chemoreceptor trigger zone (CTZ), and may be elevated in response to chemotherapy. The NK1 receptor is a G-protein receptor coupled to the inositol phosphate signal-transduction pathway and is found in both the nucleus tractus solitarii and the area postrema. Uses: Antiemetics. Synonyms: GW679769; GW 679769; GW-679769; Zunrisa; Rezonic; 4-(4-Acetylpiperazin-1-yl)-N-{1-[3,5-bis(trifluoromethyl)phenyl]ethyl}-2-(4-fluoro-2-methylphenyl)-N-methylpiperidine-1-carboxamide. CAS No. 414910-27-3. Molecular formula: C30H35F7N4O2. Mole weight: 616.62. | |
| Casopitant Mesylate | Casopitant Mesylate is a potent, selective and orally active neurokinin 1 (NK1) receptor antagonist binding of the endogenous tachykinin neuropeptide substance P (SP), which may result in antiemetic effects. Uses: Active tachykinin nk1 receptor antagonist. Synonyms: (2R,4S)-4-(4-acetylpiperazin-1-yl)-N-[(1R)-1-[3,5-bis(trifluoromethyl)phenyl]ethyl]-2-(4-fluoro-2-methylphenyl)-N-methylpiperidine-1-carboxamide;methanesulfonic acid. Grades: ≥98%. CAS No. 414910-30-8. Molecular formula: C31H39F7N4O5S. Mole weight: 712.72. | |
| CGP71683 hydrochloride | CGP71683 hydrochloride is a competitive neuropeptide Y5 receptor antagonist with a K i of 1.3 nM, and shows no obvious activity at Y1 receptor ( K i , >4000 nM) and Y2 receptor ( K i , 200 nM) in cell membranes. Uses: Scientific research. Group: Signaling pathways. Alternative Names: CGP71683A. CAS No. 192322-50-2. Pack Sizes: 10 mM * 1 mL; 5 mg; 10 mg; 25 mg; 50 mg. Product ID: HY-107723. | |
| Clenbuterol Impurity A | 4-Amino-3,5-dichlorobenzaldehyde is an impurity of Clenbuterol and is used as a reagent in the synthesis of pyrazolopyridine derivatives as inhibitors of phosphodiesterase-4 (PDE-IV) and production of tumor necrosis factor-α (TNF-α). 4-Amino-3,5-dichlorobenzaldehyde is also used as a reagent in the synthesis of amino acid derivatives as neuropeptide Y antagonists. Synonyms: 4-Amino-3,5-dichlorobenzaldehyde. Grades: > 95%. CAS No. 62909-66-4. Molecular formula: C7H5Cl2NO. Mole weight: 190.03. | |
| Cortistatin 14, human, rat | Cortistatin 14 is an endogenous neuropeptide similar to somatostatin-14 in structure and function. It is mainly expressed in the cortex and hippocampus. It shows potency at all somatostatin receptors, but prevents somatostatin-14 binding. It binds to the growth hormone secretagog receptor (GHS-R1a). It displays sleep-modulating and neuronal depressant properties in vivo. Synonyms: CST-14, human, rat; Pro-Cys-Lys-Asn-Phe-Phe-Trp-Lys-Thr-Phe-Ser-Ser-Cys-Lys (Disulfide bridge: Cys2-Cys13); Corticostatin-14; L-prolyl-L-cysteinyl-L-lysyl-L-asparagyl-L-phenylalanyl-L-phenylalanyl-L-tryptophyl-L-lysyl-L-threonyl-L-phenylalanyl-L-seryl-L-seryl-L-cysteinyl-L-lysine (2->13)-disulfide; N2-{[(4R, 7S, 10S, 13S, 16S, 19S, 22S, 25S, 28S, 31S, 34S, 37R)-19, 34-Bis(4-aminobutyl)-31-(2-amino-2-oxoethyl)-13, 25, 28-tribenzyl-16-(1-hydroxyethyl)-7, 10-bis(hydroxymethyl)-22-(1H-indol-3-ylmethyl)-6, 9, 12, 15, 18, 21, 24, 27, 30, 33, 36-undecaoxo-37-(L-prolylamino)-1, 2-dithia-5, 8, 11, 14, 17, 20, 23, 26, 29, 32, 35-undecaazacyclooctatriacontan-4-yl]carbonyl}-L-lysine. Grades: ≥95%. CAS No. 193829-96-8. Molecular formula: C81H113N19O19S2. Mole weight: 1721.01. | |
| CP-671906-01 | CP-671906-01 is a neuropeptide Y1 receptor antagonists, increasing blood pressure and food intake in rat models. Uses: Npy y1r antagonist. Synonyms: CP-671906; CP 671906; CP671906; UNII-GLZ1WA47Q8; CP-671906-01.N'-[3-(2,6-dichloro-4-methoxyphenyl)-2,5-dimethylpyrazolo[1,5-a]pyrimidin-7-yl]-N-(oxan-4-yl)ethane-1,2-diamine. Grades: ≥98%. CAS No. 332178-44-6. Molecular formula: C22H27Cl2N5O2. Mole weight: 464.39. | |
| CYM 50769 | CYM 50769 has been found to be a non-peptide antagonist of neuropeptide W/B receptor 1. Synonyms: CYM 50769; CYM50769; CYM-50769; 5-Chloro-2-(9H-fluoren-9-yl)-4-(4-methoxyphenoxy)-3(2H)-pyridazinone. Grades: ≥98% by HPLC. CAS No. 1421365-63-0. Molecular formula: C24H17ClN2O3. Mole weight: 416.86. | |
| CYM 9484 | CYM 9484 has been found to be an effective neuropeptide Y (NPY) Y2 receptor antagonist. Synonyms: CYM 9484; CYM9484; CYM-9484; N-[4-[(Dimethylamino)sulfonyl]phenyl]-4-(hydroxydiphenylmethyl)-1-piperidinecarbothioamide. Grades: ≥98% by HPLC. CAS No. 1383478-94-1. Molecular formula: C27H31N3O3S2. Mole weight: 509.63. | |
| Ethyl α-Bromoethylglyoxalate | Ethyl α-Bromoethylglyoxalate is used in the preparations of potential positron emission tomography tracers for neuropeptide Y Y1 receptors. Group: Biochemicals. Alternative Names: 3-Bromo-2-oxobutanoic Acid Ethyl Ester; 3-Bromo-2-oxobutyric Acid Ethyl Ester; Ethyl 3-bromo-2-oxobutanoate; Ethyl 3-bromo-2-oxobutyrate; 3-Bromo-2-oxo-butanoic Acid Ethyl Ester. Grades: Highly Purified. CAS No. 57332-84-0. Pack Sizes: 1g. US Biological Life Sciences. | Worldwide |
| FAS Inhibitor, C75 (Trans-4-carboxy-5-octyl-3-methylene-butyrolactone) | Inhibitor of fatty acid synthase (FAS) reducing food intake and body weight in mice. Exhibits irreversible slow-binding biphasic inactivation of FAS. Down regulates neuropeptide Y and Agouti-related protein expression. Has been proposed to activiate CPT-1 activity in liver and adipose tissue, leading to increased fatty acid oxidation and energy production. Shows significant in vivo antitumor activity in human breast cancer cells.Suppresses DNA replication and induces apoptosis. FAS inhibition by C75 leads to dramatic accumulation of the CDK inhibitor p27KIP1 from cytosol to cell nuclei. Group: Biochemicals. Alternative Names: [Trans-4-carboxy-5-octyl-3-methylene-butyrolactone]. Grades: Highly Purified. CAS No. 191282-48-1. Pack Sizes: 1mg. US Biological Life Sciences. | Worldwide |
| FR252384 | FR252384 is novel potent antagonists of human neuropeptide Y-Y5 receptor (IC50= 2.3 nM). Synonyms: FR252384; FR 252384; FR-252384; 9-methyl-2-pyridin-3-yl-3,4,5,6-tetrahydrobenzo[2,3]cyclohepta[2,4-b]imidazole; Benzo[3,4]cyclohept[1,2-d]imidazole, 1,4,5,6-tetrahydro-9-methyl-2-(3-pyridinyl)-. CAS No. 447405-11-0. Molecular formula: C18H17N3. Mole weight: 275.35. | |
| GR 231118 | GR 231118 is a potent neuropeptide Y (NPY) Y1 receptor antagonist (pA2 = 10 and 10.5 at rY1 and hY1 receptors, respectively) and an NPY Y4 receptor agonist (pEC50 = 6.0, 8.6 and 6.1 for rY2, hY4 and rY5 receptors, respectively). GR 231118 inhibits food intake in rats in vivo. Synonyms: GR-231118; GR 231118; GR231118. Grades: >99%. CAS No. 158859-98-4. Molecular formula: C110H170N34O24. Mole weight: 2352.77. | |
| H-Phe-Met-Arg-Phe-NH2 | H-Phe-Met-Arg-Phe-NH2 is a molluscan neuropeptide isolated from the ganglia of Macrocallista nimbosa. Synonyms: Fmrfamide; FMRF amide; (S)-N-((S)-1-Amino-1-oxo-3-phenylpropan-2-yl)-2-((S)-2-((S)-2-amino-3-phenylpropanamido)-4-(methylthio)butanamido)-5-guanidinopentanamide; Molluscan Cardioexcitatory Neuropeptide. CAS No. 152165-14-5. Molecular formula: C29H42N8O4S. Mole weight: 598.76. | |
| JNJ-10397049 | JNJ-10397049 is a selective orexin-2 receptor (OX2) antagonist. pIC50 is 7.4 for chimeric OX2 receptors/ pKB values are 5.9 for OX1 and 8.5 for OX2 receptors respectively. JNJ-10397049 exhibits no significant activity in a panel of over 50 other neurotransmitters and neuropeptide receptors. It achieves high level of OX2 receptor occupancy in the rat brain. Synonyms: JNJ-10397049; JNJ 10397049; JNJ10397049; 1-(2,4-Dibromophenyl)-3-((4S,5S)-2,2-dimethyl-4-phenyl-(1,3)dioxan-5-yl)urea. Grades: 98%. CAS No. 708275-58-5. Molecular formula: C19H20Br2N2O3. Mole weight: 484.19. | |
| JNJ-31020028 | JNJ-31020028 is a selective brain penetrant small molecule antagonist of the neuropeptide Y Y(2) receptor. JNJ-31020028 bound with high affinity (IC50 = 8.07, human) and was 100-fold selective versus human Y(1), Y(4), and Y(5) receptors. JNJ-31020028 was demonstrated to be an antagonist (pK(B) = 8.04) in functional assays. Synonyms: JNJ31020028; JNJ 31020028; JNJ-31020028. Grades: 98%. CAS No. 1094873-14-9. Molecular formula: C34H36FN5O2. Mole weight: 565.6. | |
| L 152804 | L 152804 is an orally active and selective neuropeptide Y Y5 receptor (NPY5-R) antagonist, with a K i of 26 nM for hY5. L 152804 causes weight loss in diet-induced obese mice by modulating food intake and energy expenditure [1] [2]. Uses: Scientific research. Group: Signaling pathways. CAS No. 6508-43-6. Pack Sizes: 10 mM * 1 mL; 5 mg; 10 mg; 50 mg; 100 mg. Product ID: HY-107734. | |
| L-152,804 | L-152,804 is a potent and selective orally available non-peptide neuropeptide Y Y5 receptor antagonist with Ki value of 26 nM for hY5. It displays > 300-fold selectivity over hY1, hY2, and hY4 receptors. It is centrally active upon oral administration in vivo. It causes weight loss in diet-induced obese mice by inducing a potent reduction of food intake in rodents. Synonyms: L-152,804; L 152,804; L152,804; 5,5-Dimethyl-2-(2,3,4,9-tetrahydro-3,3-dimethyl-1oxo-1H-xanthen-9-yl)-1,3-cyclohexanedione; 9-(4,4-Dimethyl-2,6-dioxocyclohexyl)-1,2,3,4-tetrahydro-3,3-dimethyl-1-xanthenone; 9-(2-Hydroxy-4,4-dimethyl-6-oxo-1-cyclohexenyl)-3,3-dimethyl-4,9-dihydro-2H-xanthen-1-one; L-152804; L152804. Grades: ≥99% by HPLC. CAS No. 6508-43-6. Molecular formula: C23H26O4. Mole weight: 366.46. | |
| L-Phenylalaninamide,l-prolyl-L-a-aspartyl-L-valyl-L-a-aspartyl-L-histidyl-L-valyl-L-phenylalanyl-L-Leucyl-l-arginyl- | L-Phenylalaninamide,l-prolyl-L-a-aspartyl-L-valyl-L-a-aspartyl-L-histidyl-L-valyl-L-phenylalanyl-L-Leucyl-l-arginyl-. Uses: Designed for use in research and industrial production. Additional or Alternative Names: H-PRO-ASP-VAL-ASP-HIS-VAL-PHE-LEU-ARG-PHE-NH2;FMRF-LIKE PEPTIDE;FMRF-LIKE NEUROPEPTIDE;SCHISTOFLRFAMIDE;PRO-ASP-VAL-ASP-HIS-VAL-PHE-LEU-ARG-PHE AMIDE;PRO-ASP-VAL-ASP-HIS-VAL-PHE-LEU-ARG-PHE-NH2;pro-asp-val-asp-his-val-phe-leu-arg-phe-amidefromlocust;FMRF. Product Category: Heterocyclic Organic Compound. Appearance: White powder. CAS No. 121801-61-4. Molecular formula: C59H86N16O14. Mole weight: 1243.4129. Purity: 0.96. IUPACName: 4-[[1-[[1-[[1-[[1-[[1-[[1-[[1-[(1-amino-1-oxo-3-phenylpropan-2-yl)amino]-5-(diaminomethylideneamino)-1-oxopentan-2-yl]amino]-4-methyl-1-oxopentan-2-yl]amino]-1-oxo-3-phenylpropan-2-yl]amino]-3-methyl-1-oxobutan-2-yl]amino]-3-(1H-imidazol-5-yl)-1-oxopropan. Canonical SMILES: CC(C)CC(C(=O)NC(CCCN=C(N)N)C(=O)NC(CC1=CC=CC=C1)C(=O)N)NC(=O)C(CC2=CC=CC=C2)NC(=O)C(C(C)C)NC(=O)C(CC3=CN=CN3)NC(=O)C(CC(=O)O)NC(=O)C(C(C)C)NC(=O)C(CC(=O)O)NC(=O)C4CCCN4. Density: 1.42g/cm³. Product ID: ACM121801614. Alfa Chemistry ISO 9001:2015 Certified. | |
| L-Tyrosinamide,N-acetyl-L-Leucyl-L-arginyl-L-histidyl-L-tyrosyl-L-Leucyl-L-asparaginyl-L-Leucyl-L-Leucyl-l-threonyl-l-arginyl-l-glutaminyl-l-arginyl- | L-Tyrosinamide,N-acetyl-L-Leucyl-L-arginyl-L-histidyl-L-tyrosyl-L-Leucyl-L-asparaginyl-L-Leucyl-L-Leucyl-l-threonyl-l-arginyl-l-glutaminyl-l-arginyl-. Uses: Designed for use in research and industrial production. Additional or Alternative Names: N-ACETYL-[LEU28, LEU31]NEUROPEPTIDE Y (24-36);N-ACETYL-[LEU28, LEU31]-NEUROPEPTIDE Y FRAGMENT 24-36;ACETYL-(LEU28,31)-NEUROPEPTIDE Y (24-36);ACETYL-(LEU28,31)-NPY (24-36);AC-[LEU28,31] NEUROPEPTIDE Y (24-36), HUMAN;AC-LEU-ARG-HIS-TYR-LEU-ASN-LEU-LEU-THR-. Product Category: Heterocyclic Organic Compound. CAS No. 155709-24-3. Molecular formula: C81H131N27O19. Mole weight: 1787.08. Product ID: ACM155709243. Alfa Chemistry ISO 9001:2015 Certified. | |
| Lu AA33810 | Lu AA33810 is a potent and selective antagonist of neuropeptide Y5 receptor with a K i of 1.5 nM for the human receptor. Lu AA33810 exhibts antianxiolytic-like and antidepressant-like effects [1]. Uses: Scientific research. Group: Signaling pathways. CAS No. 304008-29-5. Pack Sizes: 1 mg. Product ID: HY-107729. | |
| LU AA33810 | LU AA33810 is a neuropeptide Y Y5 receptor antagonist. It exhibits anxiolytic- and antidepressant-like effects in rat models of stress sensitivity. Synonyms: N- [ [trans-4- [ (4, 5-Dihydro [1] benzothiepino [5, 4-d] thiazol-2-yl) amino] cyclohexyl] methyl] methanesulfonamide. Grades: ≥98% by HPLC. CAS No. 304008-29-5. Molecular formula: C19H25N3O2S3. Mole weight: 423.62. | |
| MK 0557 | MK-0557 is a highly selective, orally administered neuropeptide NPY5R antagonist, could limit weight regain after very-low-calorie diet (VLCD)-induced weight loss. Uses: Npy5r antagonist. Synonyms: MK0557; MK 0557; MK-0557; N-[1-(2-fluorophenyl)pyrazol-3-yl]-1'-oxospiro[cyclohexane-4,3'-furo[3,4-c]pyridine]-1-carboxamide. Grades: ≥98%. CAS No. 328232-95-7. Molecular formula: C22H19FN4O3. Mole weight: 406.41. | |
| ML 154 | ML 154 is a neuropeptide S receptor antagonist. It has the potential to be used in the treatment of sleep, anxiety and addiction disorders. Synonyms: NCGC 84; NCGC84; NCGC-84; ML 154; ML154; ML-154; NCGC00185684. 3-(Diphenylphosphinothioyl)-2-methyl-1-[(2E)-3-phenyl-2-propen-1-yl]imidazo[1,2-a]pyridinium bromide. Grades: ≥99% by HPLC. CAS No. 1345964-89-7. Molecular formula: C29H26N2PS.Br. Mole weight: 545.47. | |
| Neuropeptide S (human) | Neuropeptide S (human), one of the "youngest" members among the biologically active peptides, is a potent endogenous neuropeptide S receptor agonist (EC50 = 9.4 nM), which modulates arousal, wakefulness, anxiety, fear-extinction, and fear memory consolidation. Synonyms: NPS (human); H-Ser-Phe-Arg-Asn-Gly-Val-Gly-Thr-Gly-Met-Lys-Lys-Thr-Ser-Phe-Gln-Arg-Ala-Lys-Ser-OH; L-seryl-L-phenylalanyl-L-arginyl-L-asparagyl-glycyl-L-valyl-glycyl-L-threonyl-glycyl-L-methionyl-L-lysyl-L-lysyl-L-threonyl-L-seryl-L-phenylalanyl-L-glutaminyl-L-arginyl-L-alanyl-L-lysyl-L-serine. Grades: ≥95%. CAS No. 412938-67-1. Molecular formula: C93H155N31O28S. Mole weight: 2187.48. | |
| NPY 5RA972 | NPY5RA972 is a neuropeptide Y Y5 antagonist. Synonyms: NPY5RA972; NPY-5-RA-972; NPY 5 RA 972; N-[4-Methyl-9-(1-methylethyl)-9H-carbazol-3-yl]-4-morpholinecarboxamide. Grades: ≥98% by HPLC. CAS No. 439861-56-0. Molecular formula: C21H25N3O2. Mole weight: 351.44. | |
| NTNCB hydrochloride | NTNCB (Compound 11) hydrochloride is a potent and selective neuropeptide Y Y5 (NPY Y5) receptor antagonist with a K i of 8 nM against human Y5 [1]. Uses: Scientific research. Group: Signaling pathways. CAS No. 191931-56-3. Pack Sizes: 5 mg; 10 mg; 25 mg; 50 mg; 100 mg. Product ID: HY-107733. | |
Our database is helping our users find suppliers everyday.
