Find where to buy products from suppliers in the USA, including: distributors, industrial manufacturers in America, bulk supplies and wholesalers of raw ingredients & finished goods.
Pancreatic Cancer Antibody Drug Conjugate. Group: Single wall cnt. >95% (SWNT).
pancreatic elastase
Formed by activation of proelastase from mammalian pancreas by trypsin. In peptidase family S1 (trypsin family). Formerly included in EC 3.4.21.11. Group: Enzymes. Synonyms: pancreatopeptidase E; pancreatic elastase I; elastase; elaszym; serine elastase. Enzyme Commission Number: EC 3.4.21.36. CAS No. 9004-6-2. ELA1. Storage: Store it at +4 ?C for short term. For long term storage, store it at -20 ?C?-80 ?C. Form: Liquid or lyophilized powder. EXWM-4130; pancreatic elastase; EC 3.4.21.36; 9004-06-2; pancreatopeptidase E; pancreatic elastase I; elastase; elaszym; serine elastase. Cat No: EXWM-4130.
pancreatic elastase II
A peptidase of family S1 (trypsin family) formed by activation of proelastase II from mammalian pancreas by trypsin. Usually, only one of the pancreatic elastases (see also EC 3.4.21.36) is expressed in a given species; human pancreatic elastase is of type II. Group: Enzymes. Synonyms: pancreatic elastase 2. Enzyme Commission Number: EC 3.4.21.71. CAS No. 75603-19-9. Storage: Store it at +4 ?C for short term. For long term storage, store it at -20 ?C?-80 ?C. Form: Liquid or lyophilized powder. EXWM-4163; pancreatic elastase II; EC 3.4.21.71; 75603-19-9; pancreatic elastase 2. Cat No: EXWM-4163.
pancreatic endopeptidase E
A peptidase of family S1 (trypsin family) from pancreatic juice. Unlike elastases, has an acidic pI. Binds cholesterol. Group: Enzymes. Synonyms: cholesterol-binding proteinase; proteinase E; cholesterol-binding serine proteinase; pancreatic protease E; pancreatic proteinase E; cholesterol-binding pancreatic proteinase; CBPP; pancreas E proteinase. Enzyme Commission Number: EC 3.4.21.70. CAS No. 68073-27-8. Storage: Store it at +4 ?C for short term. For long term storage, store it at -20 ?C?-80 ?C. Form: Liquid or lyophilized powder. EXWM-4162; pancreatic endopeptidase E; EC 3.4.21.70; 68073-27-8; cholesterol-binding proteinase; proteinase E; cholesterol-binding serine proteinase; pancreatic protease E; pancreatic proteinase E; cholesterol-binding pancreatic proteinase; CBPP; pancreas E proteinase. Cat No: EXWM-4162.
Pancreatic Microvascular Endothelial Cells, Human (Frozen)
Passage 3 cells are shipped in proliferating culture with a confluence of >90%. ENDO-Growth medium containing 5% serum and growth supplement is recommended for culture. Cells have an average population doubling level of >16 when cultured. Group: Biologicals. Grades: Cell Culture Grade. Pack Sizes: 1ml. US Biological Life Sciences.
Worldwide
Pancreatic Microvascular Endothelial Cells, Human (T-25 flask)
Passage 3 cells are shipped in proliferating culture with a confluence of >90%. ENDO-Growth medium containing 5% serum and growth supplement is recommended for culture. Cells have an average population doubling level of >16 when cultured. Group: Biologicals. Grades: Cell Culture Grade. Pack Sizes: T-25 flask. US Biological Life Sciences.
Worldwide
Pancreatic polypeptide
Pancreatic polypeptide is a peptide secreted by the endocrine PP cells of the pancreas that regulates pancreatic secretory activity and also affects hepatic glycogen stores and gastrointestinal secretion [1]. Uses: Scientific research. Group: Peptides. CAS No. 59763-91-6. Pack Sizes: 1 mg; 5 mg; 10 mg. Product ID: HY-P4060.
Pancreatic Polypeptide, bovine
Pancreatic Polypeptide, bovine, a straight chain polypeptide containing 36 amino acids, derived primarily from the pancreas, and stimulates pancreatic secretion by inhibiting secretin and cholecystokinin. As the NPY receptor agonist, it has a high affinity at NPYR4. Synonyms: Ala-Pro-Leu-Glu-Pro-Glu-Tyr-Pro-Gly-Asp-Asn-Ala-Thr-Pro-Glu-Gln-Met-Ala-Gln-Tyr-Ala-Ala-Glu-Leu-Arg-Arg-Tyr-Ile-Asn-Met-Leu-Thr-Arg-Pro-Arg-Tyr-NH2; Pancreatic polypeptide (pig), 6-L-glutamic acid-; Bovine pancreatic polypeptide. Grades: ≥95%. CAS No. 179986-89-1. Molecular formula: C186H287N53O56S2. Mole weight: 4225.78.
Pancreatic polypeptide(human)
Pancreatic polypeptide(human). Uses: Designed for use in research and industrial production. Additional or Alternative Names: PANCREATIC POLYPEPTIDE;PANCREATIC POLYPEPTIDE, HUMAN;PP, HUMAN;APLEPVYPGDNATPEQMAQYAADLRRYINMLTRPRY-NH2;H-ALA-PRO-LEU-GLU-PRO-VAL-TYR-PRO-GLY-ASP-ASN-ALA-THR-PRO-GLU-GLN-MET-ALA-GLN-TYR-ALA-ALA-ASP-LEU-ARG-ARG-TYR-ILE-ASN-MET-LEU-THR-ARG-PRO-ARG-TYR-NH2. Product Category: Heterocyclic Organic Compound. CAS No. 59763-91-6. Molecular formula: C185H287N53O54S2. Product ID: ACM59763916. Alfa Chemistry ISO 9001:2015 Certified.
Pancreatic Polypeptide (human)
Pancreatic Polypeptide (human). Group: Biochemicals. Grades: Purified. CAS No. 75976-10-2. Pack Sizes: 200ug. US Biological Life Sciences.
Worldwide
Pancreatic Polypeptide, human
Pancreatic Polypeptide, human is a C-terminally amidated 36 amino acid peptide, which acts as a neuropeptide Y ( NPY ) Y4 / Y5 receptor agonist. Uses: Scientific research. Group: Peptides. Alternative Names: Human pancreatic polypeptide. CAS No. 75976-10-2. Pack Sizes: 500 μg; 1 mg; 5 mg. Product ID: HY-P0199.
Pancreatic Polypeptide, human
Pancreatic polypeptide is an agonist of neuropeptide Y (NPY) receptors that reduces forskolin-induced cAMP accumulation in L-M(TK-) cells recombinantly expressing human and rat Y4 receptors (EC50s = 87.1 and 36.3 pM, respectively). It is believed to play an important role in the function of the gastrointestinal tract. Uses: Gastrointestinal agents. Synonyms: Human pancreatic polypeptide; L-alanyl-L-prolyl-L-leucyl-L-alpha-glutamyl-L-prolyl-L-valyl-L-tyrosyl-L-prolyl-glycyl-L-alpha-aspartyl-L-asparagyl-L-alanyl-L-threonyl-L-prolyl-L-alpha-glutamyl-L-glutaminyl-L-methionyl-L-alanyl-L-glutaminyl-L-tyrosyl-L-alanyl-L-alanyl-L-alpha-aspartyl-L-leucyl-L-arginyl-L-arginyl-L-tyrosyl-L-isoleucyl-L-asparagyl-L-methionyl-L-leucyl-L-threonyl-L-arginyl-L-prolyl-L-arginyl-L-tyrosinamide; Ala-Pro-Leu-Glu-Pro-Val-Tyr-Pro-Gly-Asp-Asn-Ala-Thr-Pro-Glu-Gln-Met-Ala-Gln-Tyr-Ala-Ala-Asp-Leu-Arg-Arg-Tyr-Ile-Asn-Met-Leu-Thr-Arg-Pro-Arg-Tyr-NH2. Grades: ≥95%. CAS No. 75976-10-2. Molecular formula: C185H287N53O54S2. Mole weight: 4181.71.
Pancreatic Polypeptide, rat
Pancreatic Polypeptide, rat is an agonist of NPY receptor with high affinity at NPYR4. Synonyms: Rat pancreatic polypeptide; Ala-Pro-Leu-Glu-Pro-Met-Tyr-Pro-Gly-Asp-Tyr-Ala-Thr-His-Glu-Gln-Arg-Ala-Gln-Tyr-Glu-Thr-Gln-Leu-Arg-Arg-Tyr-Ile-Asn-Thr-Leu-Thr-Arg-Pro-Arg-Tyr-NH2; L-alanyl-L-prolyl-L-leucyl-L-alpha-glutamyl-L-prolyl-L-methionyl-L-tyrosyl-L-prolyl-glycyl-L-alpha-aspartyl-L-tyrosyl-L-alanyl-L-threonyl-L-histidyl-L-alpha-glutamyl-L-glutaminyl-L-arginyl-L-alanyl-L-glutaminyl-L-tyrosyl-L-alpha-glutamyl-L-threonyl-L-glutaminyl-L-leucyl-L-arginyl-L-arginyl-L-tyrosyl-L-isoleucyl-L-asparagyl-L-threonyl-L-leucyl-L-threonyl-L-arginyl-L-prolyl-L-arginyl-L-tyrosinamide. Grades: ≥95%. CAS No. 90419-12-8. Molecular formula: C195H298N58O57S. Mole weight: 4398.87.
pancreatic ribonuclease
Specifically, the enzymes are involved in endonucleolytic cleavage of 3'-phosphomononucleotides and 3'-phosphooligonucleotides ending in C-P or U-P with 2',3'-cyclic phosphate intermediates. Ribonuclease can unwind the RNA helix by complexing with single-stranded RNA; the complex arises by an extended multi-site cation-anion interaction between lysine and arginine residues of the enzyme and phosphate groups of the nucleotides. Group: Enzymes. Synonyms: RNase; RNase I; RNase A; pancreatic RNase; ribonuclease I; endoribonuclease I; ribonucleic phosphatase; alkaline ribonuclease; ribonuclease; gene S glycoproteins; Ceratitis capitata alkaline ribonuclease; SLSG glycoproteins; gen. glycoproteins; ribonucleate 3'-pyrimidino-oligonucleotidohydrolase. Enzyme Commission Number: EC 3.1.27.5. CAS No. 9001-99-4. Rnase. Storage: Store it at +4 ?C for short term. For long term storage, store it at -20 ?C?-80 ?C. Form: Liquid or lyophilized powder. EXWM-3603; pancreatic ribonuclease; EC 3.1.27.5; 9001-99-4; RNase; RNase I; RNase A; pancreatic RNase; ribonuclease I; endoribonuclease I; ribonucleic phosphatase; alkaline ribonuclease; ribonuclease; gene S glycoproteins; Ceratitis capitata alkaline ribonuclease; SLSG glycoproteins; gene S locus-specific glycoproteins; S-genotype-asssocd. glycoproteins; ribonucleate 3'-pyrimidino-oligonucleotidohydrolase. Cat No: EXWM-3603.
Anti-Pancreatic Cancer Compound Library
A unique collection of 1697 pancreatic cancer related compounds can be used in HTS and HCS. Uses: Scientific use. Product Category: L2192. Categories: Anti-Pancreatic Cancer Compounds Libraries.
Aprotinin, Bovine (Pancreatic trypsin inhibitor)
Aprotinin is a competitive serine protease inhibitor that inhibits trypsin, chymotrypsin, kallikrein and plasmin. Aprotinin forms stable complexes with and blocks the active sites of enzymes. Binding is reversible with most aprotinin-protease complexes, dissociating at pH >10 or <3. Effective concentration is equimolar with protease. Group: Biochemicals. Alternative Names: Antikrein; Antilysin; Antilysine; Aprostat; Aprotinin; BPTI; BPTI Trypsin Inhibitor; Basic Pancreatic Trypsin Inhibitor; Bayer A 128; Bovine Basic Pancreatic Trypsin Inhibitor; Bovine Pancreatic Trypsin Inhibitor; Bovine Trypsin Inhibitor; Fosten; Kallikrein-trypsin Inactivator; Kiker 52G; Kir Richter; Kunitz Pancreatic Trypsin Inhibitor; Kunitz Protease Inhibitor; Kunitz Trypsin Inhibitor; Kunitz-type Inhibitor; Kunitz-type Proteinase Inhibitor; Kunitz-type Trypsin Inhibitor; Onquinin; Pancreatic Basic Trypsin Inhibitor; Pancreatic Trypsin Inhibitor; Pancreatic Trypsin Inhibitor (Kunitz); Protease Inhibitor, Kunitz Type; RP 9921; Repulson; Trasuylol; Trasylol; Trazinin; Triazinin; Trypsin Inhibitor, Trasylol; Trypsin-kallikrein Inhibitor (Kunitz); Zymofren. Grades: Highly Purified. CAS No. 9087-70-1. Pack Sizes: 100mg, 250mg, 500mg, 1g. Molecular Formula: C???H???N??O??S?, Molecular Weight: 6511.45. US Biological Life Sciences.
Worldwide
Biotinyl-Pancreatic Polypeptide (human)
Synonyms: Biotin-Pancreatic Polypeptide, human; Biotinyl-Ala-Pro-Leu-Glu-Pro-Val-Tyr-Pro-Gly-Asp-Asn-Ala-Thr-Pro-Glu-Gln-Met-Ala-Gln-Tyr-Ala-Ala-Asp-Leu-Arg-Arg-Tyr-Ile-Asn-Met-Leu-Thr-Arg-Pro-Arg-Tyr-NH2. Grades: ≥95% by HPLC. CAS No. 1816258-36-2. Molecular formula: C195H301N55O56S3. Mole weight: 4408.01.
Immobilized porcine pancreatic elastase
Cleaves PAI-1 between the P3 and P4 residues to create a loop-inserted species that is non-inhibitory towards the target enzymes uPA and tPA. Group: Enzymes. Synonyms: EC 3. 4. 21. 36, pancreatopeptidase E; pancreatic elastase I; elastase; elaszym; serine elastase; elastase-1; pancreatopeptidase; ELA1. Enzyme Commission Number: EC 3. 4. 21. 36. Purity: >95% by SDS-PAGE analysis. Stability: 12 months from delivery. Storage: 4°C. Form: Resin. Source: Porcine pancreas. Species: Porcine. EC 3. 4. 21. 36, pancreatopeptidase E; pancreatic elastase I; elastase; elaszym; serine elastase; elastase-1; pancreatopeptidase; ELA1; Immobilized elastase; Immobilized pancreatic elastase; Immobilized ELA1. Cat No: NATE-1760.
Infectious pancreatic necrosis virus (IPNV) is a birnavirus that causes an acute, contagious disease in young salmonid fish. As with most viruses that infect eukaryotic cells, the proteolytic processing of viral precursor proteins is a crucial step in the life cycle of this virus. pVP2 is converted into VP2 by cleavage near the carboxy end of pVP2. This cleavage is most likely due to host-cell proteases rather than VP4. Differs from most serine peptidases in not having the catalytic triad Ser-His-Asp. Belongs in peptidase family S50. Group: Enzymes. Synonyms: infectious pancreatic necrosis virus protease; IPNV Vp4 protease; IPNV Vp4 peptidase; NS protease; NS-associated protease; Vp4 protease. Enzyme Commission Number: EC 3.4.21.115. Storage: Store it at +4 ?C for short term. For long term storage, store it at -20 ?C?-80 ?C. Form: Liquid or lyophilized powder. EXWM-4110; infectious pancreatic necrosis birnavirus Vp4 peptidase; EC 3.4.21.115; infectious pancreatic necrosis virus protease; IPNV Vp4 protease; IPNV Vp4 peptidase; NS protease; NS-associated protease; Vp4 protease. Cat No: EXWM-4110.
1-(2'-Deoxy-2'-fluoro-β-L-arabinofuranosyl)-uracil is a cytotoxic drug used to treat various types of cancers, including pancreatic, gastric, and lung cancers. It works by disrupting DNA synthesis in cancer cells, ultimately leading to their death. Due to its high specificity towards cancer cells, side effects on healthy cells are minimized. Synonyms: 1-[(2S,3R,4S,5S)-3-fluoro-4-hydroxy-5-(hydroxymethyl)oxolan-2-yl]pyrimidine-2,4-dione. Molecular formula: C9H11FN2O5. Mole weight: 246.19.
1-(2-Deoxy-3,5-di-O-toluoyl-α-D-ribofuranosyl)-2-oxo-4-amino-1,2-dihydro-1,3,5-triazine-15N4 is an intermediate formed in the synthesis of 5-Aza-2-deoxy Cytidine-15N4 (A796952), used as cancer treatment, in particular to inhibit the growth of pancreatic endocrine tumor cell lines. Group: Biochemicals. Grades: Highly Purified. Pack Sizes: 1mg. Molecular Formula: C24H2415N4O6. US Biological Life Sciences.
1-(2-Deoxy-3,5-di-O-toluoyl- β-D-ribofuranosyl)-2-oxo-4-amino-1,2-dihydro-1,3,5-triazine is an intermediate formed in the synthesis of 5-Aza-2-deoxy Cytidine-15N4 (A796952), used as cancer treatment, in particular to inhibit the growth of pancreatic endocrine tumor cell lines. Group: Biochemicals. Grades: Highly Purified. Pack Sizes: 1mg, 5mg. Molecular Formula: C24H2415N4O6. US Biological Life Sciences.
1-(2-Deoxy-b-D-threo-pentofuranosyl)-5-fluorouracil, an effective antineoplastic agent employed in the management of diverse malignancies such as colorectal, breast, and pancreatic cancer, showcases its mechanistic action by suppressing the vital enzyme, thymidylate synthase, thereby impeding DNA synthesis. Undoubtedly, this compound's profound pharmacological features render it an indispensable asset within the biomedicine realm, proficiently combating a myriad of malignant conditions. Synonyms: 5-Fluoro-1-[(2R,4R,5R)-4-hydroxy-5-(hydroxymethyl)tetrahydrofuran-2-yl]pyrimidine-2,4-dione. CAS No. 955-24-8. Molecular formula: C9H11FN2O5. Mole weight: 246.19.
1,2-Dilaurin
1,2-Dilaurin is a diacylglycerol containing lauric acid at the sn-1 and sn-2 positions. It has been used as an internal standard for the quantification of diglycerides in rat desheathed sciatic nerves. [1] Monomolecular films containing 1,2-dilauroyl-rac-glycerol have been used as substrates to measure surface pressure and the effect of pancreatic procolipase and colipase on porcine pancreatic lipase activity. [2] References: [1]. Zhu, X. and Eichberg, J. 1,2-Diacylglycerol content and its arachidonyl-containing molecular species are reduced in the sciatic nerve of streptozotocin-induced diabetic rats. J. Neurochemistry. 55(3), 1087-1090 (1990).[2]. Wieloch, T., Borgstr m, B., Piéroni, G. et al. Porcine trypsinogen and its trypsin-activated form: lipid binding and lipase activation on monomolecular membranes. FEBS Express. 128(2), 217-220 (1981). Uses: Scientific research. Group: Biochemical assay reagents. Alternative Names: (Rac)-1,2-Didodecanoylglycerol. CAS No. 17598-94-6. Pack Sizes: 5 mg; 10 mg. Product ID: HY-W127391.
12(S)-HETE
12(S)-HETE is the 12-lipoxygenase metabolite of arachidonic acid and has a mitogenic effect on cancer cell proliferation. 12(S)-HETE induces tyrosine phosphorylation of cellular proteins, promotes ERK and P38 MAPK phosphorylation, increases DNA synthesis, and stimulates the proliferation of pancreatic cancer cells [1] [2]. Uses: Scientific research. Group: Natural products. CAS No. 54397-83-0. Pack Sizes: 100 μg (312.04 μM * 1 mL in Ethanol). Product ID: HY-124404A.
1,3,5-Tri-O-benzoyl-2-deoxy-2-fluoro-a-L-arabinofuranose, a chemical compound with multifaceted applications predominantly in biomedicine, serves as an antimetabolite for various cancer treatments, including but not limited to pancreatic cancer and leukemia. By hindering DNA synthesis, the cellular proliferation and reproduction process becomes inhibited, observed as a blockade against cell growth and potential division. Synonyms: (2S,3R,4S,5S)-5-((Benzoyloxy)methyl)-3-fluorotetrahydrofuran-2,4-diyl dibenzoate; 2-Fluoro-1-O,3-O,5-O-tribenzoyl-2-deoxy-alpha-L-arabinofuranose; 2-Deoxy-2-fluoro-1,3,5-tri-O-benzoyl-α-L-arabinofuranose. Grades: ≥95% by HPLC. CAS No. 171721-00-9. Molecular formula: C26H21FO7. Mole weight: 464.44.
16-Deacetylfusidic Acid γ-Lactone
16-Deacetylfusidic Acid γ-Lactone is a metabolite of the drug Fusidic Acid (F865500). Fusidic acid is a bacteriostatic antibiotic. Fusidic Acid suppresses nitric oxide lysis of pancreatic islet cells. Inhibits protein synthesis in prokaryotes by inhibiting the ribosome-dependent activity of G factor and translocation of peptidyl-tRNA. Group: Biochemicals. Grades: Highly Purified. CAS No. 4701-54-6. Pack Sizes: 10mg, 25mg. Molecular Formula: C29H44O4, Molecular Weight: 456.66. US Biological Life Sciences.
Worldwide
16-Epi-deacetyl-fusidic Acid
16-Epi-deacetyl-fusidic Acid (Fusidic Acid EP Impurity I) is a metabolite of fusidic acid (F865500) which is a bacteriostatic antibiotic. Fusidic Acid suppresses nitric oxide lysis of pancreatic islet cells and inhibits protein synthesis in prokaryotes by inhibiting the ribosome-dependent activity of G factor and translocation of peptidyl-tRNA. Group: Biochemicals. Grades: Highly Purified. CAS No. 5951-83-7. Pack Sizes: 25mg, 250mg. Molecular Formula: C29H46O5, Molecular Weight: 474.67. US Biological Life Sciences.
Worldwide
1-Amino-3-nitroadamantane
1-Amino-3-nitroadamantane has potential application in co-catalyst for transition metal reactions and maybe a useful intermediate for the synthesis of Vildagliptin (V305000), an antidiabetic drug that inhibits dipeptidyl peptidase 4 (DPP-4). Vildagliptin exhibits antioxidant properties and may be an apoptotic compound against pancreatic cancer cells. Group: Biochemicals. Grades: Highly Purified. CAS No. 243145-00-8. Pack Sizes: 100mg, 500mg. Molecular Formula: C10H16N2O2, Molecular Weight: 196.25. US Biological Life Sciences.
Worldwide
1-Aminoacetone Hydrochloride
Aminoacetone is a threonine and glycine catabolite that can be converted to methylglyoxal by amine oxidases.1 It has been identified as one of several endogenous sources of methylglyoxal found in the plasma of diabetes patients.2 As a pro-oxidant, 0.10-5 mM aminoacetone can induce cell death in RINm5f pancreatic β-cells.2 Aminoacetone is used as a growth substrate for Pseudomonas.3. Group: Biochemicals. Alternative Names: 1-Amino-2-propanone Hydrochloride; 2-Oxopropylammonium Chloride; Aminoacetone Hydrochloride. Grades: Highly Purified. CAS No. 7737-17-9. Pack Sizes: 50mg, 100mg, 250mg, 500mg, 1g. Molecular Formula: C3H8ClNO, Molecular Weight: 109.55. US Biological Life Sciences.
Worldwide
1-Epi-adenophorine
1-Epi-adenophorine is an intriguing natural alkaloid showcasing potent antitumor and cytotoxic qualities. The enticing compound has exhibited encouraging prospects in the management of lung and pancreatic cancer. Studies have even identified its positive effects on specific tumor cell lines.
1-Methoxy-4-nitronaphthalene
1-Methoxy-4-nitronaphthalene is used as a reagent in the synthesis of UMI-77 (U700850); a small molecule inhibitor of Mcl-1 which blocks and attenuates pancreatic cell cancer growth. Also an anticancer agent. Group: Biochemicals. Grades: Highly Purified. CAS No. 4900-63-4. Pack Sizes: 500mg, 1g. Molecular Formula: C11H9NO3, Molecular Weight: 203.19. US Biological Life Sciences.
Worldwide
2',3'-cyclic-nucleotide 2'-phosphodiesterase
Also hydrolyses 3'-nucleoside monophosphates and bis-4-nitrophenyl phosphate, but not 3'-deoxynucleotides. Similar reactions are carried out by EC 3.1.27.3 (ribonuclease T1) and EC 3.1.27.5 (pancreatic ribonuclease). Group: Enzymes. Synonyms: ribonucleoside 2',3'-cyclic phosphate diesterase; 2',3 -cyclic AMP phosphodiesterase; 2',3'-cyclic nucleotidase; cyclic 2',3'-nucleotide 2'-phosphodiesterase; cyclic 2',3'-nucleotide phosphodiesterase; 2',3'-cyclic nucleoside monophosphate phosphodiesterase; 2',3'-cyclic AMP 2'-phosphohydrolase; cyclic phosphodiesterase:3'-nucleotidase; 2',3'-cyclic n. Enzyme Commission Number: EC 3.1.4.16. CAS No. 9037-18-7. Storage: Store it at +4 ?C for short term. For long term storage, store it at -20 ?C?-80 ?C. Form: Liquid or lyophilized powder. EXWM-3715; 2',3'-cyclic-nucleotide 2'-phosphodiesterase; EC 3.1.4.16; 9037-18-7; ribonucleoside 2',3'-cyclic phosphate diesterase; 2',3 -cyclic AMP phosphodiesterase; 2',3'-cyclic nucleotidase; cyclic 2',3'-nucleotide 2'-phosphodiesterase; cyclic 2',3'-nucleotide phosphodiesterase; 2',3'-cyclic nucleoside monophosphate phosphodiesterase; 2',3'-cyclic AMP 2'-phosphohydrolase; cyclic phosphodiesterase:3'-nucleotidase; 2',3'-cyclic nucleotide phosphohydrolase; 2':3'-cyclic phosphodiesterase; 2':3'-cyclic nucleotide phosphodiesterase:3'-nucleotidase. Cat No: EXWM-3715.
2-(4-(2-(4,4,5,5-Tetramethyl-1,3,2-dioxaborolan-2-yl)phenyl)propan-2-yl)piperazin-1-yl)ethan-1-ol is a derivative compound of Dioxaborolane (I709560). Dioxaborolane (I709560) is used in the preparation of Taspase1 inhibitors and α-methylene-γ-butyrolactones. α-Methylene-γ-butyrolactones have the ability to suppress growth in pancreatic carcinoma cells. Group: Biochemicals. Grades: Highly Purified. Pack Sizes: 10mg, 25mg. Molecular Formula: C21H35BN2O3, Molecular Weight: 374.33. US Biological Life Sciences.
2- (4- (4- (4, 4, 5, 5-Tetramethyl-1, 3, 2-dioxaborolan-2-yl) -2- (trifluoromethyl) benzyl) piperazin-1-yl) ethan-1-ol is a derivative compound of Dioxaborolane (I709560). Dioxaborolane (I709560) is used in the preparation of Taspase1 inhibitors and α-methylene-γ-butyrolactones. α-Methylene-γ-butyrolactones have the ability to suppress growth in pancreatic carcinoma cells. Group: Biochemicals. Grades: Highly Purified. Pack Sizes: 5mg, 10mg. Molecular Formula: C20H30BF3N2O3, Molecular Weight: 414.27. US Biological Life Sciences.
Worldwide
2,5-Dimethylthiophene-3-boronic acid
2,5-Dimethylthiophene-3-boronic acid can be used as a KRAS G12C inhibitor to treat a variety of diseases, including pancreatic cancer, colorectal cancer and lung cancer. Synonyms: B-(2,5-Dimethyl-3-thienyl)boronic Acid; (2,5-Dimethylthiophen-3-yl)boronic Acid; 2,5-Dimethyl-3-thienylboronic Acid; 2,5-Dimethylthien-3-ylboronic Acid; 2,5-Dimethylthiophene-3-boronic Acid. CAS No. 162607-23-0. Molecular formula: C6H9BO2S. Mole weight: 156.02.
26-Hydroxy-fusidic Acid
26-Hydroxy-fusidic Acid is a metabolite of the drug Fusidic Acid (F865500). Fusidic acid is a bacteriostatic antibiotic. Fusidic Acid suppresses nitric oxide lysis of pancreatic islet cells. Inhibits protein synthesis in prokaryotes by inhibiting the ribosome-dependent activity of G factor and translocation of peptidyl-tRNA. Group: Biochemicals. Grades: Highly Purified. Pack Sizes: 10mg, 25mg. Molecular Formula: C31H48O7, Molecular Weight: 532.71. US Biological Life Sciences.
Worldwide
27-Oxo-fusidic Acid
27-Oxo-fusidic Acid is a metabolite of fusidic acid (F865500) which is a bacteriostatic antibiotic. Fusidic Acid suppresses nitric oxide lysis of pancreatic islet cells and inhibits protein synthesis in prokaryotes by inhibiting the ribosome-dependent activity of G factor and translocation of peptidyl-tRNA. Group: Biochemicals. Grades: Highly Purified. CAS No. 1415035-94-7. Pack Sizes: 25mg, 250mg. Molecular Formula: C31H46O7, Molecular Weight: 530.69. US Biological Life Sciences.
Worldwide
2-Amino-1-[4- (trifluoromethoxy) phenyl]ethanone
2-Amino-1-[4- (trifluoromethoxy) phenyl]ethanone acts as a reagent in the synthesis of diaryl oxazole-based compounds as potential agents for the treatment of pancreatic cancer lines. Group: Biochemicals. Grades: Highly Purified. CAS No. 1092443-01-0. Pack Sizes: 250mg, 1g. Molecular Formula: C9H8F3NO2, Molecular Weight: 219.16. US Biological Life Sciences.
Worldwide
2-Benzylthioadenosine
2-Benzylthioadenosine, a formidable inhibitor of methylthioadenosine phosphorylase (MTAP) - an enzyme primarily involved in adenine and methionine salvage - has received significant attention due to its potential contributions to the management of cancer forms denuded of MTAP expression (like pancreatic cancer or mesothelioma) as well as auto-immune illnesses and inflammation. Synonyms: (2R,3R,4S,5R)-2-(6-amino-2-(benzylthio)-9H-purin-9-yl)-5-(hydroxymethyl)tetrahydrofuran-3,4-diol; 2-(Benzylsulfanyl)adenosine; Adenosine, 2-[(phenylmethyl)thio]-. Grades: ≥95%. CAS No. 43157-48-8. Molecular formula: C17H19N5O4S. Mole weight: 389.43.
2'-Bromo-2'-deoxy-5-fluorouridine
2'-Bromo-2'-deoxy-5-fluorouridine is a nucleoside analog that interferes with RNA and DNA synthesis, used as an antineoplastic agent against certain types of cancer including pancreatic, colorectal and breast cancer. It can also be used clinically as a prodrug, in combination with other anticancer agents, to increase their efficacy. Synonyms: Uridine, 2'-bromo-2'-deoxy-5-fluoro-; 5-Fluor-2'-brom-2'-deoxyuridine; 1-((2R,3R,4R,5R)-3-Bromo-4-hydroxy-5-hydroxymethyl-tetrahydro-furan-2-yl)-5-fluoro-1H-pyrimidine-2,4-dione; 1-[(2R,3R,4R,5R)-3-bromo-4-hydroxy-5-(hydroxymethyl)oxolan-2-yl]-5-fluoropyrimidine-2,4-dione. Grades: ≥95%. CAS No. 32791-82-5. Molecular formula: C9H10BrFN2O5. Mole weight: 325.09.
2'-C-methyl-5-fluorouridine
2'-C-methyl-5-fluorouridine, a modified nucleoside, is a compound that has generated substantial interest in the realm of cancer research due to its impressive performance against liver, breast, pancreatic, and colon cancer cells. Considered a promising therapeutic option, the compound's antitumor activity has been rigorously tested and documented, offering a potential solution to some of the deadliest cancers. Synonyms: 2'-β-C-methyl-5-fluorouridine; 1-((2R,3R,4R,5R)-3,4-Dihydroxy-5-(hydroxymethyl)-3-methyltetrahydrofuran-2-yl)-5-fluoropyrimidine-2,4(1H,3H)-dione; 5-Fluoro-2'-C-methyluridine. Grades: ≥95%. CAS No. 23643-38-1. Molecular formula: C10H13FN2O6. Mole weight: 276.22.
2'-Deoxy-2'-fluoro-4'-thio-b-D-arabinouridine
2'-Deoxy-2'-fluoro-4'-thio-b-D-arabinouridine, a robust medication utilized in the treatment of various cancers spanning from pancreatic, breast, to colon cancer, ameliorates the condition by hindering DNA synthesis through the suppression of the enzyme ribonucleotide reductase. Furthermore, its multifaceted properties suggest it as an attractive immunosuppressant for tackling autoimmune diseases such as rheumatoid arthritis or multiple sclerosis. Synonyms: 2,4(1H,3H)-Pyrimidinedione, 1-(2-deoxy-2-fluoro-4-thio-β-D-arabinofuranosyl)-; 2'-Deoxy-2'-fluoro-4'-thio-β-D-arabinouridine; 1-[(2R,3S,4S,5R)-3-fluoro-4-hydroxy-5-(hydroxymethyl)thiolan-2-yl]pyrimidine-2,4-dione; 1-(2-Deoxy-2-fluoro-4-thio-D-ribofuranosyl)-2,4(1H,3H)-pyrimidinedione. Grades: ≥95%. CAS No. 941610-00-0. Molecular formula: C9H11FN2O4S. Mole weight: 262.26.
2'-Deoxy-2'-fluoro-4-thiouridine
2'-Deoxy-2'-fluoro-4-thiouridine, a nucleoside analog, has been shown to be efficacious against diverse cancers, notably pancreatic and liver cancer, owing to its potent RNA synthesis inhibition that halts cancer cells' growth and proliferation. Significantly, it has also exhibited some antiviral potential, especially against viruses such as HIV and hepatitis B, via viral replication inhibition. Synonyms: 1-(2'-deoxy-2'-fluoro-β-D-ribofuranosyl)-4-thiouracil; 1-((2R,3R,4R,5R)-3-Fluoro-4-hydroxy-5-(hydroxymethyl)tetrahydrofuran-2-yl)-4-thioxo-3,4-dihydropyrimidin-2(1H)-one; 2'-fluoro-4-thio-2'-deoxy-uridine; 1-(2-Deoxy-2-fluoro-β-D-ribofuranosyl)-4-thioxo-3,4-dihydro-2(1H)-pyrimidinone. Grades: ≥95%. CAS No. 10212-16-5. Molecular formula: C9H11FN2O4S. Mole weight: 262.26.
2'-Deoxy-2'-fluoro-5-methoxy-arabinouridine
2'-Deoxy-2'-fluoro-5-methoxy-arabinouridine is a fascinating and groundbreaking nucleoside analog with remarkable anti-tumor properties to combat multiple cancer types, including the notorious pancreatic cancer. Acting as a nucleoside analogue, this new molecule uniquely integrates into the RNA of malignant cells, thereby stimulating repressed apoptosis via inhibition of RNA synthesis. Remarkably, its remarkable effectiveness as an anticancer agent is currently being validated through heavily monitored clinical trials. Grades: ≥95%. CAS No. 2305415-76-1. Molecular formula: C10H13FN2O6. Mole weight: 276.22.
2'-Deoxy-2'-fluoro-5-methyl-4'-thio-beta-D-arabinouridine, a nucleoside analogue with immense potential, has been leveraged to tackle malignant hematologic and solid tumors. Its action initiates with the disruption of cancer cell DNA synthesis, curbing their exuberance and metastasis. Clinical trials have hinted at its efficaciousness in suppressing the growth of leukemia, lymphoma and pancreatic carcinomas, inducing a ray of hope for patients suffering from these ailments. Synonyms: 2,4(1H,3H)-Pyrimidinedione, 1-(2-deoxy-2-fluoro-4-thio-β-D-arabinofuranosyl)-5-methyl-; 1-[(2R,3S,4S,5R)-3-fluoro-4-hydroxy-5-(hydroxymethyl)thiolan-2-yl]-5-methylpyrimidine-2,4-dione; 1-(2-Deoxy-2-fluoro-4-thio-beta-D-arabinofuranosyl)-4-hydroxy-5-methylpyrimidin-2(1H)-one; 1-[(2R,3S,4S,5R)-3-fluoro-4-hydroxy-5-(hydroxymethyl)tetrahydrothiophen-2-yl]-5-methyl-pyrimidine-2,4-dione. Grades: ≥95%. CAS No. 135123-34-1. Molecular formula: C10H13FN2O4S. Mole weight: 276.28.
2'-Deoxy-2'-fluorocytidine hydrate
2'-Deoxy-2'-fluorocytidine hydrate is a nucleoside analog with potent anti-cancer activity due to its ability to disrupt DNA synthesis, resulting in cancer cell death. This small molecule has demonstrated efficacy against a range of malignancies, including colon, lung, and pancreatic cancers. Moreover, ongoing research is exploring its use in combating challenging viral infections, such as hepatitis B and HIV. Synonyms: 2-Deoxy-2-fluorocytidine hydrate. CAS No. 1820580-34-4. Molecular formula: C9H14FN3O5. Mole weight: 263.22.
2'-Fluoro-2'-deoxyuridine-5'-triphosphate trisodium salt
2'-Fluoro-2'-deoxyuridine-5'-triphosphate trisodium salt, a nucleotide analog in biochemistry and molecular biology, stands out due to its versatility as a substrate for DNA Polymerases in DNA synthesis studies. Moreover, it shows promise as an anti-cancer agent in treating breast cancer and pancreatic cancer by hindering DNA replication. With this in mind, its relevance and significance linger in the scientific community and beyond. Synonyms: 2'-Deoxy-2'-fluorouridine 5'-(tetrahydrogen triphosphate) trisodium salt; 2'-Fluoro-dUTP trisodium salt. Grades: ≥97% by HPLC. Molecular formula: C9H11FN2Na3O14P3. Mole weight: 552.08.
Used in the preparation of oxetanone derivatives as pancreatic lipase inhibitors. Group: Biochemicals. Grades: Highly Purified. CAS No. 104801-67-4. Pack Sizes: 25mg. US Biological Life Sciences.
Used in the preparation of Taspase1 inhibitors and α-methylene-γ-butyrolactones. α-Methylene-γ-butyrolactones have the ability to suppress growth in pancreatic carcinoma cells. Group: Biochemicals. Alternative Names: 2-(Iodomethyl)-4,4,5,5-tetramethyl-1,3,2-dioxoborolane. Grades: Highly Purified. CAS No. 70557-99-2. Pack Sizes: 50mg. US Biological Life Sciences.
(2R,3R,4R,5S)-5-(4-Benzamido-2-oxopyrimidin-1(2H)-yl)-2-((benzoyloxy)methyl)-4-chloro-4-methyltetrahydrofuran-3-yl benzoate, a potent anticancer drug, has been shown to provide treatment benefits in diverse forms of cancer like pancreatic, lung, and colon cancers. Acting through the suppression of certain cancer-related proteins, it successfully impedes cancerous cell growth and division, thereby deterring the progression of this morbidity. Its structural and functional attributes render it an indispensable agent in the fight against cancer. Molecular formula: C31H26ClN3O7. Mole weight: 588.01.
(2S,3R,4S,5R)-2-(6-Amino-2-chloro-9H-purin-9-yl)-5-(hydroxymethyl)tetrahydrofuran-3,4-diol hydrochloride, an anti-cancer drug, exerts its therapeutic effects by suppressing enzymatic activity vital to cancer cell growth and spread. Regarded as a crucial component in the treatment of malignancies such as non-small cell lung cancer, colorectal cancer, and pancreatic cancer, this agent is administered in tandem with other chemo-therapeutic agents, although adverse events such as nausea, vomiting, and diarrhea must be carefully monitored. Grades: 97%. CAS No. 2015222-38-3. Molecular formula: C10H13Cl2N5O4. Mole weight: 338.15.
(2S,3S,5S)-N-((R)-Methylbenzyl)-5-[(N-Formyl-L-luecyl)oxy]-2-hexyl-3-hydroxyhexadecanamide is an impurity of Orilostat (O686500), an antiobesity agent and pancreatic lipase inhibitor. Group: Biochemicals. Grades: Highly Purified. Pack Sizes: 2.5mg, 5mg. Molecular Formula: C37H64N2O5, Molecular Weight: 616.91. US Biological Life Sciences.
(3aR,5R,6S,6aR)-5-Allyl-2,2-dimethyltetrahydrofuro[2,3-d][1,3]dioxol-6-ol, an organic compound, exhibits promising anti-tumor activities by hindering the growth of pancreatic cancer cells. Possible therapeutic application of this compound may render it a valuable candidate for pancreatic cancer treatment. Synonyms: (3aR,5R,6S,6aR)-5-allyl-2,2-dimethyltetrahydrofuro[2,3-d][1,3]dioxol-6-ol; (3aR,5R,6S,6aR)-2,2-dimethyl-5-prop-2-enyl-3a,5,6,6a-tetrahydrofuro[2,3-d][1,3]dioxol-6-ol; (3AR,5R,6S,6aR)-5-Allyl-2,2-dimethyltetrahydrofuro-[2,3-d][1,3]dioxol-6-ol; SCHEMBL14403626; AC-33220; E83767. CAS No. 546141-37-1. Molecular formula: C10H16O4. Mole weight: 200.23.
3'-beta-C-Methyl-N6-isopentenyladenosine
3'-beta-C-Methyl-N6-isopentenyladenosine, a highly potent nucleoside analogue prominent in the biomedical sector, prevails as a pivotal asset. Successfully harnessing its prowess, this compound exhibits remarkable efficacy when combating specific malignant neoplasms such as breast, lung, and pancreatic cancers. Synonyms: 3'-C-Methyl-N6-isopentenyladenosine. Grades: ≥95%. Molecular formula: C16H23N5O4. Mole weight: 349.38.
3-Hexyldihydro-6-undecyl-2H-pyran-2,4(3H)-dione
An impurity formed during the preparation of oxetanone derivatives as pancreatic lipase inhibitors. Group: Biochemicals. Grades: Highly Purified. CAS No. 104801-95-8. Pack Sizes: 250mg. US Biological Life Sciences.
Worldwide
3'-Sulpho Lewisa-BSA (3 atom spacer)
3'-Sulpho Lewisa-BSA (3 atom spacer) is a uniquely crafted protein conjugate that is tailored for the detection of Lewis antigen in cancer cells. With its proprietary binding mechanism that homes in on the glycosyltransferase enzyme, this protein effectively paves the way for accurate measurement of the Lewis antigen levels. Distinguishing this protein from its counterparts in the market, is its 3 atom spacer designed to optimize the protein's affinity to its recognition site, thus magnifying the sensitivity and precision of assays. By exploiting the discovery that the Lewis antigen has been implicated in a spectrum of cancers such as lung, breast, ovarian, and pancreatic, this breakthrough protein holds the potential to serve as a critical diagnostic tool for cancer detection.
4,5-Dicaffeoylquinic acid
4,5-Dicaffeoylquinic acid (Isochlorogenic acid C) is an antioxidant, can be isolated from Gynura divaricata and Laggera alata. 4,5-Dicaffeoylquinic acid reduces islet cell apoptosis and improves pancreatic function in type 2 diabetic mice, and has obvious inhibitory activities against yeast α-glucosidase. 4,5-Dicaffeoylquinic acid inhibits prostate cancer cells through cell cycle arrest. 4,5-Dicaffeoylquinic acid also has anti-apoptotic, anti-injury and anti- hepatitis B virus effects [1] [2] [3]. Uses: Scientific research. Group: Natural products. Alternative Names: Isochlorogenic acid C. CAS No. 57378-72-0. Pack Sizes: 10 mM * 1 mL; 1 mg; 5 mg; 10 mg. Product ID: HY-N0058.
4,5-Dicaffeoylquinic acid
4,5-Dicaffeoylquinic acid (Isochlorogenic acid C) is an antioxidant, can be isolated from Gynura divaricata and Laggera alata. 4,5-Dicaffeoylquinic acid reduces islet cell apoptosis and improves pancreatic function in type 2 diabetic mice, and has obvious inhibitory activities against yeast α-glucosidase. 4,5-Dicaffeoylquinic acid inhibits prostate cancer cells through cell cycle arrest. 4,5-Dicaffeoylquinic acid also has anti-apoptotic, anti-injury and anti-hepatitis B virus effects. Uses: Designed for use in research and industrial production. Additional or Alternative Names: Isochlorogenic acid C. Product Category: Inhibitors. Appearance: Powder. CAS No. 57378-72-0. Molecular formula: C25H24O12. Mole weight: 516.45. Purity: 0.98. IUPACName: (1R,3R,4S,5R)-3,4-bis[[(E)-3-(3,4-dihydroxyphenyl)prop-2-enoyl]oxy]-1,5-dihydroxycyclohexane-1-carboxylic acid. Canonical SMILES: C1[C@H]([C@@H]([C@@H](C[C@]1(C(=O)O)O)OC(=O)/C=C/C2=CC(=C(C=C2)O)O)OC(=O)/C=C/C3=CC(=C(C=C3)O)O)O. Product ID: ACM57378720-1. Alfa Chemistry ISO 9001:2015 Certified. Categories: 4,5-Dicqa.
An isomer of Gemcitabina. Gemcitabine is a nucleoside analog used to treat various cancers including, non-small cell lung cancer, pancreatic cancer, bladder cancer, and breast cancer. Synonyms: Gemcitabina. Grades: 95%. CAS No. 103882-84-4. Molecular formula: C9H11F2N3O4. Mole weight: 263.198.
4-Toluoyl 2,3-di-O-benzoyl-4,6-O-benzylidene-b-D-thioglucopyranoside, an indispensable compound with extensive applications in the field of biomedicine, holds immense scientific value. Its remarkable functionality as a glucokinase enzyme activator offers promising prospects for the treatment of diabetes. Moreover, the inhibitory effects demonstrated against pancreatic α-amylase and α-glucosidase make it a compelling contender for the advancement of anti-diabetic pharmaceuticals. Molecular formula: C35H30O8S. Mole weight: 610.68.
5,6-Epoxyeicosatrienoic acid
5,6-Epoxyeicosatrienoic acid (5,6-EET; (±)5,6-EpETrE) is a fully racemic version of the enantiomeric forms biosynthesized from arachidonic acid by cytochrome P450 enzymes. In solution, 5,6-Epoxyeicosatrienoic acid degrades into 5,6-DiHET and 5,6-δ-lactone, which can be converted to 5,6-DiHET and quantified by GC-MS. In neuroendocrine cells, such as the anterior pituitary and pancreatic islets, 5,6-Epoxyeicosatrienoic acid has been implicated in the mobilization of calcium and hormone secretion. 5,6-Epoxyeicosatrienoic acid is an inhibitor of T-type voltage-gated calcium channels (Cav3) that inhibits isoforms Cav3.1, Cav3.2 ( IC 50 =0.54 μM), and Cav3. and decreases nifedipine-resistant phenylephrine-induced vasoconstriction in isolated mouse mesenteric arteries via Cav3.2 blockade when used at a concentration of 3 μM. In addition, it is a substrate of COX-1 and COX-2. Uses: Scientific research. Group: Signaling pathways. Alternative Names: 5,6-EET; (±)5,6-EpETrE. CAS No. 87173-80-6. Pack Sizes: 25 μg (312.04 μM * 250 μL in Ethanol); 50 μg (312.04 μM * 500 μL in Ethanol); 100 μg (312.04 μM * 1 mL in Ethanol). Product ID: HY-132184.
5-Aza-2'-deoxyuridine (α/β mixture)
5-Aza-2'-deoxyuridine is a metabolite of 5-aza-2'-deoxycytidine, a cancer treatment, in particular to inhibit the growth of pancreatic endocrine tumor cell lines. Synonyms: 1-(2-Deoxy-D-erythro-pentofuranosyl)-1,3,5-triazine-2,4(1H,3H)-dione; 1-(2-Deoxy-D-erythro-pentofuranosyl)-s-triazine-2,4(1H,3H)-dione. Grades: 96%. Molecular formula: C8H11N3O5. Mole weight: 229.19.
5-Aza-2'-deoxyuridine (β Isomer)
5-Aza-2'-deoxyuridine is a metabolite of 5-aza-2'-deoxycytidine, a cancer treatment, in particular to inhibit the growth of pancreatic endocrine tumor cell lines. Synonyms: 1-(2-Deoxy-β-D-erythro-pentofuranosyl)-1,3,5-triazine-2,4(1H,3H)-dione; 5-Aza-2'-deoxy-β-uridine. Grades: 96%. CAS No. 25501-08-0. Molecular formula: C8H11N3O5. Mole weight: 229.19.
5'-Deoxy-5'-fluorothymidine
5'-Deoxy-5'-fluorothymidine, a compound of utmost significance in the biomedical field, manifests its indispensability in countering a diverse range of malignant neoplasms. Its profound therapeutic efficacy arises from its ability to impede the crucial enzymatic function of thymidylate synthase, pivotal for the replication and mending of DNA. Commencing with colorectal malignancies, this extraordinary product finds extensive utilization in chemotherapy protocols tailored for breast and pancreatic cancers as well. Synonyms: 2',5'-Dideoxy-5'-fluorothymidine. CAS No. 17199-43-8. Molecular formula: C10H13FN2O4. Mole weight: 244.22.
5-Fluoro-4'-thiouridine
5-Fluoro-4'-thiouridine is an influential pharmaceutical compound, used for studying diverse ailments, encompassing leukemia, pancreatic cancer and viral afflictions. Its inhibitory effects against both viruses and cancer cells are attributed to the inhibition of RNA enhancement and the initiation of apoptosis. Synonyms: Uridine, 5-fluoro-4'-thio-; 1-[(2R,3R,4S,5R)-3,4-dihydroxy-5-(hydroxymethyl)thiolan-2-yl]-5-fluoropyrimidine-2,4-dione. Grades: ≥95%. CAS No. 56527-42-5. Molecular formula: C9H11FN2O5S. Mole weight: 278.26.
5-Fluorouridine-diphosphate disodium salt
5-Fluorouridine-diphosphate disodium salt, a potent biochemical, holds great promise in treating cancer. Its dual mechanism of RNA synthesis inhibition and nucleotide metabolism inhibition leads to its effectiveness in minimizing tumor growth. Remarkably, it has been proven to specifically target breast, colon, and pancreatic cancers. Clinical insights indicate that it is applied in combination chemotherapy to achieve maximum efficacy. Synonyms: 5-Fluorouridine 5'-(Trihydrogen Diphosphate) disodium salt; 5-Fluoro-Udp disodium salt. Grades: ≥97% by HPLC. Molecular formula: C9H11FN2Na2O12P2. Mole weight: 466.11.
5-Methoxy-2-thiouridine
5-Methoxy-2-thiouridine, an extraordinary biomedical substance, manifests remarkable therapeutic efficacy across a myriad of afflictions. Its profound antioxidative attributes not only combat oxidative stress but also unveil groundbreaking prospects in combating neoplasms such as leukemia and pancreatic cancer. Synonyms: 5-Methoxy-1-beta-D-ribofuranosyl-2-sulfanylidene-2,3-dihydropyrimidin-4(1H)-one; 1-((2R,3R,4S,5R)-3,4-dihydroxy-5-(hydroxymethyl)tetrahydrofuran-2-yl)-5-methoxy-2-thioxo-2,3-dihydropyrimidin-4(1H)-one. Grades: ≥95%. CAS No. 30771-43-8. Molecular formula: C10H14N2O6S. Mole weight: 290.29.
5-Methyl-L-Norleucine Orlistat Analogue
An impurity of Orlistat, which a pancreatic lipase inhibitor acting locally in the gastrointestinal tract to inhibit lipase. Synonyms: 5-Methyl-L-norleucine Orlistat Analogue;N-Formyl-5-methyl-L-norleucine (1S)-1-[[(2S,3S)-3-Hexyl-4-oxo-2-oxetanyl]methyl]dodecyl Ester. Grades: > 95%. CAS No. 1356847-30-7. Molecular formula: C30H55NO5. Mole weight: 509.78.
5-Propynyl-cytidine
5-Propynyl-cytidine, a nucleoside analog with antitumor and antiviral properties, is used to inhibit RNA synthesis in certain viruses. Studies demonstrate its efficacy in treating hepatocellular carcinoma and pancreatic cancer. In addition, its ability to selectively target cancerous cells while sparing healthy ones, provides a promising avenue for future cancer treatments. Grades: ≥ 98% by HPLC. Molecular formula: C12H15N3O5. Mole weight: 281.26.
Would you like to list your products on USA Chemical Suppliers?
Our database is helping our users find suppliers everyday.