polypeptide suppliers USA

Find where to buy products from suppliers in the USA, including: distributors, industrial manufacturers in America, bulk supplies and wholesalers of raw ingredients & finished goods.

Search for products or services, then visit the American suppliers website for prices, SDS or more information. You can also view suppliers in Australia, NZ or the UK.

Product
polypeptide N-acetylgalactosaminyltransferase Requires both Mn2+ and Ca2+. The glycosyl residue is transferred to threonine or serine hydroxy groups on the polypeptide core of submaxillary mucin, κ-casein, apofetuin and some other acceptors of high molecular mass. Group: Enzymes. Synonyms: protein-UDP acetylgalactosaminyltransferase; UDP-GalNAc:polypeptide N-acetylgalactosaminyl transferase; UDP-N-acetylgalactosamine:κ-casein polypeptide N-acetylgalactosaminyltransferase; uridine diphosphoacetylgalactosamine-glycoprotein acetylgalactosaminyltransferase; glycoprotein acet. Enzyme Commission Number: EC 2.4.1.41. CAS No. 9075-15-4. Storage: Store it at +4 ?C for short term. For long term storage, store it at -20 ?C?-80 ?C. Form: Liquid or lyophilized powder. EXWM-2588; polypeptide N-acetylgalactosaminyltransferase; EC 2.4.1.41; 9075-15-4; protein-UDP acetylgalactosaminyltransferase; UDP-GalNAc:polypeptide N-acetylgalactosaminyl transferase; UDP-N-acetylgalactosamine:κ-casein polypeptide N-acetylgalactosaminyltransferase; uridine diphosphoacetylgalactosamine-glycoprotein acetylgalactosaminyltransferase; glycoprotein acetylgalactosaminyltransferase; polypeptide-N-acetylgalactosamine transferase; UDP-acetylgalactosamine-glycoprotein acetylgalactosaminyltransferase; UDP-acetylgalactosamine:peptide-N-galactosaminyltransferase; UDP-GalNAc:polypeptide N-acetylgalactosami Creative Enzymes
Antifreeze Polypeptide 6 (winter flounder) Antifreeze Polypeptide 6 (winter flounder) is the component 6 of the winter flounder's antifreeze polypeptides. Antifreeze Polypeptide 6 (winter flounder) lowers the plasma freezing point by arresting the growth of ice nuclei [1]. Uses: Scientific research. Group: Peptides. CAS No. 122604-16-4. Pack Sizes: 1 mg; 5 mg; 10 mg. Product ID: HY-P3832. MedChemExpress MCE
Antifreeze Polypeptide 6 (winter flounder) Antifreeze polypeptides (AFP) have the common ability to lower the freezing point of serum, thus allowing fish to survive in sub-zero ocean temperatures. Type I AFPs are found in the blood of winter flounder, yellowtail flounder, Alaskan plaice, and the shorthorn and grubby sculpin. AFP37 (HPLC6) is isolated from the winter flounder, Pseudopleuronectes americanus, and consists of 37 amino acids arranged in three 11-residue repeats to form α-helices. Synonyms: AFP 6 (winter flounder); H-Asp-Thr-Ala-Ser-Asp-Ala-Ala-Ala-Ala-Ala-Ala-Leu-Thr-Ala-Ala-Asn-Ala-Lys-Ala-Ala-Ala-Glu-Leu-Thr-Ala-Ala-Asn-Ala-Ala-Ala-Ala-Ala-Ala-Ala-Thr-Ala-Arg-OH; L-alpha-aspartyl-L-threonyl-L-alanyl-L-seryl-L-alpha-aspartyl-L-alanyl-L-alanyl-L-alanyl-L-alanyl-L-alanyl-L-alanyl-L-leucyl-L-threonyl-L-alanyl-L-alanyl-L-asparagyl-L-alanyl-L-lysyl-L-alanyl-L-alanyl-L-alanyl-L-alpha-glutamyl-L-leucyl-L-threonyl-L-alanyl-L-alanyl-L-asparagyl-L-alanyl-L-alanyl-L-alanyl-L-alanyl-L-alanyl-L-alanyl-L-alanyl-L-threonyl-L-alanyl-L-arginine; HPLC-6 (winter flounder); AFP37 (winter flounder). Grades: ≥95%. CAS No. 122604-16-4. Molecular formula: C133H225N43O51. Mole weight: 3242.47. BOC Sciences 2
Biotinyl-Pancreatic Polypeptide (human) Synonyms: Biotin-Pancreatic Polypeptide, human; Biotinyl-Ala-Pro-Leu-Glu-Pro-Val-Tyr-Pro-Gly-Asp-Asn-Ala-Thr-Pro-Glu-Gln-Met-Ala-Gln-Tyr-Ala-Ala-Asp-Leu-Arg-Arg-Tyr-Ile-Asn-Met-Leu-Thr-Arg-Pro-Arg-Tyr-NH2. Grades: ≥95% by HPLC. CAS No. 1816258-36-2. Molecular formula: C195H301N55O56S3. Mole weight: 4408.01. BOC Sciences 6
Bovine Heme Iron Polypeptide (HIP) 2% Iron Bovine Heme Iron Polypeptide (HIP) 2% Iron. Pharma Resources International LLC
CA, FL & NJ
Collagens polypeptide Collagen is a major structural protein that provides structure and strength to tissues in the body. Due to its biocompatibility, biodegradability, and high abundance, collagen has been utilized for many applications in biomedical research. Applications of fibrillar collagen may include: Development of collagen-based tissues for skin replacement, bone substitutes and to generate artificial blood vessels and valves. Drug delivery systems such as sponges for burns/wounds, formulations with liposomes for sustained drug delivery, materials for transdermal drug delivery, and nanoparticles for gene delivery. As collagen scaffolds for research in cancer, electrophysiological protocols, neuron myelination, immunology and other cell culture applications. Synonyms: Collagenpowder; collagens; BOVINE COLLAGEN TYPE II; COLLAGEN TYPE IV, HUMAN; COLLAGEN, TYPE IV, HUMAN PLACENTA; COLLAGEN TYPE IV (HU PLACENTA); COLLAGEN TYPE V (HU PLACENTA); COLLAGEN, TYPE 5. CAS No. 9007-34-5. BOC Sciences
[cPP1-7,NPY19-23,Ala31,Aib32,Gln34]-hPancreatic Polypeptide A Y5 receptor-selective agonist (IC50 values for inhibition of NPY binding to human Y5, Y1, Y2 and Y4 receptors are 0.24, 530, > 500, and 51 nM respectively, Ki at Y5 = 0.1-0.15 nM). Synonyms: GPSQPTYPGDNATPEQMARYYSALRRYINMAXRQRY. CAS No. 313988-89-5. Molecular formula: C183H281N57O54S2. Mole weight: 4207.67. BOC Sciences 10
Gastric Inhibitory Polypeptide (1-30) amide (porcine) It is a fully glucose-dependent insulinotropic polypeptide (GIP) receptor agonist with high affinity equal to native GIP(1-42). It is a weak inhibitor of gastric acid secretion and a strong stimulator of insulin. The site responsible for insulinotropic activity is apparently located between residues 19 and 30 of GIP. Synonyms: Glucose-Dependent Insulinotropic Polypeptide (1-30) amide (porcine); H-Tyr-Ala-Glu-Gly-Thr-Phe-Ile-Ser-Asp-Tyr-Ser-Ile-Ala-Met-Asp-Lys-Ile-Arg-Gln-Gln-Asp-Phe-Val-Asn-Trp-Leu-Leu-Ala-Gln-Lys-NH2; L-tyrosyl-L-alanyl-L-alpha-glutamyl-glycyl-L-threonyl-L-phenylalanyl-L-isoleucyl-L-seryl-L-alpha-aspartyl-L-tyrosyl-L-seryl-L-isoleucyl-L-alanyl-L-methionyl-L-alpha-aspartyl-L-lysyl-L-isoleucyl-L-arginyl-L-glutaminyl-L-glutaminyl-L-alpha-aspartyl-L-phenylalanyl-L-valyl-L-asparagyl-L-tryptophyl-L-leucyl-L-leucyl-L-alanyl-L-glutaminyl-L-lysinamide; GIP (1-30) amide, porcine. Grades: ≥95%. CAS No. 134846-93-8. Molecular formula: C162H245N41O47S. Mole weight: 3551.04. BOC Sciences 6
Gastric Inhibitory Polypeptide (3-42) (human) Gastric Inhibitory Polypeptide (3-42) (human), the main physiological degradation product of gastric inhibitory polypeptide (GIP), is produced by proteolytic processing of GIP by dipeptidyl peptidase IV (DPP IV). It is a glucose-dependent insulinotropic polypeptide (GIP) receptor antagonist that regulates insulin secretion and GIP metabolism in vivo. Synonyms: GIP (3-42) (human); H-Glu-Gly-Thr-Phe-Ile-Ser-Asp-Tyr-Ser-Ile-Ala-Met-Asp-Lys-Ile-His-Gln-Gln-Asp-Phe-Val-Asn-Trp-Leu-Leu-Ala-Gln-Lys-Gly-Lys-Lys-Asn-Asp-Trp-Lys-His-Asn-Ile-Thr-Gln-OH; L-Glutamine, L-α-glutamylglycyl-L-threonyl-L-phenylalanyl-L-isoleucyl-L-seryl-L-α-aspartyl-L-tyrosyl-L-seryl-L-isoleucyl-L-alanyl-L-methionyl-L-α-aspartyl-L-lysyl-L-isoleucyl-L-histidyl-L-glutaminyl-L-glutaminyl-L-α-aspartyl-L-phenylalanyl-L-valyl-L-asparaginyl-L-tryptophyl-L-leucyl-L-leucyl-L-alanyl-L-glutaminyl-L-lysylglycyl-L-lysyl-L-lysyl-L-asparaginyl-L-α-aspartyl-L-tryptophyl-L-lysyl-L-histidyl-L-asparaginyl-L-isoleucyl-L-threonyl-. Grades: ≥95%. CAS No. 1802086-25-4. Molecular formula: C214H324N58O63S. Mole weight: 4749.35. BOC Sciences 6
Gastric Inhibitory Polypeptide (6-30) amide (human) Gastric Inhibitory Polypeptide (6-30) amide (human), a porcine homolog, antagonizes the induction of cAMP production of gastric inhibitory polypeptide (human) (GIP human) in vitro. Competitive binding studies showed that it exhibited a receptor-binding affinity equivalent to the gastric inhibitory polypeptide (human) with an IC50 of 3.08±0.57 nM. Synonyms: GIP (6-30) amide (human); H-Phe-Ile-Ser-Asp-Tyr-Ser-Ile-Ala-Met-Asp-Lys-Ile-His-Gln-Gln-Asp-Phe-Val-Asn-Trp-Leu-Leu-Ala-Gln-Lys-NH2; L-phenylalanyl-L-isoleucyl-L-seryl-L-alpha-aspartyl-L-tyrosyl-L-seryl-L-isoleucyl-L-alanyl-L-methionyl-L-alpha-aspartyl-L-lysyl-L-isoleucyl-L-histidyl-L-glutaminyl-L-glutaminyl-L-alpha-aspartyl-L-phenylalanyl-L-valyl-L-asparagyl-L-tryptophyl-L-leucyl-L-leucyl-L-alanyl-L-glutaminyl-L-lysinamide; glucose-dependent insulinotropic polypeptide (6-30) amide (human). Grades: ≥95% by HPLC. CAS No. 1139691-72-7. Molecular formula: C139H209N35O38S. Mole weight: 3010.42. BOC Sciences 6
Gastric Inhibitory Polypeptide human ?95% (HPLC). Group: Fluorescence/luminescence spectroscopy. Alfa Chemistry Analytical Products
Gastric Inhibitory Polypeptide (porcine) Synonyms: L-Tyrosyl-L-alanyl-L-α-glutamylglycyl-L-threonyl-L-phenylalanyl-L-isoleucyl-L-seryl-L-α-aspartyl-L-tyrosyl-L-seryl-L-isoleucyl-L-alanyl-L-methionyl-L-α-aspartyl-L-lysyl-L-isoleucyl-L-arginyl-L-glutaminyl-L-glutaminyl-L-α-aspartyl-L-phenylalanyl-L-valyl-L-asparaginyl-L-tryptophyl-L-leucyl-L-leucyl-L-alanyl-L-glutaminyl-L-lysylglycyl-L-lysyl-L-lysyl-L-seryl-L-α-aspartyl-L-tryptophyl-L-lysyl-L-histidyl-L-asparaginyl-L-isoleucyl-L-threonyl-L-glutamine; Gastric inhibitory polypeptide (pig major); Gastric inhibitory polypeptide (swine major); Gastric inhibitory polypeptide (pig); Pig gastric inhibitory polypeptide; Porcine gastric inhibitory peptide; Porcine gastric inhibitory polypeptide; H-Tyr-Ala-Glu-Gly-Thr-Phe-Ile-Ser-Asp-Tyr-Ser-Ile-Ala-Met-Asp-Lys-Ile-Arg-Gln-Gln-Asp-Phe-Val-Asn-Trp-Leu-Leu-Ala-Gln-Lys-Gly-Lys-Lys-Ser-Asp-Trp-Lys-His-Asn-Ile-Thr-Gln-OH. CAS No. 11063-17-5. Molecular formula: C225H342N60O66S. Mole weight: 4975.55. BOC Sciences 6
Heme Iron Polypeptide (HIP) 2% Iron Heme Iron Polypeptide (HIP) 2% Iron. Pharma Resources International LLC
CA, FL & NJ
Napin-like polypeptide Napin-like polypeptide is a polypeptide with translation-inhibitory, trypsin-inhibitory, antiproliferative and antibacterial activities from kale seeds. BOC Sciences 4
Neutrophil cationic antibacterial polypeptide Neutrophil cationic antibacterial polypeptide is an antimicrobial peptide found in Cavia porcellus (Domestic guinea pig), and has antibacterial activity. Synonyms: CAP11. Grades: >98%. BOC Sciences 4
PACAP-27, Amide, Sheep (Pituitary Adenylate Cyclase Activating Polypeptide, HSDGIFTDSYSRYRKQMAVKKy l AAVL-NH2) Increases cAMP levels in a dose-dependent manner (EC50=4.7nM). Increases tyrosine hydroxylase expression in chromaffin cells.CAS No:127317-03-7. Group: Biochemicals. Grades: Highly Purified. CAS No. 127317-03-7. Pack Sizes: 0.5mg. Molecular Formula: C???H???N??O??S, Molecular Weight: 3147.7. US Biological Life Sciences. USBiological 4
Worldwide
Pancreatic polypeptide Pancreatic polypeptide is a peptide secreted by the endocrine PP cells of the pancreas that regulates pancreatic secretory activity and also affects hepatic glycogen stores and gastrointestinal secretion [1]. Uses: Scientific research. Group: Peptides. CAS No. 59763-91-6. Pack Sizes: 1 mg; 5 mg; 10 mg. Product ID: HY-P4060. MedChemExpress MCE
Pancreatic Polypeptide, bovine Pancreatic Polypeptide, bovine, a straight chain polypeptide containing 36 amino acids, derived primarily from the pancreas, and stimulates pancreatic secretion by inhibiting secretin and cholecystokinin. As the NPY receptor agonist, it has a high affinity at NPYR4. Synonyms: Ala-Pro-Leu-Glu-Pro-Glu-Tyr-Pro-Gly-Asp-Asn-Ala-Thr-Pro-Glu-Gln-Met-Ala-Gln-Tyr-Ala-Ala-Glu-Leu-Arg-Arg-Tyr-Ile-Asn-Met-Leu-Thr-Arg-Pro-Arg-Tyr-NH2; Pancreatic polypeptide (pig), 6-L-glutamic acid-; Bovine pancreatic polypeptide. Grades: ≥95%. CAS No. 179986-89-1. Molecular formula: C186H287N53O56S2. Mole weight: 4225.78. BOC Sciences 3
Pancreatic polypeptide(human) Pancreatic polypeptide(human). Uses: Designed for use in research and industrial production. Additional or Alternative Names: PANCREATIC POLYPEPTIDE;PANCREATIC POLYPEPTIDE, HUMAN;PP, HUMAN;APLEPVYPGDNATPEQMAQYAADLRRYINMLTRPRY-NH2;H-ALA-PRO-LEU-GLU-PRO-VAL-TYR-PRO-GLY-ASP-ASN-ALA-THR-PRO-GLU-GLN-MET-ALA-GLN-TYR-ALA-ALA-ASP-LEU-ARG-ARG-TYR-ILE-ASN-MET-LEU-THR-ARG-PRO-ARG-TYR-NH2. Product Category: Heterocyclic Organic Compound. CAS No. 59763-91-6. Molecular formula: C185H287N53O54S2. Product ID: ACM59763916. Alfa Chemistry — ISO 9001:2015 Certified. Alfa Chemistry. 5
Pancreatic Polypeptide (human) Pancreatic Polypeptide (human). Group: Biochemicals. Grades: Purified. CAS No. 75976-10-2. Pack Sizes: 200ug. US Biological Life Sciences. USBiological 5
Worldwide
Pancreatic Polypeptide, human Pancreatic Polypeptide, human is a C-terminally amidated 36 amino acid peptide, which acts as a neuropeptide Y ( NPY ) Y4 / Y5 receptor agonist. Uses: Scientific research. Group: Peptides. Alternative Names: Human pancreatic polypeptide. CAS No. 75976-10-2. Pack Sizes: 500 μg; 1 mg; 5 mg. Product ID: HY-P0199. MedChemExpress MCE
Pancreatic Polypeptide, human Pancreatic polypeptide is an agonist of neuropeptide Y (NPY) receptors that reduces forskolin-induced cAMP accumulation in L-M(TK-) cells recombinantly expressing human and rat Y4 receptors (EC50s = 87.1 and 36.3 pM, respectively). It is believed to play an important role in the function of the gastrointestinal tract. Uses: Gastrointestinal agents. Synonyms: Human pancreatic polypeptide; L-alanyl-L-prolyl-L-leucyl-L-alpha-glutamyl-L-prolyl-L-valyl-L-tyrosyl-L-prolyl-glycyl-L-alpha-aspartyl-L-asparagyl-L-alanyl-L-threonyl-L-prolyl-L-alpha-glutamyl-L-glutaminyl-L-methionyl-L-alanyl-L-glutaminyl-L-tyrosyl-L-alanyl-L-alanyl-L-alpha-aspartyl-L-leucyl-L-arginyl-L-arginyl-L-tyrosyl-L-isoleucyl-L-asparagyl-L-methionyl-L-leucyl-L-threonyl-L-arginyl-L-prolyl-L-arginyl-L-tyrosinamide; Ala-Pro-Leu-Glu-Pro-Val-Tyr-Pro-Gly-Asp-Asn-Ala-Thr-Pro-Glu-Gln-Met-Ala-Gln-Tyr-Ala-Ala-Asp-Leu-Arg-Arg-Tyr-Ile-Asn-Met-Leu-Thr-Arg-Pro-Arg-Tyr-NH2. Grades: ≥95%. CAS No. 75976-10-2. Molecular formula: C185H287N53O54S2. Mole weight: 4181.71. BOC Sciences 3
Pancreatic Polypeptide, rat Pancreatic Polypeptide, rat is an agonist of NPY receptor with high affinity at NPYR4. Synonyms: Rat pancreatic polypeptide; Ala-Pro-Leu-Glu-Pro-Met-Tyr-Pro-Gly-Asp-Tyr-Ala-Thr-His-Glu-Gln-Arg-Ala-Gln-Tyr-Glu-Thr-Gln-Leu-Arg-Arg-Tyr-Ile-Asn-Thr-Leu-Thr-Arg-Pro-Arg-Tyr-NH2; L-alanyl-L-prolyl-L-leucyl-L-alpha-glutamyl-L-prolyl-L-methionyl-L-tyrosyl-L-prolyl-glycyl-L-alpha-aspartyl-L-tyrosyl-L-alanyl-L-threonyl-L-histidyl-L-alpha-glutamyl-L-glutaminyl-L-arginyl-L-alanyl-L-glutaminyl-L-tyrosyl-L-alpha-glutamyl-L-threonyl-L-glutaminyl-L-leucyl-L-arginyl-L-arginyl-L-tyrosyl-L-isoleucyl-L-asparagyl-L-threonyl-L-leucyl-L-threonyl-L-arginyl-L-prolyl-L-arginyl-L-tyrosinamide. Grades: ≥95%. CAS No. 90419-12-8. Molecular formula: C195H298N58O57S. Mole weight: 4398.87. BOC Sciences 3
(Pro3)-Gastric Inhibitory Polypeptide (human) (Pro3)-Gastric Inhibitory Polypeptide (human) is an antagonist of GIP. Synonyms: (Pro3)-GIP (human); H-Tyr-Ala-Pro-Gly-Thr-Phe-Ile-Ser-Asp-Tyr-Ser-Ile-Ala-Met-Asp-Lys-Ile-His-Gln-Gln-Asp-Phe-Val-Asn-Trp-Leu-Leu-Ala-Gln-Lys-Gly-Lys-Lys-Asn-Asp-Trp-Lys-His-Asn-Ile-Thr-Gln-OH; L-tyrosyl-L-alanyl-L-prolyl-glycyl-L-threonyl-L-phenylalanyl-L-isoleucyl-L-seryl-L-alpha-aspartyl-L-tyrosyl-L-seryl-L-isoleucyl-L-alanyl-L-methionyl-L-alpha-aspartyl-L-lysyl-L-isoleucyl-L-histidyl-L-glutaminyl-L-glutaminyl-L-alpha-aspartyl-L-phenylalanyl-L-valyl-L-asparagyl-L-tryptophyl-L-leucyl-L-leucyl-L-alanyl-L-glutaminyl-L-lysyl-glycyl-L-lysyl-L-lysyl-L-asparagyl-L-alpha-aspartyl-L-tryptophyl-L-lysyl-L-histidyl-L-asparagyl-L-isoleucyl-L-threonyl-L-glutamine. Grades: ≥95%. CAS No. 299898-52-5. Molecular formula: C226H338N60O64S. Mole weight: 4951.60. BOC Sciences 6
TAT-NSF222scr Fusion Polypeptide, scrambled It is a scrambled TAT-NSF222scr fusion polypeptide. It consists of 11 amino acids from the cell permeable human immunodeficiency virus TAT polypeptide, 3 glycines as a linker, followed by scrambled N-Ethyl-maleimide-sensitive factor (NSF) D1 domain. It is used as a control for the TAT-NSF222 peptide. Synonyms: H-Tyr-Gly-Arg-Lys-Lys-Arg-Arg-Gln-Arg-Arg-Arg-Gly-Gly-Gly-Glu-Asn-Ser-Phe-Arg-Phe-Leu-Ala-Asp-Ile-Phe-Pro-Ala-Lys-Ala-Phe-Pro-Val-Arg-Phe-Glu-OH. Grades: ≥95%. Molecular formula: C190H298N64O46. Mole weight: 4214.88. BOC Sciences 4
TAT-NSF81scr Fusion Polypeptide, scrambled It is a scrambled peptide containing the TAT domain and 20 of N-Ethyl-maleimide-sensitive factor 81 (NSF81). TAT-NSF81scr is used to measure the effect of the active and control peptides upon NSF activities and exocytosis. Synonyms: H-Tyr-Gly-Arg-Lys-Lys-Arg-Arg-Gln-Arg-Arg-Arg-Gly-Gly-Gly-Gln-Asp-Gly-Cys-Lys-Tyr-Phe-Ala-Thr-Asp-Glu-Thr-Ile-Met-Lys-Leu-Ser-Ile-Ala-Ile-OH. Grades: ≥97%. Molecular formula: C169H284N58O48S2. Mole weight: 3960.61. BOC Sciences 4
Vasoactive intestinal polypeptide Vasoactive intestinal polypeptide is a peptide hormone with vasoactive activity in the intestine, and has the functions of neuromodulator and neurotransmitter. Synonyms: H-His-Ser-Asp-Ala-Val-Phe-Thr-Asp-Asn-Tyr-Thr-Arg-Leu-Arg-Lys-Gln-Met-Ala-Val-Lys-Lys-Tyr-Leu-Asn-Ser-Ile-Leu-Asn-OH. CAS No. 37221-79-7. Molecular formula: C147H237N43O43S. Mole weight: 3326.8. BOC Sciences 5
10-deoxymethynolide synthase The product, 10-deoxymethynolide, contains a 12-membered ring and is an intermediate in the biosynthesis of methymycin in the bacterium Streptomyces venezuelae. The enzyme also produces narbonolide (see EC 2.3.1.240, narbonolide synthase). The enzyme has 29 active sites arranged in four polypeptides (pikAI - pikAIV) with a loading domain, six extension modules and a terminal thioesterase domain. Each extension module contains a ketosynthase (KS), keto reductase (KR), an acyltransferase (AT) and an acyl-carrier protein (ACP). Not all active sites are used in the biosynthesis. Group: Enzymes. Synonyms: pikromycin PKS. Enzyme Commission Number: EC 2.3.1.239. Storage: Store it at +4 ?C for short term. For long term storage, store it at -20 ?C?-80 ?C. Form: Liquid or lyophilized powder. EXWM-2187; 10-deoxymethynolide synthase; EC 2.3.1.239; pikromycin PKS. Cat No: EXWM-2187. Creative Enzymes
1,1,1,3,3,3-Hexafluoro-2-propanol 1,1,1,3,3,3-Hexafluoro-2-propanol effects the native state of proteins, denaturing them as well as stabilizing the α-helical conformation of unfolded proteins and polypeptides. Group: Biochemicals. Alternative Names: 1,1,1,3,3,3-Hexafluoro-2-hydroxypropane; 1,1,1,3,3,3-Hexafluoroisopropanol; 1,1,1,3,3,3-Hexafluoroisopropyl Alcohol; 1,1,1,3,3,3-Hexafluoropropanol; 2, 2, 2-Trifluoro-1- (trifluoromethyl) ethanol; Bis (trifluoromethyl) methanol; HFIP; Hexafluoroisopropanol; Hexafluoroisopropyl Alcohol; NSC 96336. Grades: Highly Purified. CAS No. 920-66-1. Pack Sizes: 10g. US Biological Life Sciences. USBiological 3
Worldwide
1,1,1,3,3,3-Hexafluoro-2-propanol-d2 1,1,1,3,3,3-Hexafluoro-2-propanol-d2 is a labelled analogue of 1,1,1,3,3,3-Hexafluoro-2-propanol (H293880), it affects the native state of proteins, denaturing them as well as stabilizing the α-helical conformation of unfolded proteins and polypeptides. Group: Biochemicals. Grades: Highly Purified. CAS No. 38701-74-5. Pack Sizes: 250mg, 500mg. Molecular Formula: C3D2F6O. US Biological Life Sciences. USBiological 9
Worldwide
1, 11-Bis (maleimido) tetraethyleneglycol A sulfhydryl reactive homobifunctional reagent for polypeptide or small molecule conjugation. Group: Biochemicals. Alternative Names: 1,1'-[Oxybis(2,1-ethanediyloxy-2,1-ethanediyl)]bis-1H-pyrrole-2,5-dione; 1,11-Bis(maleimido)-3,6,9-trioxaundecane; N,N'-3,6,9-Trioxadecane-1,11-bismaleimide. Grades: Highly Purified. CAS No. 86099-06-1. Pack Sizes: 25mg. US Biological Life Sciences. USBiological 3
Worldwide
13-O-Ethylamphotericin B 13-O-Ethylamphotericin B is an analogue of 13-O-Methylamphotericin B, an antifungal. 13-O-Methylamphotericin B is a derivative of Amphotericin B, a polypeptide antibiotic active against gram positive bacteria. Antifungal. Synonyms: (1R, 3S, 5R, 6R, 9R, 11R, 15S, 16R, 17R, 18S, 19E, 21E, 23E, 25E, 27E, 29E, 31E, 33R, 35S, 36R, 37S)-33-(((2R, 3S, 4S, 5S, 6R)-4-Amino-3, 5-dihydroxy-6-methyltetrahydro-2H-pyran-2-yl)oxy)-1-ethoxy-3, 5, 6, 9, 11, 17, 37-heptahydroxy-15, 16, 18-trimethyl-13-oxo-14, 39-dioxabicyclo[33.3.1]nonatriaconta-19, 21, 23, 25, 27, 29, 31-heptaene-36-carboxylic Acid. Molecular formula: C49H77NO17. Mole weight: 952.13. BOC Sciences 12
13-O-Ethylamphotericin B 13-O-Ethylamphotericin B is an analogue of 13-O-Methylamphotericin B (M287440), an antifungal. 13-O-Methylamphotericin B is a derivative of Amphotericin B (A634250), a polypeptide antibiotic active against gram positive bacteria. Antifungal. Group: Biochemicals. Grades: Highly Purified. Pack Sizes: 5mg, 50mg. Molecular Formula: C49H77NO17, Molecular Weight: 952.13. US Biological Life Sciences. USBiological 9
Worldwide
13-O-Methylamphotericin B 13-O-Methylamphotericin B is an antifungal. 13-O-Methylamphotericin B is a derivative of Amphotericin B (A634250), a polypeptide antibiotic active against gram positive bacteria. Antifungal. Group: Biochemicals. Grades: Highly Purified. CAS No. 136135-57-4. Pack Sizes: 5mg, 50mg. Molecular Formula: C48H75NO17. US Biological Life Sciences. USBiological 9
Worldwide
13-O-Methylamphotericin B 13-O-Methylamphotericin B is an antifungal. 13-O-Methylamphotericin B is a derivative of Amphotericin B, a polypeptide antibiotic active against gram positive bacteria. Antifungal. Synonyms: 14,39-Dioxabicyclo[33.3.1]nonatriacontane Amphotericin B derivative. CAS No. 136135-57-4. Molecular formula: C48H75NO17. Mole weight: 938.11. BOC Sciences 12
1-Benzhydryl-3-cyanoazetidine A useful intermediate in the synthesis of polypeptides. Group: Biochemicals. Grades: Highly Purified. Pack Sizes: 500mg. US Biological Life Sciences. USBiological 1
Worldwide
1-Benzhydryl-3-methane sulfonatoazetidine (1-Diphenylmethyl-3-azetidinyl Methanethiosulfonate) A useful intermediate in the synthesis of polypeptides. Group: Biochemicals. Alternative Names: 1-Diphenylmethyl-3-azetidinyl Methanethiosulfonate. Grades: Highly Purified. Pack Sizes: 1g. US Biological Life Sciences. USBiological 1
Worldwide
1-Benzhydrylazetidin-3-ol (1-(Diphenylmethyl)-3-hydroxyazetinide) A useful intermediate in the synthesis of polypeptides. Group: Biochemicals. Alternative Names: 1-(Diphenylmethyl)-3-hydroxyazetinide. Grades: Highly Purified. Pack Sizes: 2g. US Biological Life Sciences. USBiological 1
Worldwide
1-Benzhydrylazetidine-2-carboxylic Acid An intermediate in the synthesis of high molecular weight polypeptides. Group: Biochemicals. Alternative Names: N-Benzhydryl-azetidine-2-carboxylic Acid; 1-(Diphenylmethyl)-2-azetidinecarboxylic Acid. Grades: Highly Purified. CAS No. 65219-11-6. Pack Sizes: 1g. US Biological Life Sciences. USBiological 2
Worldwide
1-Benzhydrylazetidine-3-carboxylic Acid (1- (Diphenylmethyl) azetidine-3-carboxylic Acid) A useful intermediate in the synthesis of polypeptides. Group: Biochemicals. Alternative Names: 1- (Diphenylmethyl) azetidine-3-carboxylic Acid. Grades: Highly Purified. Pack Sizes: 500mg. US Biological Life Sciences. USBiological 1
Worldwide
1-Methyl-3-azetidinemethanamine 1-Methyl-3-azetidinemethanamine is a derivative of Azetidine (A813000); a useful building block in the synthesis of polypeptides and other nitrogen containing compounds with potential biological properties. 1-Methyl-3-azetidinemethanamine is also used as a reagent in the synthesis of amidinourea derivatives as neuropeptide Y ligands. Group: Biochemicals. Grades: Highly Purified. CAS No. 1359656-98-6. Pack Sizes: 250mg, 2.5g. Molecular Formula: C5H12N2, Molecular Weight: 100.16. US Biological Life Sciences. USBiological 9
Worldwide
2-[2-[2- (2-Azidoethoxy) ethoxy]ethoxy]ethanol Applications in medical research, drug-release, nanotechnology, materials research and cell culture. In the study of ligand, polypeptide synthesis support, graft polymer compounds, new materials, and polyethylene glycol-modified functional coatings and other aspects of the active compound. Group: Biochemicals. Alternative Names: Azido-PEG4-OH; N3-PEG4-OH; 1-Azido-3,6,9-trioxaundecane-11-ol. Grades: Highly Purified. CAS No. 86770-67-4. Pack Sizes: 250mg, 500mg, 1g. Molecular Formula: C?H??N?O?, Molecular Weight: 219.24. US Biological Life Sciences. USBiological 6
Worldwide
2,4-Dinitrofluorobenzene A substituted benzene use in polypeptide sequencing (also referred to as Sanger’s reagent). Used in the derivitization of primary amines. Shown to inhibit the reductase activity of mitochondrial b-c1 complex isolated from beef heart mitochondria. Group: Biochemicals. Alternative Names: 1-Fluoro-2,4-dinitrobenzene; 2,4-Dinitrobenzene fluoride; 4-Fluoro-1,3-dinitrobenzene; DFB; DNFB; FDNB; Fluorodinitrobenzene; NSC 33519. Grades: Highly Purified. CAS No. 70-34-8. Pack Sizes: 25g. US Biological Life Sciences. USBiological 2
Worldwide
2-Amino-2-methyl-1,3-propanediol 2-Amino-2-methyl-1,3-propanediol. Synonyms: AMPD, Ammediol. CAS No. 115-69-5. Pack Sizes: 25, 100, 500 g in poly bottle. Product ID: CDC10-0205. Molecular formula: C4H11NO2. Category: Fragrance Agents. Product Keywords: Cosmetic Ingredients; Fragrance Agents; 2-Amino-2-methyl-1,3-propanediol; CDC10-0205; 115-69-5; C4H11NO2; AMPD, Ammediol; 204-100-7; MFCD00004678; 115-69-5. Purity: ≥99%. Color: White. EC Number: 204-100-7. Physical State: Crystalline. Solubility: H2O: 100 mg/mL, clear to slightly hazy, colorless to very faintly yellow. Quality Level: 300. Application: Buffer component in a SDS-gradient gel electrophoresis system that separates polypeptides in the molecular weight range of 1500 to 100,000. Used as a spacer in isotachophoresis of proteins. Also used as a buffer for the determination of alkaline phosphatase activity. Boiling Point: 151 °C/10 mmHg (lit.). Melting Point: 100-110 °C (lit.). Density: 1.0509 (estimate). CD Formulation
2-Methylazetidine 2-Methylazetidine is a derivative of Azetidine (A813000) which is a useful building block in the synthesis of polypeptides and other nitrogen containing compounds with potential biological properties. Group: Biochemicals. Grades: Highly Purified. CAS No. 19812-49-8. Pack Sizes: 50mg, 500mg. Molecular Formula: C4H9N, Molecular Weight: 71.12. US Biological Life Sciences. USBiological 10
Worldwide
2-Methylazetidine-d3 2-Methylazetidine-d3 is labelled 2-Methylazetidine (M265015) which is a derivative of Azetidine (A813000), a useful building block in the synthesis of polypeptides and other nitrogen containing compounds with potential biological properties. Group: Biochemicals. Grades: Highly Purified. Pack Sizes: 1mg. Molecular Formula: C4H6D3N, Molecular Weight: 74.14. US Biological Life Sciences. USBiological 10
Worldwide
2-Nitro-L-phenylalanine 2-Nitro-L-phenylalanine is a derivative of L-phenylalanine, and is used in the photocleavage of polypeptide backbones. L-Phenylalanine is an essential amino acid. L-Phenylalanine is biologically converted into L-tyrosine, another one of the DNA-encoded amino acids, which in turn is converted to L-DOPA and further converted into dopamine, norepinephrine, and epinephrine. Synonyms: H-Phe(2-NO2)-OH; L-3-(o-Nitrophenyl)-alanine; L-2-Nitrophenylalanine. Grades: ≥ 99% (HPLC, Chiral purity). CAS No. 19883-75-1. Molecular formula: C9H10N2O4. Mole weight: 210.19. BOC Sciences 5
3-Azetidinecarboxylic Acid (3-Carboxyazetidine) A useful intermediate in the synthesis of polypeptides. Group: Biochemicals. Alternative Names: 3-Carboxyazetidine. Grades: Highly Purified. Pack Sizes: 250mg. US Biological Life Sciences. USBiological 1
Worldwide
3-Boc-aminomethylazetidine 3-Boc-aminomethylazetidine is a derivative of Azetidine (A813000); a useful building block in the synthesis of polypeptides and other nitrogen containing compounds with potential biological properties. Group: Biochemicals. Grades: Highly Purified. CAS No. 91188-15-7. Pack Sizes: 250mg, 500 mg. Molecular Formula: C9H18N2O2, Molecular Weight: 186.25. US Biological Life Sciences. USBiological 10
Worldwide
3'-Dithiol Serinol CPG 3'-Dithiol Serinol CPG, an essential chemical for solid-phase peptide synthesis, is a promising solution to the challenge of preparing disulfide-rich peptides and proteins with higher efficiency. By facilitating the construction of polypeptide chains, this chemical helps to unravel the intricate mechanisms underlying disorders including heart disease, cancer, and Alzheimer's disease at the molecular level, paving the way for targeted intervention and therapy. Synonyms: 3-Dimethoxytrityloxy-2-(3-((R)-α-lipoamido)propanamido)propyl-1-O-succinyl-long chain alkylamino-CPG. Mole weight: 412.46. BOC Sciences 3
3- (Trifluoromethyl) azetidine Hydrochloride An azetidine (A813000) derivative that is useful as a building block in the synthesis of polypeptides and other nitrogen containing compounds with potential biological properties. Group: Biochemicals. Grades: Highly Purified. CAS No. 1221272-90-7. Pack Sizes: 25mg, 50mg. Molecular Formula: C4H6F3N HCl, Molecular Weight: 125.093646. US Biological Life Sciences. USBiological 10
Worldwide
4-(Hydroxymethyl)phenylacetic acid 4-(Hydroxymethyl)phenylacetic acid can serve as the main body of insoluble polypeptide. 4-(Hydroxymethyl)phenylacetic acid contains a benzen ring with substituted 1, 4 position [1]. Uses: Scientific research. Group: Signaling pathways. CAS No. 73401-74-8. Pack Sizes: 10 mM * 1 mL; 1 g; 5 g. Product ID: HY-W004128. MedChemExpress MCE
5-Propargylamino-ddUTP - ATTO-612Q 5-Propargylamino-ddUTP - ATTO-612Q is a fluorescent nucleotide analog used in the labeling of DNA in biomedical research. It is commonly used in assays for detecting Apolipoprotein B mRNA-editing enzyme catalytic polypeptide 1 (APOBEC1) activity and to study RNA damage caused by reactive oxygen species in diseases such as cancer and diabetes. Synonyms: 5-Propargylamino-2',3'-dideoxyuridine-5'-triphosphate, labeled with ATTO 612Q, Triethylammonium salt. Grades: ≥ 95% by HPLC. Molecular formula: C12H18N3O13P3- ATTO 612Q (free acid). Mole weight: 1177.20 (free acid). BOC Sciences 2
6-deoxyerythronolide-B synthase The product, 6-deoxyerythronolide B, contains a 14-membered lactone ring and is an intermediate in the biosynthesis of erythromycin antibiotics. Biosynthesis of 6-deoxyerythronolide B requires 28 active sites that are precisely arranged along three large polypeptides, denoted DEBS1, -2 and -3. The polyketide product is synthesized by the processive action of a loading didomain, six extension modules and a terminal thioesterase domain. Each extension module contains a minimum of a ketosynthase (KS), an acyltransferase (AT) and an acyl-carrier protein (ACP).The KS domain both accepts the growing polyketide chain from the previous module and catalyses the subsequent decarboxylat...e (cyclizing); erythronolide synthase; malonyl-CoA:propanoyl-CoA malonyltransferase (cyclizing); deoxyerythronolide B synthase; 6-deoxyerythronolide B synthase; DEBS. Enzyme Commission Number: EC 2.3.1.94. CAS No. 87683-77-0. Storage: Store it at +4 ?C for short term. For long term storage, store it at -20 ?C?-80 ?C. Form: Liquid or lyophilized powder. EXWM-2276; 6-deoxyerythronolide-B synthase; EC 2.3.1.94; 87683-77-0; erythronolide condensing enzyme; malonyl-CoA:propionyl-CoA malonyltransferase (cyclizing); erythronolide synthase; malonyl-CoA:propanoyl-CoA malonyltransferase (cyclizing); deoxyerythronolide B synthase; 6-deoxyerythronolide B synthase; DEBS. Cat No: EXWM-2276. Creative Enzymes
8-Epi-11,12-epoxy Erythromycin A An impurity of Erythromycin. Erythromycin is a macrolide antibiotic that inhibits bacterial protein synthesis by targeting the 55S ribosomal subunit, blocking the progression of nascent polypeptide chains. Synonyms: 8-Epi-11,12-epoxy Erythromycin A. Grades: > 95%. Molecular formula: C37H65NO12. Mole weight: 715.93. BOC Sciences 8
(9S)-9-Deoxo-12-deoxy-9,12-epoxyerythromycin (9S)-9-Deoxo-12-deoxy-9,12-epoxyerythromycin is a derivative of Erythromycin, a macrolide antibiotic that inhibits bacterial protein synthesis by targeting the 55S ribosomal subunit, blocking the progression of nascent polypeptide chains. Synonyms: Erythromycin, 9-deoxo-12-deoxy-9,12-epoxy-, (9S)-; (1R,2R,5R,6S,7S,8R,11R,12S,13S)-8-(((2S,3R,4S,6R)-4-(dimethylamino)-3-hydroxy-6-methyltetrahydro-2H-pyran-2-yl)oxy)-2-ethyl-9-hydroxy-6-(((2R,4R,5S,6S)-5-hydroxy-4-methoxy-4,6-dimethyltetrahydro-2H-pyran-2-yl)oxy)-1,5,7,9,11,13-hexamethyl-3,15-dioxabicyclo[10.2.1]pentadecane-4,14-dione. Grades: >95%. CAS No. 134108-11-5. Molecular formula: C37H68N2O13. Mole weight: 715.91. BOC Sciences 6
Acetyl-Coenzyme A acetyltransferase 2 from Human, Recombinant ACAT2 enzyme participates in lipid metabolism. ACAT2 takes part in lipoprotein assembly, catalyzing cholesterol esterification in mammalian cells. ACAT2 is an integral membrane protein that localizes to the endoplasmic reticulum of human intestinal cells. ACAT2 deficiency contributes to severe mental retardation and hypotonus. Acat2 recombinant human produced in e. coli is a single, non-glycosylated polypeptide chain containing 433 amino acids (1-397 a.a.) and having a molecular mass of 45.4 kda. the acat2 is fused to 36 amino acid his-tag at n-terminus and purified by proprietary chromatographic techniques. Group: Enzymes. Synonyms: Acetyl-CoA acetyltransferase cytosolic; Cytosolic acetoacetyl-CoA thiolase; ACAT2; Acetyl CoA transferase-like protein; ACAT-2. Purity: Greater than 95.0% as determined by SDS-PAGE. ACAT-2. Mole weight: 45.4 kDa. Stability: ACAT2 Human although stable at 4°C for 1 week, should be stored desiccated below -18°C. Please prevent freeze thaw cycles. Appearance: Sterile Filtered clear solution. Source: E. coli. Species: Human. Acetyl-CoA acetyltransferase cytosolic; Cytosolic acetoacetyl-CoA thiolase; ACAT2; Acetyl CoA transferase-like protein; ACAT-2. Cat No: NATE-0798. Creative Enzymes
adenylyl-sulfate kinase The human phosphoadenosine-phosphosulfate synthase (PAPSS) system is a bifunctional enzyme (fusion product of two catalytic activities). In a first step, sulfate adenylyltransferase catalyses the formation of adenosine 5'-phosphosulfate (APS) from ATP and inorganic sulfate. The second step is catalysed by the adenylylsulfate kinase portion of 3'-phosphoadenosine 5'-phosphosulfate (PAPS) synthase, which involves the formation of PAPS from enzyme-bound APS and ATP. In contrast, in bacteria, yeast, fungi and plants, the formation of PAPS is carried out by two individual polypeptides, sulfate adenylyltransferase (EC 2.7.7.4) and adenylyl-sulfate kinase (EC 2.7.1.25). Group: Enzymes. Synonyms: adenylylsulfate kinase (phosphorylating); 5'-phosphoadenosine sulfate kinase; adenosine 5'-phosphosulfate kinase; adenosine phosphosulfate kinase; adenosine phosphosulfokinase; . Enzyme Commission Number: EC 2.7.1.25. CAS No. 9012-38-8. Storage: Store it at +4 ?C for short term. For long term storage, store it at -20 ?C?-80 ?C. Form: Liquid or lyophilized powder. EXWM-3055; adenylyl-sulfate kinase; EC 2.7.1.25; 9012-38-8; adenylylsulfate kinase (phosphorylating); 5'-phosphoadenosine sulfate kinase; adenosine 5'-phosphosulfate kinase; adenosine phosphosulfate kinase; adenosine phosphosulfokinase; adenosine-5'-phosphosulfate-3'-phosphokinase; APS kinase. Cat No: EXWM-3055. Creative Enzymes
Adrenocorticotropic hormone Adrenocorticotropic hormone (ACTH) is a polypeptide tropic hormone produced by the anterior pituitary gland. Adrenocorticotropic hormone regulates cortisol and androgen production [1] [2]. Uses: Scientific research. Group: Peptides. Alternative Names: ACTH; Adrenocorticotrophic hormone. CAS No. 9002-60-2. Pack Sizes: 5 mg; 10 mg. Product ID: HY-106373. MedChemExpress MCE
Alanine Aminotransferase from Human, Recombinant Alanine transaminase (ALT) is a transaminase enzyme. It is also called alanine aminotransferase (ALAT) and was formerly called serum glutamate-pyruvate transaminase (SGPT) or serum glutamic-pyruvic transaminase (SGPT). ALT is found in plasma and in various body tissues, but is most common in the liver. It catalyzes the two parts of the alanine cycle. Serum ALT level, serum AST (aspartate transaminase) level, and their ratio (AST/ALT ratio) are commonly measured clinically as biomarkers for liver health. The tests are part of blood panels. Alanine aminotransferase human recombinant produced in e. coli is a homodimer, nonglycosylated, polypeptide chain containing 495a.a...inotransferase; pyruvate transaminase; pyruvate-alanine aminotransferase; pyruvate-glutamate transaminase. CAS No. 9000-86-6. Purity: Greater than 95.0% as determined by (a) Analysis by RP-HPLC. (b) Analysis by SDS-PAGE. ALT. Mole weight: 54,479 Da. Activity: 1,000 U/mg. Stability: AAT1 although stable at 10°C for 5 days, should be stored desiccated below -18°C. Please prevent freeze-thaw cycles. Appearance: Sterile liquid formulation. Source: E. coli. Species: Human. ALT1; Glutamic-pyruvic transaminase 1; GPT 1; Glutamic-alanine transaminase 1; AAT1; ALT; ALAT; SGPT; Alanine transaminase; alanine aminotransferase; GPT; β-alanine aminotransferase; alanine-α Creative Enzymes
α amylase α-Amylase isolated from porcine pancreas is a glycoprotein.2 It is a single polypeptide chain of approximately 475 residues containing 2 SH groups and four disulfide bridges and a tightly bound Ca2+ necessary for stability.3,4 Chloride ions are necessary for activity and stability5 The pH range for activity is 5.5 to 8.0, with the pH optimum at 7.6. Α-amylase from porcine pancreas. Applications: Α-amylase is used to hydrolyze α bonds of α-linked polysaccharides, such as starch and glycogen. product is from porcine pancreas and is type i-a. α-amylase has been used in various plant studies, such as metabolism studies in arabidopsis. Group: Enzymes. S...mission Number: EC 3.2.1.1. CAS No. 9000-90-2. α-Amylase. Mole weight: 51-54 kDa. Activity: 700-1400 units/mg protein (E1%/280). Stability: α-Amylase is stable in 25 mM Tris-HCl, pH 7.5, with 100 mM KCl, at 0 °C or at -20 °C for at least 9 days.8 Another recommended storage condition is in 1 mM phosphate, pH 7.3, with 30 mM CaCl2 at -15 °C. Appearance: Appearance (Color): White to Light Yellow Appearance (Form): Suspension. Form: PMSF treated, saline suspension. Alpha amylase enzyme; for flour; fungal alpha amylase enzyme; enhance quality of flour enzyme; enhance quality; alpha amylase enzyme; flour; alpha amylase; Alpha amylase enzyme for flour; FLO-1301. Cat No: BAK-250. Creative Enzymes
Amino-PEG3-t-butyl ester (Propanoic acid, 3-[2-[2- (2-aminoethoxy) ethoxy]ethoxy]-, 1,1-dimethylethyl ester) Applications in medical research, drug-release, nanotechnology, materials research and cell culture. In the study of ligand, polypeptide synthesis support, graft polymer compounds, new materials, and polyethylene glycol-modified functional coatings and other aspects of the active compound. Group: Biochemicals. Alternative Names: NH2-PEG3-CH2CH2COOtBu. Grades: Highly Purified. CAS No. 252881-74-6. Pack Sizes: 5g. Molecular Formula: C13H27NO5, Molecular Weight: 277.4. US Biological Life Sciences. USBiological 4
Worldwide
Amoxicillin Amoxicillin (Amoxycillin) is an antibiotic with good oral absorption and broad spectrum antimicrobial activity. Amoxicillin inhibits the biosynthesis of polypeptides in the cell wall, thereby inhibiting cell growth [1] [2] [3]. Uses: Scientific research. Group: Signaling pathways. Alternative Names: Amoxycillin. CAS No. 26787-78-0. Pack Sizes: 10 mM * 1 mL; 500 mg; 1 g; 5 g; 10 g. Product ID: HY-B0467A. MedChemExpress MCE
Amoxicillin sodium Amoxicillin (Amoxycillin) sodium is an antibiotic with good oral absorption and broad spectrum antimicrobial activity. Amoxicillin sodium inhibits the biosynthesis of polypeptides in the cell wall, thereby inhibiting cell growth [1] [2] [3]. Uses: Scientific research. Group: Signaling pathways. Alternative Names: Amoxycillin sodium. CAS No. 34642-77-8. Pack Sizes: 10 mM * 1 mL; 500 mg; 1 g; 5 g; 10 g. Product ID: HY-B0467. MedChemExpress MCE
Amoxicillin trihydrate Amoxicillin (Amoxycillin) trihydrateis an antibiotic with good oral absorption and broad spectrum antimicrobial activity. Amoxicillin trihydrateis inhibits the biosynthesis of polypeptides in the cell wall, thereby inhibiting cell growth [1] [2] [3]. Uses: Scientific research. Group: Signaling pathways. Alternative Names: Amoxycillin trihydrate. CAS No. 61336-70-7. Pack Sizes: 10 mM * 1 mL; 500 mg; 1 g; 5 g; 10 g. Product ID: HY-B0467B. MedChemExpress MCE
Amylin It is a polypeptide sequence containing 37 amino acids. Synonyms: Diabetes-associated peptide; IAPP; IAPP protein; Insulinoma amyloid peptide; Insulinoma amyloid polypeptide; Islet amyloid polypeptide; Protein IAPP; Proteins, IAPP. Grades: 95%. CAS No. 106602-62-4. BOC Sciences
Amylin (1-13) (human) Amylin (1-13) (human) does not form fibrils, and this region may be involved in amylin binding to the membranes. Synonyms: Diabetes-Associated Peptide (1-13) (human); H-Lys-Cys-Asn-Thr-Ala-Thr-Cys-Ala-Thr-Gln-Arg-Leu-Ala-OH (Disulfide bridge: Cys2-Cys7); L-lysyl-L-cysteinyl-L-asparagyl-L-threonyl-L-alanyl-L-threonyl-L-cysteinyl-L-alanyl-L-threonyl-L-glutaminyl-L-arginyl-L-leucyl-L-alanine (2->7)-disulfide; Islet Amyloid Polypeptide (1-13) (human); DAP (1-13) (human); Insulinoma Amyloid Peptide (1-13) (human); IAPP 1-13. Grades: ≥95% by HPLC. CAS No. 198328-30-2. Molecular formula: C54H95N19O19S2. Mole weight: 1378.58. BOC Sciences 2
Amylin (20-29) (human) Amylin (20-29) (human) forms fibrils ultrastructurally identical to amyloid fibrils seen in pancreatic islets. The region SNNFGAILSS appears to be the most important amyloidogenic sequence of hIAPP (human islet amyloid polypeptide). Synonyms: H-Ser-Asn-Asn-Phe-Gly-Ala-Ile-Leu-Ser-Ser-OH; L-seryl-L-asparagyl-L-asparagyl-L-phenylalanyl-glycyl-L-alanyl-L-isoleucyl-L-leucyl-L-seryl-L-serine; Amylin Fragment 20-29 human; Diabetes Associated Peptide Fragment 20-29 human; hIAPP 20-29. Grades: 95%. CAS No. 118068-30-7. Molecular formula: C43H68N12O16. Mole weight: 1009.07. BOC Sciences 2
Amylin, amide, human Amylin, amide, human, a 37-amino acid polypeptide, is a pancreatic hormone cosecreted with insulin that exerts unique roles in metabolism and glucose homeostasis. Amylin, amide, human inhibits glucagon secretion, delays gastric emptying, and acts as a satiety agent[1]. Uses: Scientific research. Group: Peptides. Alternative Names: DAP amide, human. CAS No. 122384-88-7. Pack Sizes: 500 ?g; 1 mg; 5 mg. Product ID: HY-P1070. MedChemExpress MCE
Amylin, amide, rat acetate Amylin, amide, rat acetate is a potent and high-affinity ligand for the AMY1 and AMY3 receptors and variably of AMY2 receptors. Synonyms: H-Lys-Cys-Asn-Thr-Ala-Thr-Cys-Ala-Thr-Gln-Arg-Leu-Ala-Asn-Phe-Leu-Val-Arg-Ser-Ser-Asn-Asn-Leu-Gly-Pro-Val-Leu-Pro-Pro-Thr-Asn-Val-Gly-Ser-Asn-Thr-Tyr-NH2.CH3CO2H (Disulfide bridge: Cys2-Cys7); L-lysyl-L-cysteinyl-L-asparagyl-L-threonyl-L-alanyl-L-threonyl-L-cysteinyl-L-alanyl-L-threonyl-L-glutaminyl-L-arginyl-L-leucyl-L-alanyl-L-asparagyl-L-phenylalanyl-L-leucyl-L-valyl-L-arginyl-L-seryl-L-seryl-L-asparagyl-L-asparagyl-L-leucyl-glycyl-L-prolyl-L-valyl-L-leucyl-L-prolyl-L-prolyl-L-threonyl-L-asparagyl-L-valyl-glycyl-L-seryl-L-asparagyl-L-threonyl-L-tyrosinamide (2->7)-disulfide acetic acid; Amylin (rat) acetate; Rat amylin acetate; Rat amylin amide acetate; Rat islet amyloid polypeptide acetate. Grades: ≥95%. Molecular formula: C169H276N52O55S2. Mole weight: 3980.45. BOC Sciences 2

Would you like to list your products on USA Chemical Suppliers?

Our database is helping our users find suppliers everyday.

Add Your Products