A directory of where to buy chemicals in the USA, including: distributors, industrial manufacturers, bulk supplies and wholesalers of raw ingredients & finished goods.
Search for products or services, then visit the suppliers website for prices or more information.
| Product | Description | |
|---|---|---|
| Tiotropium bromide monohydrate | Tiotropium bromide monohydrate. Group: Biochemicals. Grades: Highly Purified. CAS No. 139404-48-1. Pack Sizes: 100mg, 250mg, 500mg, 1g, 2g. Molecular Formula: C19H22NO4S2·H2O·Br. US Biological Life Sciences. |  Worldwide |
| Tiotropium bromide monohydrate | ?98% (HPLC). Group: Fluorescence/luminescence spectroscopy. |  |
| Tiotropium bromide monohydrate | 100mg Pack Size. Group: Analytical Reagents, Biochemicals, Building Blocks, Organics. Formula: C19H22BrNO4S2.H2O. CAS No. 139404-48-1. Prepack ID 90025485-100mg. Molecular Weight 490.43. See USA prepack pricing. |  |
| Tiotropium Bromide Monohydrate | Used for maintenance treatment of airflow obstruction in patients with chronic obstructive pulmonary disease. It has a role as a muscarinic antagonist and a bronchodilator agent. Alternative Names: Tiotropium bromide hydrate. 411207-31-3. Spiriva. CAS No. 139404-48-1. Product ID: API139404481. Molecular formula: C19H24BrNO5S2. Mole weight: 490.4. SMILES: C[N+]1(C2CC(CC1C3C2O3)OC(=O)C(C4=CC=CS4)(C5=CC=CS5)O)C.O.[Br-]. Category: Bronchiectasis APIs. |  |
| Tiotropium-[d3] Bromide | Tiotropium-[d3] Bromide is the labelled analogue of Tiotropium bromide. Tiotropium bromide is an anticholinergic bronchodilator used in the management of chronic obstructive pulmonary disease. Synonyms: Tiotropium D3 Bromide; (1α,2β,4β,5α,7β)-7-[(2-Hydroxy-2,2-di-2-thienylacetyl)oxy]-9,9-dimethyl-3-oxa-9-azoniatricyclo[3.3.1.02,4]nonane-d3 Bromide. Grade: 98% by HPLC; 99% atom D. CAS No. 1127226-56-5. Molecular formula: C19H19D3BrNO4S2. Mole weight: 475.43. |  |
| Tiotropium-d3 Bromide | Muscarinic receptor antagonist. Bronchodilator. Group: Biochemicals. Alternative Names: (1α,2 β,4 β,5α,7 β )-7-[(2-Hydroxy-2, 2-di-2-thienylacetyl)oxy]-9, 9-dimethyl-3-oxa-9-azoniatricyclo[3. 3. 1. 02, 4]nonane-d3 Bromide. Grades: Highly Purified. CAS No. 1127226-56-5. Pack Sizes: 1mg. US Biological Life Sciences. | Worldwide |
| Tiotropium-[d3] Iodide | An isotope labelled derivative of Tiotropium bromide. Tiotropium bromide is an anticholinergic bronchodilator used in the management of chronic obstructive pulmonary disease. Synonyms: (1R,2R,4S,5S,7S)-7-{[2-hydroxy-2,2-bis(thiophen-2-yl)acetyl]oxy}-9-(D3)methyl-9-methyl-3-oxa-9-azatricyclo[3.3.1.0,4]nonan-9-ium iodide. Grade: 95% by HPLC; 98% atom D. CAS No. 412010-61-8. Molecular formula: C19H19D3NO4S2I. Mole weight: 522.44. | |
| Tioxidazole | Tioxidazole. Uses: Designed for use in research and industrial production. Additional or Alternative Names: Tioxidazole, 61570-90-9, Sch-21480, NCGC00160481-01, methyl 6-propoxy-2-benzothiazolylcarbamate, methyl (6-propoxy-1,3-benzothiazol-2-yl)carbamate, (6-Propoxy-benzothiazol-2-yl)-carbamic acid methyl ester, Tioxidazol, Tioxidazolum, Tiox, Tiox (TN), ChemDivAM_000281, Tioxidazole (USAN/INN), ChemDiv1_000106, Tioxidazol [INN-Spanish], Tioxidazolum [INN-Latin], AC1L2HJ1, DSSTox_CID_26178, DSSTox_RID_81409, UNII-NZW046NI85. Product Category: Heterocyclic Organic Compound. CAS No. 61570-90-9. Molecular formula: C12H14N2O3S. Mole weight: 266.316160 [g/mol]. Purity: 0.96. IUPACName: methyl N-(6-propoxy-1,3-benzothiazol-2-yl)carbamate. Canonical SMILES: CCCOC1=CC2=C(C=C1)N=C(S2)NC(=O)OC. Density: 1.313g/cm³. ECNumber: 262-854-2. Product ID: ACM61570909. Alfa Chemistry ISO 9001:2015 Certified. |  |
| Tioxolone | Tioxolone is an inhibitor of the metalloenzyme carbonic anhydrase I and has anti-acne activity. Uses: Scientific research. Group: Signaling pathways. CAS No. 4991-65-5. Pack Sizes: 10 mM * 1 mL; 500 mg; 1 g. Product ID: HY-B0483. |  |
| Tip-39 | Tip-39. Uses: Designed for use in research and industrial production. Additional or Alternative Names: H-SER-LEU-ALA-LEU-ALA-ASP-ASP-ALA-ALA-PHE-ARG-GLU-ARG-ALA-ARG-LEU-LEU-ALA-ALA-LEU-GLU-ARG-ARG-HIS-TRP-LEU-ASN-SER-TYR-MET-HIS-LYS-LEU-LEU-VAL-LEU-ASP-ALA-PRO-OH;SLALADDAAFRERARLLAALERRHWLNSYMHKLLVLDAP;TIP-39;TUBEROINFUNDIBULAR NEUROPEPTIDE;H-SER-LEU-ALA-. Product Category: Heterocyclic Organic Compound. CAS No. 277302-47-3. Molecular formula: C202H325N61O54S. Product ID: ACM277302473. Alfa Chemistry ISO 9001:2015 Certified. Categories: TIP39. | |
| TIP 39, Tuberoinfundibular Neuropeptide | It is a neuropeptide and parathyroid hormone 2 receptor (PTH2R) agonist. Synonyms: Ser-Leu-Ala-Leu-Ala-Asp-Asp-Ala-Ala-Phe-Arg-Glu-Arg-Ala-Arg-Leu-Leu-Ala-Ala-Leu-Glu-Arg-Arg-His-Trp-Leu-Asn-Ser-Tyr-Met-His-Lys-Leu-Leu-Val-Leu-Asp-Ala-Pro; TIP 39 (39 mer); L-seryl-L-leucyl-L-alanyl-L-leucyl-L-alanyl-L-alpha-aspartyl-L-alpha-aspartyl-L-alanyl-L-alanyl-L-phenylalanyl-L-arginyl-L-alpha-glutamyl-L-arginyl-L-alanyl-L-arginyl-L-leucyl-L-leucyl-L-alanyl-L-alanyl-L-leucyl-L-alpha-glutamyl-L-arginyl-L-arginyl-L-histidyl-L-tryptophyl-L-leucyl-L-asparagyl-L-seryl-L-tyrosyl-L-methionyl-L-histidyl-L-lysyl-L-leucyl-L-leucyl-L-valyl-L-leucyl-L-alpha-aspartyl-L-alanyl-L-proline. Grade: ≥95% by HPLC. CAS No. 277302-47-3. Molecular formula: C202H325N61O54S. Mole weight: 4504.17. | |
| TIP 39, Tuberoinfundibular Neuropeptide | TIP 39, Tuberoinfundibular Neuropeptide is a neuropeptide and parathyroid hormone 2 receptor (PTH2R) agonist. TIP 39 is highly conserved among species. TIP39 from all species activates adenylyl cyclase and elevates intracellular calcium levels through parathyroid hormone 2 receptor (PTH2R)[1]. Uses: Scientific research. Group: Peptides. CAS No. 277302-47-3. Pack Sizes: 1 mg; 5 mg; 10 mg. Product ID: HY-P1852. | |
| Tipelukast | Tipelukast (KCA 757) is a sulfidopeptide leukotriene receptor antagonist, an orally bioavailable anti-inflammatory agent and used for the treatment of asthma. Uses: Scientific research. Group: Signaling pathways. Alternative Names: KCA 757; MN 001. CAS No. 125961-82-2. Pack Sizes: 1 mg. Product ID: HY-14938. | |
| Tipelukast | ?98% (HPLC). Group: Fluorescence/luminescence spectroscopy. | |
| Tipelukast-[d6] | Tipelukast-[d6] is the labelled analogue of Tipelukast, which could be used as an oral anti-inflammatory agent and has been found to exhibit potential activities against non-alcoholic fatty liver disease as a leukotriene receptor antagonist. Synonyms: Tipelukast-D6. Molecular formula: C29H32D6O7S. Mole weight: 536.71. | |
| Tipepidine hydrochloride | Tipepidine hydrochloride reversibly inhibits dopamine (DA) D 2 receptor-mediated GIRK currents (I DA(GIRK) ) with an IC 50 of 7.0 μM. Tipepidine hydrochloride subsequently activates VTA dopamine neuron [1]. Tipepidine hydrochloride, a non-narcotic antitussive, exerts an antidepressant-like effect [2]. Uses: Scientific research. Group: Signaling pathways. CAS No. 1449686-84-3. Pack Sizes: 10 mM * 1 mL; 5 mg; 10 mg; 50 mg; 100 mg. Product ID: HY-121685A. | |
| Tiphenylphosphine-3,3',3''-trisulfonic acid trisodium salt | Tiphenylphosphine-3,3',3''-trisulfonic acid trisodium salt. Group: Biochemicals. Grades: Highly Purified. CAS No. 63995-70-0. Pack Sizes: 50mg, 100mg, 250mg, 500mg, 1g. Molecular Formula: C18H12Na3O9PS3. US Biological Life Sciences. | Worldwide |
| Tipifarnib | A farnesyltransferase inhibitor. Sensitizes human multiple myeloma cell to proteasome inhibition by blocking degradation of bortezomib-induced aggresomes. Also shown to inhibit the growth of myeloid leukemia cell lines and primary leukemia cells by inducing apoptosis and cell-cycle blockage when combined with rapamycin(R124000). Group: Biochemicals. Alternative Names: 6-[(R)-Amino(4-chlorophenyl)(1-methyl-1H-imidazol-5-yl)methyl]-4-(3-chlorophenyl)-1-methyl-2(1H)-quinolinone; (R)-(+)-R 115777; Zarnestra. Grades: Highly Purified. CAS No. 192185-72-1. Pack Sizes: 2.5mg. US Biological Life Sciences. | Worldwide |
| Tipifarnib | Tipifarnib (IND 58359) binds to and inhibits farnesyltransferase (FTase) with an IC 50 of 0.86 nM. Antineoplastic activity and antiparasitic activity [1]. Uses: Scientific research. Group: Signaling pathways. Alternative Names: IND 58359; R115777. CAS No. 192185-72-1. Pack Sizes: 10 mM * 1 mL; 5 mg; 10 mg; 25 mg; 50 mg; 100 mg. Product ID: HY-10502. | |
| Tipifarnib | ?98% (HPLC). Group: Fluorescence/luminescence spectroscopyenzyme activators, inhibitors & substrates. | |
| Tipiracil | Tipiracil is a thymidine phosphorylase ( TPase ) inhibitor. Uses: Scientific research. Group: Signaling pathways. CAS No. 183204-74-2. Pack Sizes: 5 mg; 10 mg; 25 mg; 50 mg; 100 mg; 200 mg. Product ID: HY-A0063A. | |
| Tipiracil hydrochloride | ?98% (HPLC). Group: Fluorescence/luminescence spectroscopy. | |
| Tipiracil hydrochloride | Tipiracil (hydrochloride) is a thymidine phosphorylase inhibitor (TPI), used for cancer research. Uses: Scientific research. Group: Signaling pathways. CAS No. 183204-72-0. Pack Sizes: 10 mM * 1 mL; 5 mg; 10 mg; 25 mg; 50 mg; 100 mg; 200 mg. Product ID: HY-A0063. | |
| Tiplaxtinin | ?98% (HPLC). Group: Fluorescence/luminescence spectroscopy. | |
| Tiplaxtinin | Tiplaxtinin is a selective and orally efficacious inhibitor of plasminogen activator inhibitor-1 (PAI-1) with IC50 of 2.7 ?M[1]. Uses: Scientific research. Group: Signaling pathways. Alternative Names: PAI-039; Tiplasinin. CAS No. 393105-53-8. Pack Sizes: 10 mM * 1 mL; 5 mg; 10 mg; 50 mg; 100 mg. Product ID: HY-15253. | |
| Tipranavir | Tipranavir (PNU-140690) inhibits the enzymatic activity and dimerization of HIV-1 protease , exerts potent activity against multi-protease inhibitor (PI)-resistant HIV-1 isolates with IC 50 s of 66-410 nM [1] [2]. Tipranavir inhibits SARS-CoV-2 3CL pro activity [3]. Uses: Scientific research. Group: Signaling pathways. Alternative Names: PNU-140690. CAS No. 174484-41-4. Pack Sizes: 10 mM * 1 mL; 1 mg; 5 mg; 10 mg. Product ID: HY-15148. | |
| Tipranavir | Tipranavir (PNU-140690) inhibits the enzymatic activity and dimerization of HIV-1 protease, exerts potent activity against multi-protease inhibitor (PI)-resistant HIV-1 isolates with IC50s of 66-410 nM. Tipranavir inhibits SARS-CoV-2 3CLpro activity. Uses: Designed for use in research and industrial production. Additional or Alternative Names: PNU-140690;Aptivus;N-[3-[(1R)-1-[(6R)-5,6-Dihydro-4-hydroxy-2-oxo-6-(2-phenylethyl)-6-propyl-2H-pyran-3-yl]propyl]phenyl]-5-(trifluoromethyl)-2-pyridinesulfonamide;N-[3-[(1R)-1-[(6R)-2-Hydroxy-4-oxo-6-phenethyl-6-propyl-5H-pyran-3-yl]propyl]phenyl]-5-(trifluoromethyl)pyridine-2-sulfonamide;Tipranavir;Tipranavir(PNU-140690,Aptivus);2-PyridinesulfonaMide,N-[3-[(1R)-1-[(6R)-5,6-dihydro-4-hydroxy-2-oxo-6-(2-phenylethyl)-6-propyl-2H-pyran-3-yl]propyl]phenyl]-5-(trifluoroMethyl)-. Product Category: Inhibitors. Appearance: Solid. CAS No. 174484-41-4. Molecular formula: C31H33F3N2O5S. Mole weight: 602.66. Purity: 0.9808. Canonical SMILES: O=C1C([C@H](CC)C2=CC=CC(NS(C3=CC=C(C(F)(F)F)C=N3)(=O)=O)=C2)=C(O)C[C@](CCC4=CC=CC=C4)(CCC)O1. Product ID: ACM174484414. Alfa Chemistry ISO 9001:2015 Certified. | |
| Tipranavir | Storage and Stability. Group: Biochemicals. Alternative Names: N-[3-[(1R)-1-[(6R)-5,6-Dihydro-4-hydroxy-2-oxo-6-(2-phenylethyl)-6-propyl-2H-pyran-3-yl]propyl]phenyl]-5-(trifluoromethyl)-2-pyridinesulfonamide; PNU-140690; Aptivus. Grades: Highly Purified. CAS No. 174484-41-4. Pack Sizes: 1mg, 2mg, 5mg, 10mg, 25mg. US Biological Life Sciences. | Worldwide |
| Tipranavir-[d4] | Tipranavir-[d4] is the labelled analogue of Tipranavir, which is a nonpeptidic HIV protease inhibitor and has been found to be effective as an antiviral. Synonyms: Tipranavir D4; N-[3-[(1R)-1-[(6R)-5,6-Dihydro-4-hydroxy-2-oxo-6-(2-phenylethyl)-6-propyl-2H-pyran-3-yl]propyl]phenyl]-5-(trifluoromethyl)-2-pyridinesulfonamide-d4. Grade: 95% by HPLC; 98% atom D. CAS No. 1217819-15-2. Molecular formula: C31H29D4F3N2O5S. Mole weight: 606.69. | |
| Tipranavir-d4 (N-[3-[(1R)-1-[(6R)-5,6-Dihydro-4-hydroxy-2-oxo-6-(2-phenylethyl)-6-propyl-2H-pyran-3-yl]propyl]phenyl]-5-(trifluoromethyl)-2-pyridinesulfonamide-d4,. PNU-140690-d4, Aptivus-d4,. ) | Nonpeptidic HIV protease inhibitor (NPPI). Antiviral. Group: Biochemicals. Alternative Names: N-[3-[(1R)-1-[(6R)-5,6-Dihydro-4-hydroxy-2-oxo-6-(2-phenylethyl)-6-propyl-2H-pyran-3-yl]propyl]phenyl]-5-(trifluoromethyl)-2-pyridinesulfonamide-d4; PNU-140690-d4; Aptivus-d4. Grades: Highly Purified. Pack Sizes: 1mg. US Biological Life Sciences. | Worldwide |
| Tipranavir. (N-[3-[(1R)-1-[(6R)-5,6-Dihydro-4-hydroxy-2-oxo-6-(2-phenylethyl)-6-propyl-2H-pyran-3-yl]propyl]phenyl]-5-(trifluoromethyl)-2-pyridinesulfonamide,. PNU-140690, Aptivus,. ) | Nonpeptidic HIV protease inhibitor (NPPI). Antiviral. Group: Biochemicals. Alternative Names: N-[3-[(1R)-1-[(6R)-5,6-Dihydro-4-hydroxy-2-oxo-6-(2-phenylethyl)-6-propyl-2H-pyran-3-yl]propyl]phenyl]-5-(trifluoromethyl)-2-pyridinesulfonamide; PNU-140690; Aptivus. Grades: Highly Purified. CAS No. 174484-41-4. Pack Sizes: 1mg. US Biological Life Sciences. | Worldwide |
| Tiq-a | TIQ-A is a potent TNKS (poly-ART, PARP) inhibitor, with an IC50 of 24 nM for TNKS2. TIQ-A is a potential anti-ischemic agent. Uses: Designed for use in research and industrial production. Additional or Alternative Names: TIQ-A, 4H-Thieno[2,3-c]isoquinolin-5-one, PARP Inhibitor X, TIQ-A, Thieno[2,3-c]isoquinolin-5-one, 420849-22-5, SureCN422013, T2825_SIGMA, CTK1C8658, ZINC00003266, AG-F-49683, Thieno[2,3-c]isoquinolin-5(4H)-one, NCGC00165904-01, FT-0675250, G18. Product Category: Inhibitors. CAS No. 420849-22-5. Molecular formula: C11H7NOS. Mole weight: 201.24. Purity: ≥98%. IUPACName: 4H-thieno[2,3-c]isoquinolin-5-one. Canonical SMILES: C1=CC=C2C(=C1)C3=C(NC2=O)SC=C3. Density: 1.359g/cm³. Product ID: ACM420849225. Alfa Chemistry ISO 9001:2015 Certified. Categories: TiQal. | |
| TIQ-A | ?98% (HPLC), solid. Group: Fluorescence/luminescence spectroscopy. | |
| TIQ-A | TIQ-A. Group: Biochemicals. Alternative Names: Thieno[2,3-C]isoquinolin-5-one. Grades: Highly Purified. CAS No. 420849-22-5. Pack Sizes: 2mg, 5mg, 10mg, 25mg, 50mg. Molecular Formula: C11H7NOS. US Biological Life Sciences. | Worldwide |
| TIQ-A (Thieno[2,3-C]isoquinolin-5-one) | TIQ-A (Thieno[2,3-C]isoquinolin-5-one). Group: Biochemicals. Alternative Names: Thieno[2,3-C]isoquinolin-5-one. Grades: Highly Purified. Pack Sizes: 5mg. US Biological Life Sciences. | Worldwide |
| Tiquizium Bromide | Tiquizium Bromide is a antimuscarinic agent that was used on airway smooth muscle in vitro and in patients with chronic obstructive pulmonary disease. Group: Biochemicals. Alternative Names: HS 902; HSR 902; Thiaton; (5R, 9aR) -rel-3- (Di-2-thienylmethylene) octahydro-5-methyl-2H-quinolizinium Bromide; trans-3- (Di-2-thienylmethylene) octahydro-5-methyl-2H-quinolizinium Bromide. Grades: Highly Purified. CAS No. 71731-58-3. Pack Sizes: 100mg. US Biological Life Sciences. | Worldwide |
| Tirabrutinib | Tirabrutinib (ONO-4059) is an orally active Brutons Tyrosine Kinase ( BTK ) inhibitor (can cross the blood-brain barrier (BBB)), with an IC 50 of 6.8 nM. Tirabrutinib irreversibly and covalently binds to BTK and inhibits aberrant B cell receptor signaling. Tirabrutinib can be used in studies of autoimmune diseases and hematological malignancies [1] [2] [3] [4]. Uses: Scientific research. Group: Signaling pathways. Alternative Names: ONO-4059; GS-4059. CAS No. 1351636-18-4. Pack Sizes: 10 mM * 1 mL; 5 mg; 10 mg; 25 mg; 50 mg; 100 mg. Product ID: HY-15771. | |
| Tirabrutinib hydrochloride | Tirabrutinib (ONO-4059) hydrochloride is an orally active Brutons Tyrosine Kinase ( BTK ) inhibitor (can cross the blood-brain barrier (BBB)), with an IC 50 of 6.8 nM. Tirabrutinib hydrochloride irreversibly and covalently binds to BTK and inhibits aberrant B cell receptor signaling. Tirabrutinib hydrochloride can be used in studies of autoimmune diseases and hematological malignancies [1] [2] [3] [4]. Uses: Scientific research. Group: Signaling pathways. Alternative Names: ONO-4059 hydrochloride; GS-4059 hydrochloride. CAS No. 1439901-97-9. Pack Sizes: 10 mM * 1 mL; 5 mg; 10 mg; 25 mg; 50 mg; 100 mg. Product ID: HY-15771A. | |
| Tiragolumab | Tiragolumab is an immune checkpoint inhibitor binding to T-cell immunoglobulin and ITIM domain ( TIGIT ). Tiragolumab, alone or in combination with the PD-L1 inhibitor Atezolizumab (HY-P9904), may be effective against multiple solid malignancies-most notably non-small cell lung cancer (NSCLC) [1] [2]. Uses: Scientific research. Group: Inhibitory antibodies. Alternative Names: MTIG-7192A; RG-6058. CAS No. 1918185-84-8. Pack Sizes: 1 mg; 5 mg; 10 mg. Product ID: HY-P9986. | |
| Tirandamycin A | Tirandamycin A is originally isolated from Str. tirandis var. tirandis NRRL 3689, and it has anti-gram-positive bacteria effect. Synonyms: NSC 107067; 3-Pyrrolin-2-one, 4-hydroxy-3-(4-methyl-6-(1,2,7-trimethyl-5-oxo-3,9,10-trioxatricyclo(4.3.1.0(sup 2,4))dec-8-yl)-2,4-heptadienoyl)-, (E,E)-. Grade: 95% by HPLC. CAS No. 34429-70-4. Molecular formula: C22H27NO7. Mole weight: 417.45. | |
| Tirapazamine | Tirapazamine (SR259075) is an anticancer agent that shows selective cytotoxicity for hypoxic cells in solid tumors, thereby inducing single-and double-strand breaks in DNA, base damage, and cell death. Tirapazamine is an anticancer and bioreductive agent.Tirapazamine (SR259075) can enhance the cytotoxic effects of ionizing radiation in hypoxic cells [1] [2]. Uses: Scientific research. Group: Signaling pathways. Alternative Names: SR259075; SR4233; Win59075; SML 0552; SR 259075; Tirazone. CAS No. 27314-97-2. Pack Sizes: 10 mM * 1 mL; 50 mg; 100 mg; 200 mg. Product ID: HY-13767. | |
| Tirapazamine | ?98% (HPLC). Group: Fluorescence/luminescence spectroscopy. | |
| Tirasemtiv | Tirasemtiv is an activator of the fast skeletal muscle troponin complex. Tirasemtiv is a click chemistry reagent, it contains an Alkyne group and can undergo copper-catalyzed azide-alkyne cycloaddition (CuAAc) with molecules containing Azide groups. Uses: Scientific research. Group: Signaling pathways. Alternative Names: CK-2017357. CAS No. 1005491-05-3. Pack Sizes: 10 mM * 1 mL; 5 mg; 10 mg; 25 mg; 50 mg; 100 mg. Product ID: HY-15964. | |
| Tiratricol | Tiratricol is an orally available thyroid hormone analog that inhibits pituitary thyroid-stimulating hormone secretion. Tiratricol is an intracellular toxin neutralizer that inhibits LPS and lipid A cytotoxicity with IC 50 s of 20 μM and 32 μM, respectively. Tiratricol reduces TNF production in lipopolysaccharide-stimulated macrophages. Tiratricol also has antiviral activity and is an inhibitor of yellow fever virus (Flavivirus). It can bind to the RdRp domain of the viral NS5 protein to hinder YFV replication. [2]. Uses: Scientific research. Group: Signaling pathways. Alternative Names: 3,3',5-Triiodothyroacetic acid. CAS No. 51-24-1. Pack Sizes: 10 mM * 1 mL; 50 mg; 100 mg. Product ID: HY-B1201. | |
| Tirbanibulin | Tirbanibulin (KX2-391) is an inhibitor of Src that targets the peptide substrate site of Src, with GI 50 of 9-60 nM in cancer cell lines. Uses: Scientific research. Group: Signaling pathways. Alternative Names: KX2-391; KX-01. CAS No. 897016-82-9. Pack Sizes: 10 mM * 1 mL; 5 mg; 10 mg; 50 mg; 100 mg. Product ID: HY-10340. | |
| Tirbanibulin dihydrochloride | Tirbanibulin (dihydrochloride) (KX2-391 (dihydrochloride)) is an inhibitor of Src that targets the peptide substrate site of Src, with GI 50 of 9-60 nM in cancer cell lines. Uses: Scientific research. Group: Signaling pathways. Alternative Names: KX2-391 dihydrochloride; KX-01 dihydrochloride. CAS No. 1038395-65-1. Pack Sizes: 10 mM * 1 mL; 5 mg; 10 mg; 50 mg; 100 mg. Product ID: HY-10340A. | |
| Tirbanibulin Mesylate | Tirbanibulin Mesylate (KX2-391 Mesylate) is an inhibitor of Src that targets the peptide substrate site of Src, with GI 50 of 9-60 nM in cancer cell lines. Uses: Scientific research. Group: Signaling pathways. Alternative Names: KX2-391 Mesylate; KX01 Mesylate. CAS No. 1080645-95-9. Pack Sizes: 10 mM * 1 mL; 5 mg; 10 mg; 50 mg; 100 mg. Product ID: HY-10340B. | |
| Tirilazad | Tirilazad is a nonglucocorticoid, 21-aminosteroid that inhibits lipid peroxidation. Tirilazad can attenuate brain or spinal cord injury caused by trauma, stroke, ischemia and reperfusion injury. Tirilazad has antiviral activities against nCoV. Tirilazad is neuroprotective for ischaemic stroke, can be used for subarachnoid hemorrhage research [1] [2] [3]. Uses: Scientific research. Group: Signaling pathways. Alternative Names: U 74006F free base. CAS No. 110101-66-1. Pack Sizes: 5 mg; 10 mg; 25 mg; 50 mg. Product ID: HY-132280. | |
| Tirnovetmab | Tirnovetmab (KIND-016) is an antibody. Tirnovetmab can be used for experiment research. Uses: Scientific research. Group: Inhibitory antibodies. Alternative Names: KIND-016. CAS No. 2364504-80-1. Pack Sizes: 1 mg; 5 mg; 10 mg. Product ID: HY-P99557. | |
| Tirofiban | Tirofiban (L700462) is a selective and reversible platelet integrin receptor ( Gp IIb/IIIa ) antagonist that inhibits fibrinogen binding to this receptor and has antithrombotic activity. Tirofiban induces proliferation and migration on endothelial cell by inducing production of VEGF. Tirofiban can significantly reduces myocardial no-reflow and ischemia-reperfusion injury by alleviating myocardial microvascular structural and endothelial dysfunction in the ischemic area [1] [2] [3]. Uses: Scientific research. Group: Signaling pathways. Alternative Names: L700462; MK383. CAS No. 144494-65-5. Pack Sizes: 5 mg; 10 mg; 50 mg; 100 mg. Product ID: HY-17369B. | |
| Tirofiban-butyl-d9, Hydrochloride (N-(Butyl-d9-sulfonyl)-O-[4-(4-piperidynyl)butyl]-L-tyrosine, Hydrochloride) | Labeled Tirofiban, a specific nonpeptide platelet fibrinogen receptor (GPIIb/IIIa) antagonist. An antithrombotic used in the treatment of unstable angina. Group: Biochemicals. Alternative Names: N-(Butyl-d9-sulfonyl)-O-[4-(4-piperidynyl)butyl]-L-tyrosine, Hydrochloride. Grades: Highly Purified. Pack Sizes: 1mg. US Biological Life Sciences. | Worldwide |
| Tirofiban hydrochloride | Tirofiban hydrochloride. Group: Biochemicals. Grades: Highly Purified. CAS No. 142373-60-2. Pack Sizes: 250mg, 500mg, 1g, 2g, 5g. Molecular Formula: C22H36N2O5S·HCl. US Biological Life Sciences. | Worldwide |
| Tirofiban Hydrochloride | Tyrosine analog and PLATELET GLYCOPROTEIN GPIIB-IIIA COMPLEX antagonist that inhibits PLATELET AGGREGATION and is used in the treatment of ACUTE CORONARY SYNDROME. Alternative Names: Tirofiban hydrochloride monohydrate. TIROFIBAN HYDROCHLORIDE. Tirofiban HCl. Tirofiban hydrochloride hydrate. CAS No. 150915-40-5. Product ID: API150915405. Molecular formula: C22H39ClN2O6S. Mole weight: 495.1. EINECS: 682-504-6. SMILES: CCCCS(=O)(=O)NC(CC1=CC=C(C=C1)OCCCCC2CCNCC2)C(=O)O.O.Cl. Appearance: Solid powder. Category: Cardiovascular and Geriatric Medicine APIs. | |
| Tirofiban Hydrochloride | Tirofiban Hydrochloride. Uses: For analytical and research use. Group: Impurity standards. CAS No. 150915-40-5. Molecular formula: C22H39ClN2O6S. Mole weight: 495.07. Catalog: APB150915405. | |
| Tirofiban hydrochloride hydrate | Tirofiban hydrochloride hydrate. Group: Biochemicals. Alternative Names: N-(Butylsulfonyl)-O-[4-(4-piperidynyl)butyl]-L-tyrosine, hydrochloride hydrate. Grades: Highly Purified. CAS No. 150915-40-5. Pack Sizes: 5mg, 10mg, 25mg, 50mg, 100mg. Molecular Formula: C22H39ClN2O6S. US Biological Life Sciences. | Worldwide |
| Tirofiban, Hydrochloride Hydrate (N-(Butylsulfonyl)-O-[4-(4-piperidynyl)butyl]-L-tyrosine, Hydrochloride Hydrate) | A specific nonpeptide platelet fibrinogen receptor (GPIIb/IIIa) antagonist. An antithrombotic used in the treatment of unstable angina. Group: Biochemicals. Alternative Names: N-(Butylsulfonyl)-O-[4-(4-piperidynyl)butyl]-L-tyrosine, Hydrochloride Hydrate. Grades: Highly Purified. Pack Sizes: 10mg. US Biological Life Sciences. | Worldwide |
| Tirofiban hydrochloride monohydrate | Tirofiban (L700462) hydrochloride monohydrate is a selective and reversible platelet integrin receptor ( Gp IIb/IIIa ) antagonist that inhibits fibrinogen binding to this receptor and has antithrombotic activity. Tirofiban hydrochloride monohydrate induces proliferation and migration on endothelial cell by inducing production of VEGF. Tirofiban hydrochloride monohydrate can significantly reduces myocardial no-reflow and ischemia-reperfusion injury by alleviating myocardial microvascular structural and endothelial dysfunction in the ischemic area [1] [2] [3]. Uses: Scientific research. Group: Signaling pathways. Alternative Names: L700462 hydrochloride monohydrate; MK383 hydrochloride monohydrate. CAS No. 150915-40-5. Pack Sizes: 10 mM * 1 mL; 5 mg; 10 mg; 50 mg; 100 mg. Product ID: HY-17369. | |
| Tirofiban hydrochloride monohydrate | ?98% (HPLC). Group: Fluorescence/luminescence spectroscopy. | |
| Tiron | Tiron is a non-toxic chelator of a variety of metals. Tiron is cell permeable analog of vitamin E and function as hydroxyl radical and superoxide scavenger. Tiron is an orally active antioxidant. Tiron can be used to alleviate acute metal overload in animals [1] [2] [3]. Uses: Scientific research. Group: Signaling pathways. CAS No. 149-45-1. Pack Sizes: 10 mM * 1 mL; 10 g; 25 g. Product ID: HY-D0261. | |
| Tiron | Tiron. CAS No. 149-45-1. |  Pennsylvania PA |
| Tiron (1,2-Dihydroxybenzene-3,5-disulfonic acid disodium salt) C6H6Na2O9S2 | 25g Pack Size. Group: Analytical Reagents, Building Blocks, Organics, Stains & Indicators. Formula: C6H6Na2O9S2. CAS No. 149-45-1. Prepack ID 58661995-25g. Molecular Weight 332.22. See USA prepack pricing. | |
| Tiropramide | Tiropramide. Uses: Designed for use in research and industrial production. Additional or Alternative Names: Tiropramide;N-[1-[4-(2-diethylaminoethyloxy)benzyl]-2-(dipropylamino)-2-keto-ethyl]benzamide;N-[3-[4-(2-diethylaminoethyloxy)phenyl]-1-(dipropylamino)-1-oxo-propan-2-yl]benzamide;N-[3-[4-(2-diethylaminoethyloxy)phenyl]-1-(dipropylamino)-1-oxopropan-2-yl]. Product Category: Heterocyclic Organic Compound. CAS No. 55837-29-1. Molecular formula: C28H41N3O3. Mole weight: 467.65. Product ID: ACM55837291. Alfa Chemistry ISO 9001:2015 Certified. | |
| Tiropramide Hydrochloride | Tiropramide is an antispasmodic agent. Studies sugges that Tiropramide has a pure musculotropic smooth muscle relaxant activity. Tiropramide is considered to be useful to inhibit the contractile response of the urinary bladder. Group: Biochemicals. Alternative Names: (±) - α - (Benzoylamino) -4- [2- (diethylamino) ethoxy] -N, N-dipropyl benzenepropanamide Hydrochloride; Alfospas; Maiorad; Tiromid. Grades: Highly Purified. CAS No. 53567-47-8. Pack Sizes: 100mg. US Biological Life Sciences. | Worldwide |
| tirucalladienol synthase | The product from Arabidopsis thaliana is 85% tirucalla-7,24-dien-3β-ol with trace amounts of other triterpenoids. Group: Enzymes. Synonyms: PEN3. Enzyme Commission Number: EC 5.4.99.56. Storage: Store it at +4 ?C for short term. For long term storage, store it at -20 ?C?-80 ?C. Form: Liquid or lyophilized powder. EXWM-5599; tirucalladienol synthase; EC 5.4.99.56; PEN3. Cat No: EXWM-5599. |  |
| Tirzepatide | Tirzepatide is a dual GIP and GLP-1 receptor agonist and a drug candidate for the treatment of type 2 diabetes. Uses: Treating type 2 diabetes is one of the main conditions where tirzepatide shows promise. millions of people worldwide suffer with this chronic illness, which is characterized by poor glucose metabolism and insulin resistance. targeting several receptors, such as the glucose-dependent insulinotropic polypeptide (gip) and glucagon-like peptide-1 (glp-1) receptors, is part of tirzepatide's distinct mo. Synonyms: L-Tyrosyl-2-methylalanyl-L-α-glutamylglycyl-L-threonyl-L-phenylalanyl-L-threonyl-L-seryl-L-α-aspartyl-L-tyrosyl-L-seryl-L-isoleucyl-2-methylalanyl-L-leucyl-L-α-aspartyl-L-lysyl-L-isoleucyl-L-alanyl-L-glutaminyl-N6-[(22S)-22,42-dicarboxy-1,10,19,24-tetraoxo-3,6,12,15-tetraoxa-9,18,23-triazadotetracont-1-yl]-L-lysyl-L-alanyl-L-phenylalanyl-L-valyl-L-glutaminyl-L-tryptophyl-L-leucyl-L-isoleucyl-L-ala. Grade: ≥95%. CAS No. 2023788-19-2. Molecular formula: C225H348N48O68. Mole weight: 4813.45. | |
| Tirzepatide | Tirzepatide. Categories: tirzepatide; 2023788-19-2. |  CA, FL & NJ |
| Tirzepatide | Tirzepatide acetate is a dual GIP / GLP-1 receptor agonist. CAS No. 2023788-19-2. Product ID: API2023788192. SMILES: CC[C@H](C)[C@@H](C(=O)N[C@@H](C)C(=O)N[C@@H](CCC(=O)N)C(=O)N[C@@H](CCCCNC(=O)COCCOCCNC(=O)COCCOCCNC(=O)CC[C@H](C(=O)O)NC(=O)CCCCCCCCCCCCCCCCCCC(=O)O)C(=O)N[C@@H](C)C(=O)N[C@@H](CC1=CC=CC=C1)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CCC(=O)N)C(=O)N[C@@H](CC2=CNC3=CC=CC=C32)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H](C)C(=O)NCC(=O)NCC(=O)N4CCC[C@H]4C(=O)N[C@@H](CO)C(=O)N[C@@H](CO)C(=O)NCC(=O)N[C@@H](C)C(=O)N5CCC[C@H]5C(=O)N6CCC[C@H]6C(=O)N7CCC[C@H]7C(=O)N[C@@H](CO)C(=O)N)NC(=O)[C@H](CCCCN)NC(=O)[C@H](CC(=O)O)NC(=O)[C@H](CC(C)C)NC(=O)C(C)(C)NC(=O)[C@H]([C@@H](C)CC)NC(=O)[C@H](CO)NC(=O)[C@H](CC8=CC=C(C=C8)O)NC(=O)[C@H](CC(=O)O)NC(=O)[C@H](CO)NC(=O)[C@H]([C@@H](C)O)NC(=O)[C@H](CC9=CC=CC=C9)NC(=O)[C@H]([C@@H](C)O)NC(=O)CNC(=O)[C@H](CCC(=O)O)NC(=O)C(C)(C)NC(=O)[C@H](CC1=CC=C(C=C1)O)N.CC(=O)O. Category: Active Pharmaceutical Ingredients. | |
| Tirzepatide | Tirzepatide Inhibitor. Uses: Scientific use. Product Category: TP1111L. CAS No.: |  |
| Tirzepatide acetate | Tirzepatide acetate is a dual GIP and GLP-1 receptor agonist used as a drug candidate for the treatment of type 2 diabetes. Synonyms: L-Tyrosyl-2-methylalanyl-L-α-glutamylglycyl-L-threonyl-L-phenylalanyl-L-threonyl-L-seryl-L-α-aspartyl-L-tyrosyl-L-seryl-L-isoleucyl-2-methylalanyl-L-leucyl-L-α-aspartyl-L-lysyl-L-isoleucyl-L-alanyl-L-glutaminyl-N6-[(22S)-22,42-dicarboxy-1,10,19,24-tetraoxo-3,6,12,15-tetraoxa-9,18,23-triazadotetracont-1-yl]-L-lysyl-L-alanyl-L-phenylalanyl-L-valyl-L-glutaminyl-L-tryptophyl-L-leucyl-L-isoleucyl-L-ala. CAS No. 2931515-08-9. Molecular formula: C227H352N48O70. Mole weight: 4873.58. | |
| Tislelizumab | Tislelizumab is a monoclonal antibody that specifically binds to programmed cell death receptor 1 (PD-1), blocking its interaction with programmed death ligand 1 (PD-L1) and programmed death ligand 2 (PD-L2). Tislelizumab can reactivate immune cells such as T lymphocytes and enhance anti-tumor activity. Tislelizumab can be used for the research of a variety of tumors including typical Hodgkin's lymphoma, urothelial carcinoma, non-small cell lung cancer and hepatocellular carcinoma [1] [2] [3]. Uses: Scientific research. Group: Inhibitory antibodies. CAS No. 1858168-59-8. Pack Sizes: 1 mg; 5 mg; 10 mg. Product ID: HY-P99052. | |
Our database is helping our users find suppliers everyday.
