A directory of where to buy chemicals in the USA, including: distributors, industrial manufacturers, bulk supplies and wholesalers of raw ingredients & finished goods.
Search for products or services, then visit the suppliers website for prices or more information.
| Product | Description | |
|---|---|---|
| TiO2 103-80G | TiO2 103-80G. Group: Polymers. |  |
| TiO2 coated Upconverting Nanoparticles(UV light) | TiO2 coated Upconverting Nanoparticles(UV light). Uses: Up conversion nanoparticles have excellent optical stability. they have been widely applied in biomedicine, including in vivo bioimaging, in vivo bioimaging, biodetection, immunohistochemistry, microarray detection, photodynamic therapy, and photoactivated drug activation. Group: Tio2 coated upconverting nanoparticles. Pack Sizes: 10 mg/20 mg/50 mg. | |
| TiO2/graphene nanocomposite | TiO2/graphene composite is highly crystalline graphene sheets hybridized with titanium oxide nanocrystals. The graphene sheets act as substrate and thickness is about 1~10 nm. The attached particle size of TiO2 is between 10-40 nm, and the loading density is in the range of 30%-70%. X-ray diffraction pattern confirms that the graphene sheets are well crystallized and the attached particles are TiO2. Uses: Photocatalyst dye sensitized solar cells. Group: Carbon nano materials. | |
| TiO2 Nanoparticles | TiO2 Nanoparticles. Group: Oxides nanoparticles. CAS No. 13463-67-7. Molecular formula: 79.866 g/mol. Mole weight: TiO2. 99.9 %. | |
| TiO2 Nanoparticles | TiO2 Nanoparticles. Group: Oxides nanoparticles. | |
| TiO2 nanopowder | TiO2 nanopowder. Group: Compounds nanoparticles. 99%. | |
| TiO2 nanotube arrary film(thickness: 10μm,HD: 60-80 nm) | Titanium dioxide is an odorless white powder. Tasteless. pH 7.5. Occurs in three crystalline forms. (NTP, 1992);Liquid;DryPowder; Liquid; OtherSolid;DryPowder; DryPowder, Liquid; DryPowder, OtherSolid; DryPowder, PelletsLargeCrystals, Liquid; DryPowder, WetSolid; Liquid; OtherSolid; OtherSolid, Liquid; PelletsLargeCrystals; WetSolid; WetSolid, Liquid;White to slightly coloured powder;COLOURLESS-TO-WHITE CRYSTALLINE POWDER.;White, odorless powder.;White, odorless powder. Group: Perovskite materials. CAS No. 13463-67-7. Product ID: dioxotitanium. Molecular formula: 79.87g/mol. Mole weight: TiO2;TiO2;TiO2;O2Ti. O=[Ti]=O. InChI=1S/2O.Ti. GWEVSGVZZGPLCZ-UHFFFAOYSA-N. | |
| TiO2 nanotube arrary film(thickness: 5μm,HD: 60-80 nm) | Titanium dioxide is an odorless white powder. Tasteless. pH 7.5. Occurs in three crystalline forms. (NTP, 1992);Liquid;DryPowder; Liquid; OtherSolid;DryPowder; DryPowder, Liquid; DryPowder, OtherSolid; DryPowder, PelletsLargeCrystals, Liquid; DryPowder, WetSolid; Liquid; OtherSolid; OtherSolid, Liquid; PelletsLargeCrystals; WetSolid; WetSolid, Liquid;White to slightly coloured powder;COLOURLESS-TO-WHITE CRYSTALLINE POWDER.;White, odorless powder.;White, odorless powder. Group: Perovskite materials. CAS No. 13463-67-7. Product ID: dioxotitanium. Molecular formula: 79.87g/mol. Mole weight: TiO2;TiO2;TiO2;O2Ti. O=[Ti]=O. InChI=1S/2O.Ti. GWEVSGVZZGPLCZ-UHFFFAOYSA-N. | |
| TiO2 Nanotubes | TiO2 Nanotubes. Group: Oxides nanoparticles. CAS No. 13463-67-7. Molecular formula: 79.866 g/mol. Mole weight: TiO2. 99.9%. | |
| Tioclomarol | Tioclomarol. Uses: Designed for use in research and industrial production. Additional or Alternative Names: 3-[3-(4-Chlorophenyl)-1-(5-chloro-2-thienyl)-3-hydroxypropyl]-4-hydroxy-2H-1-benzopyran-2-one; Apegmone; 3-[5-Chloro-α-(p-chloro-β-hydroxyphenethyl)-2-thenyl]-4-hydroxy-coumarin. Product Category: Heterocyclic Organic Compound. CAS No. 22619-35-8. Molecular formula: C22H16Cl2O4S. Mole weight: 447.336. Product ID: ACM22619358. Alfa Chemistry ISO 9001:2015 Certified. |  |
| Tioconazole | Tioconazole is an antifungal medication of the imidazole class used to treat infections caused by a fungus or yeast, with an average IC50 of 1.7 μM. Synonyms: UK20,349; UK-20,349; UK 20,349; STS 557; STS557; STS-557. Grades: >98%. CAS No. 65899-73-2. Molecular formula: C16H13Cl3N2OS. Mole weight: 387.71. |  |
| Tioconazole | 1-[2-[(2-Chloro-3-thienyl)methoxy]-2-(2,4-dichlorophenyl) ethyl]-1H-imidazole 1-[2,4-Dichloro-b-[(2-chloro-3-thienyl)-oxy]phenethyl] imidazole. CAS No. 65899-73-2. Product ID: 8-04578. Molecular formula: C16H13Cl3N2OS. Mole weight: 387.71. Properties: White or off-white crystalline powder. |  |
| Tioconazole | Tioconazole (UK-20349) is a broad-spectrum antifungal imidazole derivative. Tioconazole inhibits several dermatophytes and yeasts, with MIC 50 values of less than 3.12 mg/L and 9 mg/L, respectively. Additionally, Tioconazole exhibits anti-parasitic activity. Tioconazole exerts anticancer activity by inhibiting the PI3K/AKT/mTOR signaling pathway and blocking autophagy. Tioconazole is applicable for research in the fields of anti-infection and anticancer therapy [1] [2] [3] [4] [5]. Uses: Scientific research. Group: Signaling pathways. Alternative Names: UK-20349. CAS No. 65899-73-2. Pack Sizes: 10 mM * 1 mL; 500 mg; 5 g; 10 g. Product ID: HY-B0319. |  |
| Tioconazole Related Compound A | One impurity of Tioconazole, which could be used as an antifungal agent and exhibit activities against Candida glabrata mutant strains. Synonyms: 2-Deschlorothien-3-yl Tioconazole Hydrochloride; 1-[2-(2,4-Dichlorophenyl)-2-(3-thienylmethoxy)ethyl]-1H-imidazole Monohydrochloride. CAS No. 61709-33-9. Molecular formula: C16H14Cl2N2OS. HCl. Mole weight: 389.73. | |
| Tioconazole Related Compound B | One impurity of Tioconazole, which could be used as an antifungal agent and exhibit activities against Candida glabrata mutant strains. Synonyms: 2,5-Dichlorothiophen-3-yl Tioconazole Hydrochloride; 1-(2-(2,4-Dichlorophenyl)-2-((2,5-dichlorothiophen-3-yl)methoxy)ethyl)-1H-imidazole Hydrochloride. CAS No. 61675-62-5. Molecular formula: C16H12Cl4N2OS HCl. Mole weight: 460.63. | |
| Tioconazole Related Compound C | One impurity of Tioconazole, which could be used as an antifungal agent and exhibit activities against Candida glabrata mutant strains. Synonyms: 5-Bromo-2-chlorothien-3-yl Tioconazole Hydrochloride; 5-Bromo-2-chloro-3-thenyl)-oxy]-phenethyl]imidazole Hydrochlorid. Molecular formula: C16H12BrCl3N2OS HCl. Mole weight: 503.07. | |
| TiOPC | TiOPC. Uses: Designed for use in research and industrial production. Additional or Alternative Names: Titanium oxide phthalocyanine. Product Category: Organic Light Emitting Diode (OLED). Appearance: Blue powder. CAS No. 26201-32-1. Molecular formula: C32H16N8OTi. Mole weight: 576.39 g/mol. Purity: 95%+. Product ID: ACM26201321. Alfa Chemistry ISO 9001:2015 Certified. Categories: Tiocfaidh ár lá. | |
| Tiopronin | Tiopronin is a diffusible antioxidant, an antidote to heavy metal poisoning and a radioprotective agent. Tiopronin can control the rate of cystine precipitation and excretion and has the potential for cystinuria, rheumatoid arthritis and hepatic disorders [1] [2]. Uses: Scientific research. Group: Natural products. CAS No. 1953-2-2. Pack Sizes: 10 mM * 1 mL; 500 mg; 1 g. Product ID: HY-B0373. | |
| Tiopronin | It is used as antidote against heavy metal poisoning; hepatoprotectant; mucolytic. Group: Biochemicals. Alternative Names: N-(2-Mercapto-1-oxopropyl)glycine. Grades: Highly Purified. CAS No. 1953-2-2. Pack Sizes: 1g. US Biological Life Sciences. |  Worldwide |
| Tiopronin-cysteine disulfide | Tiopronin-cysteine disulfide is a disulfide formed by Tiopronin (HY-B0373) and cysteine [1]. Uses: Scientific research. Group: Signaling pathways. CAS No. 77591-18-5. Pack Sizes: 1 mg. Product ID: HY-131516. | |
| Tiopronin-d3,13C (N- (2-Mercaptopropionyl) glycine-d3, 13C, µ-Mercaptopropionyl glycine-d3, 13C, . (2-Mercapto-propionylamino)-acetic Acid-d3,13C,. ) | Tiopronin-d3,13C (N- (2-Mercaptopropionyl) glycine-d3, 13C, µ-Mercaptopropionyl glycine-d3, 13C, (2-Mercapto-propionylamino)-acetic Acid-d3,13C, ). Group: Biochemicals. Alternative Names: N- (2-Mercaptopropionyl) glycine-d3, 13C; µ-Mercaptopropionyl glycine-d3, 13C; (2-Mercapto-propionylamino)-acetic Acid-d3,13C. Grades: Highly Purified. Pack Sizes: 1mg. US Biological Life Sciences. | Worldwide |
| Tiopronin Dimer Disodium Salt (Mixture of Diastereoisomers) | Tiopronin Dimer Disodium Salt (Mixture of Diastereoisomers) is an impurity of Tiopronin, which is used as an antidote against heavy metal poisoning. CAS No. 21269-37-4. Molecular formula: C10H14N2O6S2.2Na. Mole weight: 368.34. | |
| Tiopronin Disulfide | Tiopronin Disulfide is used in the treatment of mitochondrial dysfunction and postischemic myocardial damage. Tiopronin Disulfide partly prevents and reverses mitochondrial uncoupling and improves deteriorated heart function. Group: Biochemicals. Grades: Highly Purified. CAS No. 21269-37-4. Pack Sizes: 250mg, 2.5g. Molecular Formula: C10H16N2O6S2. US Biological Life Sciences. | Worldwide |
| Tiopronin impurity 1 | Tiopronin impurity 1. Uses: For analytical and research use. Group: Impurity standards. CAS No. 177219-40-8. Molecular Formula: C11H20N2O2. Mole Weight: 212.3. Catalog: APB177219408. |  |
| Tiopronin Impurity 1 | Tiopronin Impurity 1 is an impurity of Tiopronin, which is used as an antidote against heavy metal poisoning. Synonyms: 2-(acetylthio)propanoyl)glycine. Grades: 98%. CAS No. 6182-96-3. Molecular formula: C7H11NO4S. Mole weight: 205.23. | |
| Tiopronin impurity 2 | Tiopronin impurity 2. Uses: For analytical and research use. Group: Impurity standards. CAS No. 5438-83-5. Molecular Formula: C8H14N2O5. Mole Weight: 218.21. Catalog: APB5438835. | |
| Tiopronin Sulfinic Acid | | |
| Tiopronin Sulfone | One of the impurities of Tiopronin, which could be used as an antidote in poisoning caused by heavy metals. Molecular formula: C5H9NO5S. Mole weight: 195.20. | |
| Tiopronin Sulfoxide | One of the impurities of Tiopronin, which could be used as an antidote in poisoning caused by heavy metals. Molecular formula: C5H9NO4S. Mole weight: 179.20. | |
| Tiospirone Hydrochloride | Tiospirone is an atypical antipsychotic agent. Tiospirone is used in the treatment of schizophrenia. Tiospirone acts as a 5-HT1A receptor partial agonist, 5-HT2A, 5-HT2C, and 5-HT7 receptor inverse agonist, and D2, D4, and α1-adrenergic receptor antagonist. Group: Biochemicals. Alternative Names: 8-[4-[4-(1,2-Benzisothiazol-3-yl)-1-piperazinyl]butyl]-8-azaspiro[4.5]decane-7,9-dione Hydrochloride; BMY 13859; BMY 13859-1; MJ 13859-1; Tiaspirone Hydrochloride. Grades: Highly Purified. CAS No. 87691-92-7. Pack Sizes: 10mg. US Biological Life Sciences. | Worldwide |
| Tiotidine | Tiotidine is a potent histamine H2 receptor antagonist with negligible activity against H1- and H3- receptors. Synonyms: 1-cyano-3-[2-[[2-(diaminomethylideneamino)-1,3-thiazol-4-yl]methylsulfanyl]ethyl]-2-methylguanidine. Grades: ≥99% by HPLC. CAS No. 69014-14-8. Molecular formula: C10H16N8S2. Mole weight: 312.41. | |
| Tiotropium Bromide | Muscarinic receptor antagonist. Bronchodilator. Group: Biochemicals. Alternative Names: (1α,2 β,4 β,5α,7 β )-7-[(2-Hydroxy-2, 2-di-2-thienylacetyl)oxy]-9, 9-dimethyl-3-oxa-9-azoniatricyclo[3. 3. 1. 02, 4]nonane Bromide. Grades: Highly Purified. CAS No. 136310-93-5. Pack Sizes: 5mg. US Biological Life Sciences. | Worldwide |
| Tiotropium Bromide | Tiotropium Bromide (BA679 BR) is a muscarinic acetylcholine receptor (mAChR) antagonist that blocks the binding of the acetylcholine ligand and subsequent opening of the ligand-gated ion channel. Uses: Scientific research. Group: Signaling pathways. Alternative Names: BA679 BR. CAS No. 136310-93-5. Pack Sizes: 10 mM * 1 mL; 5 mg; 10 mg; 50 mg; 100 mg; 500 mg. Product ID: HY-17360. | |
| Tiotropium Bromide | anti-migraine agent. CAS No. 136310-93-5. Product ID: 8-04719. Molecular formula: C19H22BrNO4S2. Mole weight: 472.41. Purity: 0.99. | |
| Tiotropium Bromide | Tiotropium Bromide. Uses: Designed for use in research and industrial production. Additional or Alternative Names: (1R,2R,4S,5S,7s)-7-(2-Hydroxy-2,2-di(thiophen-2-yl)acetoxy)-9,9-dimethyl-3-oxa-9-azatricyclo[3.3.1.02,4]nonan-9-ium bromide. Product Category: Thiophenes. Appearance: White Solid. CAS No. 136310-93-5. Molecular formula: C19H22BrNO4S2. Mole weight: 472.41. Purity: 0.99. Product ID: ACM136310935. Alfa Chemistry ISO 9001:2015 Certified. | |
| Tiotropium bromide hydrate | Tiotropium Bromide hydrate is a monohydrate of tiotropium bromide (Spiriva; Tiova; BA 679BR; tiopropium) that is an anticholinergic and bronchodilator and a muscarinic receptor antagonist. Synonyms: BA 679BR. Grades: >98%. CAS No. 139404-48-1. Molecular formula: C19H22NO4S2.Br.xH2O. Mole weight: 490.43. | |
| Tiotropium Bromide Hydrate | Tiotropium Bromide Hydrate. Uses: Designed for use in research and industrial production. Additional or Alternative Names: Tiotropium Bromide Monohydrate; Tiotropium Bromide Xhydrate. Product Category: Thiophenes. Appearance: White to Off-White Solid. CAS No. 139404-48-1. Molecular formula: C19H22NO4S2Br·H2O. Mole weight: 490.43. Purity: 95%+. Product ID: ACM139404481. Alfa Chemistry ISO 9001:2015 Certified. | |
| Tiotropium bromide monohydrate | Tiotropium bromide monohydrate. Group: Biochemicals. Grades: Highly Purified. CAS No. 139404-48-1. Pack Sizes: 100mg, 250mg, 500mg, 1g, 2g. Molecular Formula: C19H22NO4S2·H2O·Br. US Biological Life Sciences. | Worldwide |
| Tiotropium bromide monohydrate | 100mg Pack Size. Group: Analytical Reagents, Biochemicals, Building Blocks, Organics. Formula: C19H22BrNO4S2.H2O. CAS No. 139404-48-1. Prepack ID 90025485-100mg. Molecular Weight 490.43. See USA prepack pricing. |  |
| Tiotropium bromide monohydrate | Tiotropium bromide (BA-679 BR) monohydrate is a long-acting muscarinic receptor antagonist [1] [2]. Uses: Scientific research. Group: Signaling pathways. Alternative Names: BA-679 BR monohydrate. CAS No. 411207-31-3. Pack Sizes: 10 mM * 1 mL; 50 mg; 100 mg. Product ID: HY-B0460. | |
| Tiotropium-d3 Bromide | Muscarinic receptor antagonist. Bronchodilator. Group: Biochemicals. Alternative Names: (1α,2 β,4 β,5α,7 β )-7-[(2-Hydroxy-2, 2-di-2-thienylacetyl)oxy]-9, 9-dimethyl-3-oxa-9-azoniatricyclo[3. 3. 1. 02, 4]nonane-d3 Bromide. Grades: Highly Purified. CAS No. 1127226-56-5. Pack Sizes: 1mg. US Biological Life Sciences. | Worldwide |
| Tiotropium impurity 1 | Tiotropium impurity 1. Uses: For analytical and research use. Group: Impurity standards. CAS No. 588-63-6. Molecular Formula: C9H11BrO. Mole Weight: 215.09. Catalog: APB588636. | |
| Tioxidazole | Tioxidazole. Uses: Designed for use in research and industrial production. Additional or Alternative Names: Tioxidazole, 61570-90-9, Sch-21480, NCGC00160481-01, methyl 6-propoxy-2-benzothiazolylcarbamate, methyl (6-propoxy-1,3-benzothiazol-2-yl)carbamate, (6-Propoxy-benzothiazol-2-yl)-carbamic acid methyl ester, Tioxidazol, Tioxidazolum, Tiox, Tiox (TN), ChemDivAM_000281, Tioxidazole (USAN/INN), ChemDiv1_000106, Tioxidazol [INN-Spanish], Tioxidazolum [INN-Latin], AC1L2HJ1, DSSTox_CID_26178, DSSTox_RID_81409, UNII-NZW046NI85. Product Category: Heterocyclic Organic Compound. CAS No. 61570-90-9. Molecular formula: C12H14N2O3S. Mole weight: 266.316160 [g/mol]. Purity: 0.96. IUPACName: methyl N-(6-propoxy-1,3-benzothiazol-2-yl)carbamate. Canonical SMILES: CCCOC1=CC2=C(C=C1)N=C(S2)NC(=O)OC. Density: 1.313g/cm³. ECNumber: 262-854-2. Product ID: ACM61570909. Alfa Chemistry ISO 9001:2015 Certified. | |
| Tioxolone | Tioxolone is an inhibitor of the metalloenzyme carbonic anhydrase I and has anti-acne activity. Uses: Scientific research. Group: Signaling pathways. CAS No. 4991-65-5. Pack Sizes: 10 mM * 1 mL; 500 mg; 1 g. Product ID: HY-B0483. | |
| Tioxolone | Tioxolone is a metalloenzyme carbonic anhydrase I inhibitor with a Ki of 91 nM. Synonyms: 6-Hydroxy-1,3-benzoxathiol-2-one. Grades: >98%. CAS No. 4991-65-5. Molecular formula: C7H4O3S. Mole weight: 168.17. | |
| Tip-39 | Tip-39. Uses: Designed for use in research and industrial production. Additional or Alternative Names: H-SER-LEU-ALA-LEU-ALA-ASP-ASP-ALA-ALA-PHE-ARG-GLU-ARG-ALA-ARG-LEU-LEU-ALA-ALA-LEU-GLU-ARG-ARG-HIS-TRP-LEU-ASN-SER-TYR-MET-HIS-LYS-LEU-LEU-VAL-LEU-ASP-ALA-PRO-OH;SLALADDAAFRERARLLAALERRHWLNSYMHKLLVLDAP;TIP-39;TUBEROINFUNDIBULAR NEUROPEPTIDE;H-SER-LEU-ALA-. Product Category: Heterocyclic Organic Compound. CAS No. 277302-47-3. Molecular formula: C202H325N61O54S. Product ID: ACM277302473. Alfa Chemistry ISO 9001:2015 Certified. Categories: TIP39. | |
| TIP 39, Tuberoinfundibular Neuropeptide | It is a neuropeptide and parathyroid hormone 2 receptor (PTH2R) agonist. Synonyms: Ser-Leu-Ala-Leu-Ala-Asp-Asp-Ala-Ala-Phe-Arg-Glu-Arg-Ala-Arg-Leu-Leu-Ala-Ala-Leu-Glu-Arg-Arg-His-Trp-Leu-Asn-Ser-Tyr-Met-His-Lys-Leu-Leu-Val-Leu-Asp-Ala-Pro; TIP 39 (39 mer); L-seryl-L-leucyl-L-alanyl-L-leucyl-L-alanyl-L-alpha-aspartyl-L-alpha-aspartyl-L-alanyl-L-alanyl-L-phenylalanyl-L-arginyl-L-alpha-glutamyl-L-arginyl-L-alanyl-L-arginyl-L-leucyl-L-leucyl-L-alanyl-L-alanyl-L-leucyl-L-alpha-glutamyl-L-arginyl-L-arginyl-L-histidyl-L-tryptophyl-L-leucyl-L-asparagyl-L-seryl-L-tyrosyl-L-methionyl-L-histidyl-L-lysyl-L-leucyl-L-leucyl-L-valyl-L-leucyl-L-alpha-aspartyl-L-alanyl-L-proline. Grades: ≥95% by HPLC. CAS No. 277302-47-3. Molecular formula: C202H325N61O54S. Mole weight: 4504.17. | |
| Tipelukast | Tipelukast could be used as an oral anti-inflammatory agent and has been found to exhibit potential activities against non-alcoholic fatty liver disease as a leukotriene receptor antagonist. Synonyms: 4-[6-Acetyl-3-[3-[(4-acetyl-3-hydroxy-2-propylphenyl)thio]propoxy]-2-propylphenoxy]-butanoic Acid; 4-[6-Acetyl-3-[3-(4-acetyl-3-hydroxy-2-propylphenylthio)propoxy]-2-propylphenoxy]butyric Acid. CAS No. 125961-82-2. Molecular formula: C29H38O7S. Mole weight: 530.69. | |
| Tipelukast | Tipelukast (KCA 757) is a sulfidopeptide leukotriene receptor antagonist, an orally bioavailable anti-inflammatory agent and used for the treatment of asthma. Uses: Scientific research. Group: Signaling pathways. Alternative Names: KCA 757; MN 001. CAS No. 125961-82-2. Pack Sizes: 1 mg. Product ID: HY-14938. | |
| Tipepidine hydrochloride | Tipepidine hydrochloride reversibly inhibits dopamine (DA) D 2 receptor-mediated GIRK currents (I DA(GIRK) ) with an IC 50 of 7.0 μM. Tipepidine hydrochloride subsequently activates VTA dopamine neuron [1]. Tipepidine hydrochloride, a non-narcotic antitussive, exerts an antidepressant-like effect [2]. Uses: Scientific research. Group: Signaling pathways. CAS No. 1449686-84-3. Pack Sizes: 10 mM * 1 mL; 5 mg; 10 mg; 50 mg; 100 mg. Product ID: HY-121685A. | |
| tipepidine Impurity 1 | tipepidine Impurity 1. Uses: For analytical and research use. Group: Impurity standards. CAS No. 5169-77-7. Molecular Formula: C21H25NO7S2. Mole Weight: 467.55. Catalog: APB5169777. | |
| Tiphenylphosphine-3,3',3''-trisulfonic acid trisodium salt | Tiphenylphosphine-3,3',3''-trisulfonic acid trisodium salt. Group: Biochemicals. Grades: Highly Purified. CAS No. 63995-70-0. Pack Sizes: 50mg, 100mg, 250mg, 500mg, 1g. Molecular Formula: C18H12Na3O9PS3. US Biological Life Sciences. | Worldwide |
| Tipifarnib | Tipifarnib is a nonpeptidomimetic quinolinone with potential antineoplastic activity. Tipifarnib binds to and inhibits the enzyme farnesyl protein transferase, an enzyme involved in protein processing (farnesylation) for signal transduction. By inhibiting the farnesylation of proteins, this agent prevents the activation of Ras oncogenes, inhibits cell growth, induces apoptosis, and inhibits angiogenesis. Uses: Antineoplastic agents. Synonyms: R115777; R 115777; R-115777; LX81; NSC702818; D03720; Tipifarnib; trade name Zarnestra. Grades: 0.97. CAS No. 192185-72-1. Molecular formula: C27H22Cl2N4O. Mole weight: 489.4. | |
| Tipifarnib | A farnesyltransferase inhibitor. Sensitizes human multiple myeloma cell to proteasome inhibition by blocking degradation of bortezomib-induced aggresomes. Also shown to inhibit the growth of myeloid leukemia cell lines and primary leukemia cells by inducing apoptosis and cell-cycle blockage when combined with rapamycin(R124000). Group: Biochemicals. Alternative Names: 6-[(R)-Amino(4-chlorophenyl)(1-methyl-1H-imidazol-5-yl)methyl]-4-(3-chlorophenyl)-1-methyl-2(1H)-quinolinone; (R)-(+)-R 115777; Zarnestra. Grades: Highly Purified. CAS No. 192185-72-1. Pack Sizes: 2.5mg. US Biological Life Sciences. | Worldwide |
| Tipifarnib | Tipifarnib (IND 58359) binds to and inhibits farnesyltransferase (FTase) with an IC 50 of 0.86 nM. Antineoplastic activity and antiparasitic activity [1]. Uses: Scientific research. Group: Signaling pathways. Alternative Names: IND 58359; R115777. CAS No. 192185-72-1. Pack Sizes: 10 mM * 1 mL; 5 mg; 10 mg; 25 mg; 50 mg; 100 mg. Product ID: HY-10502. | |
| Tipifarnib S enantiomer | Tipifarnib S enantiomer is the S enantiomer of Tipifarnib. Tipifarnib, also called as Zarnestra or R115777, is a farnesyltransferase inhibitor (IC50= 0.6 nM) with antitumor activity. Synonyms: 6-[(S)-amino-(4-chlorophenyl)-(3-methylimidazol-4-yl)methyl]-4-(3-chlorophenyl)-1-methylquinolin-2-one Tipifarnib (S enantiomer) CHEMBL243659 tipifarnib zarnestra (S)-TIPIFARNIB tipifarnib(r115777) SCHEMBL4429738 (r)-(+)-r 115777 FT-0675247 tipifarnib(zar. CAS No. 192185-71-0. Molecular formula: C27H22Cl2N4O. Mole weight: 489.40. | |
| Tipiracil | Tipiracil, a thymidine phosphorylase (TPase) inhibitor, has been found to be a potential drug candidate for metastatic colorectal cancer. Synonyms: TAS-102; TAS102. CAS No. 183204-74-2. Molecular formula: C9H11ClN4O2. Mole weight: 242.67. | |
| Tipiracil | Tipiracil is a thymidine phosphorylase ( TPase ) inhibitor. Uses: Scientific research. Group: Signaling pathways. CAS No. 183204-74-2. Pack Sizes: 5 mg; 10 mg; 25 mg; 50 mg; 100 mg; 200 mg. Product ID: HY-A0063A. | |
| Tipiracil HCl | Tipiralacil, also known as TPI, is a thymidine phosphorylase inhibitor (TPI). Tipiracil is one of the active components in TAS-102, which is an anticancer drug candidate currently in clinical trials. TAS-102 consists of the cytotoxin Trifluridine and the thymidine phosphorylase inhibitor (TPI) tipiracil. Trifluridine is incorporated into DNA during DNA synthesis and inhibits tumor cell growth. Tipiracil protects trifluridine from being broken down when taken orally. Synonyms: Tipiracil, TPI. Grades: 0.99. CAS No. 183204-72-0. Molecular formula: C9H12Cl2N4O2. Mole weight: 279.121. | |
| Tipiracil hydrochloride | Tipiracil (hydrochloride) is a thymidine phosphorylase inhibitor (TPI), used for cancer research. Uses: Scientific research. Group: Signaling pathways. CAS No. 183204-72-0. Pack Sizes: 10 mM * 1 mL; 5 mg; 10 mg; 25 mg; 50 mg; 100 mg; 200 mg. Product ID: HY-A0063. | |
| Tipiracil Impurity 1 | One of the impurities of Tipiracil, which is a thymidine phosphorylase (TPase) inhibitor and has been found to be a potential drug candidate for metastatic colorectal cancer. Molecular formula: C9H10ClN3O3. Mole weight: 243.65. | |
| Tipiracil Impurity 2 | One of the impurities of Tipiracil, which is a thymidine phosphorylase (TPase) inhibitor and has been found to be a potential drug candidate for metastatic colorectal cancer. Molecular formula: C6H7ClN2O3. Mole weight: 190.59. | |
| Tipiracil Impurity 3 | An impurity of Trifluridine. Trifluridine is a nucleoside analogue antiviral and nucleoside metabolic inhibitor used for the treatment of primary keratoconjunctivitis and recurrent epithelial keratitis due to HERPES SIMPLEX virus. Synonyms: Trifluridine Impurity 5; Methyl 5-chloro-2,6-dihydroxy-4-pyrimidinecarboxylate; Methyl 5-chloro-2,6-dihydroxypyrimidine-4-carboxylate; CD-0006; AK162189. CAS No. 91447-90-4. Molecular formula: C6H5ClN2O4. Mole weight: 204.57. | |
| Tiplaxtinin | Tiplaxtinin is a novel plasminogen activator inhibitor-1 (PAI-1) inhibitor. It is an orally active prothrombolytic drug that inhibits PAI-1 and accelerates fibrinolysis while maintaining normal coagulation in a model of coronary occlusion. It exerts antithrombotic efficacy in rat models of arterial and venous vascular injury without effecting platelet aggregation. Synonyms: Tiplaxtinin; PAI039; PAI-039; PAI 039. Grades: >98%. CAS No. 393105-53-8. Molecular formula: C24H16F3NO4. Mole weight: 439.38. | |
| Tipranavir | Tipranavir, a nonpeptidic HIV protease inhibitor (NPPI), inhibits the enzymatic activity and dimerization of HIV-1 protease, exerts potent activity against multi-PI-resistant HIV-1 isolates. Synonyms: PNU-140690; PNU 140690; PNU140690; Aptivus; N-[3-[(1R)-1-[(6R)-5,6-Dihydro-4-hydroxy-2-oxo-6-(2-phenylethyl)-6-propyl-2H-pyran-3-yl]propyl]phenyl]-5-(trifluoromethyl)-2-pyridinesulfonamide; 2-Pyridinesulfonamide, N-[3-[(1R)-1-[(6R)-5,6-dihydro-4-hydroxy-2-oxo-6-(2-phenylethyl)-6-propyl-2H-pyran-3-yl]propyl]phenyl]-5-(trifluoromethyl)-; 2-Pyridinesulfonamide, N-[3-[1-[5,6-dihydro-4-hydroxy-2-oxo-6-(2-phenylethyl)-6-propyl-2H-pyran-3-yl]propyl]phenyl]-5-(trifluoromethyl)-, [R-(R*,R*)]-; TPV; U 140690. Grades: ≥95%. CAS No. 174484-41-4. Molecular formula: C31H33F3N2O5S. Mole weight: 602.67. | |
| Tipranavir | Storage and Stability. Group: Biochemicals. Alternative Names: N-[3-[(1R)-1-[(6R)-5,6-Dihydro-4-hydroxy-2-oxo-6-(2-phenylethyl)-6-propyl-2H-pyran-3-yl]propyl]phenyl]-5-(trifluoromethyl)-2-pyridinesulfonamide; PNU-140690; Aptivus. Grades: Highly Purified. CAS No. 174484-41-4. Pack Sizes: 1mg, 2mg, 5mg, 10mg, 25mg. US Biological Life Sciences. | Worldwide |
| Tipranavir | Tipranavir (PNU-140690) inhibits the enzymatic activity and dimerization of HIV-1 protease, exerts potent activity against multi-protease inhibitor (PI)-resistant HIV-1 isolates with IC50s of 66-410 nM. Tipranavir inhibits SARS-CoV-2 3CLpro activity. Uses: Designed for use in research and industrial production. Additional or Alternative Names: PNU-140690;Aptivus;N-[3-[(1R)-1-[(6R)-5,6-Dihydro-4-hydroxy-2-oxo-6-(2-phenylethyl)-6-propyl-2H-pyran-3-yl]propyl]phenyl]-5-(trifluoromethyl)-2-pyridinesulfonamide;N-[3-[(1R)-1-[(6R)-2-Hydroxy-4-oxo-6-phenethyl-6-propyl-5H-pyran-3-yl]propyl]phenyl]-5-(trifluoromethyl)pyridine-2-sulfonamide;Tipranavir;Tipranavir(PNU-140690,Aptivus);2-PyridinesulfonaMide,N-[3-[(1R)-1-[(6R)-5,6-dihydro-4-hydroxy-2-oxo-6-(2-phenylethyl)-6-propyl-2H-pyran-3-yl]propyl]phenyl]-5-(trifluoroMethyl)-. Product Category: Inhibitors. Appearance: Solid. CAS No. 174484-41-4. Molecular formula: C31H33F3N2O5S. Mole weight: 602.66. Purity: 0.9808. Canonical SMILES: O=C1C([C@H](CC)C2=CC=CC(NS(C3=CC=C(C(F)(F)F)C=N3)(=O)=O)=C2)=C(O)C[C@](CCC4=CC=CC=C4)(CCC)O1. Product ID: ACM174484414. Alfa Chemistry ISO 9001:2015 Certified. | |
| Tipranavir | Tipranavir (PNU-140690) inhibits the enzymatic activity and dimerization of HIV-1 protease , exerts potent activity against multi-protease inhibitor (PI)-resistant HIV-1 isolates with IC 50 s of 66-410 nM [1] [2]. Tipranavir inhibits SARS-CoV-2 3CL pro activity [3]. Uses: Scientific research. Group: Signaling pathways. Alternative Names: PNU-140690. CAS No. 174484-41-4. Pack Sizes: 10 mM * 1 mL; 1 mg; 5 mg; 10 mg. Product ID: HY-15148. | |
| Tipranavir-d4 (N-[3-[(1R)-1-[(6R)-5,6-Dihydro-4-hydroxy-2-oxo-6-(2-phenylethyl)-6-propyl-2H-pyran-3-yl]propyl]phenyl]-5-(trifluoromethyl)-2-pyridinesulfonamide-d4,. PNU-140690-d4, Aptivus-d4,. ) | Nonpeptidic HIV protease inhibitor (NPPI). Antiviral. Group: Biochemicals. Alternative Names: N-[3-[(1R)-1-[(6R)-5,6-Dihydro-4-hydroxy-2-oxo-6-(2-phenylethyl)-6-propyl-2H-pyran-3-yl]propyl]phenyl]-5-(trifluoromethyl)-2-pyridinesulfonamide-d4; PNU-140690-d4; Aptivus-d4. Grades: Highly Purified. Pack Sizes: 1mg. US Biological Life Sciences. | Worldwide |
| Tipranavir disodium salt | Tipranavir disodium salt is the sodium salt form of Tipranavir. Tipranavir is a nonpeptidic protease inhibitor that can inhibit the HIV ptotease. Uses: Anti-hiv agents. Synonyms: Tipranavir disodium; disodium (2R)-4-oxo-2-(2-phenylethyl)-2-propyl-5-[(1R)-1-[3-[5-(trifluoromethyl)pyridin-2-yl]sulfonylazanidylphenyl]propyl]-3H-pyran-6-olate. CAS No. 191150-83-1. Molecular formula: C31H31F3N2Na2O5S. Mole weight: 646.633. | |
Our database is helping our users find suppliers everyday.
