American Chemical Suppliers

A directory of where to buy chemicals in the USA, including: distributors, industrial manufacturers, bulk supplies and wholesalers of raw ingredients & finished goods.

Search for products or services, then visit the suppliers website for prices or more information.

Product
Tiopronin Dimer Disodium Salt (Mixture of Diastereoisomers) Tiopronin Dimer Disodium Salt (Mixture of Diastereoisomers) is an impurity of Tiopronin, which is used as an antidote against heavy metal poisoning. CAS No. 21269-37-4. Molecular formula: C10H14N2O6S2.2Na. Mole weight: 368.34. BOC Sciences 7
Tiopronin Disulfide Tiopronin Disulfide is used in the treatment of mitochondrial dysfunction and postischemic myocardial damage. Tiopronin Disulfide partly prevents and reverses mitochondrial uncoupling and improves deteriorated heart function. Group: Biochemicals. Grades: Highly Purified. CAS No. 21269-37-4. Pack Sizes: 250mg, 2.5g. Molecular Formula: C10H16N2O6S2. US Biological Life Sciences. USBiological 5
Worldwide
Tiopronin Impurity 1 Tiopronin Impurity 1 is an impurity of Tiopronin, which is used as an antidote against heavy metal poisoning. Synonyms: 2-(acetylthio)propanoyl)glycine. Grades: 98%. CAS No. 6182-96-3. Molecular formula: C7H11NO4S. Mole weight: 205.23. BOC Sciences 7
Tiopronin Sulfinic Acid BOC Sciences 8
Tiopronin Sulfone One of the impurities of Tiopronin, which could be used as an antidote in poisoning caused by heavy metals. Molecular formula: C5H9NO5S. Mole weight: 195.20. BOC Sciences 7
Tiopronin Sulfoxide One of the impurities of Tiopronin, which could be used as an antidote in poisoning caused by heavy metals. Molecular formula: C5H9NO4S. Mole weight: 179.20. BOC Sciences 7
Tiospirone Hydrochloride Tiospirone is an atypical antipsychotic agent. Tiospirone is used in the treatment of schizophrenia. Tiospirone acts as a 5-HT1A receptor partial agonist, 5-HT2A, 5-HT2C, and 5-HT7 receptor inverse agonist, and D2, D4, and α1-adrenergic receptor antagonist. Group: Biochemicals. Alternative Names: 8-[4-[4-(1,2-Benzisothiazol-3-yl)-1-piperazinyl]butyl]-8-azaspiro[4.5]decane-7,9-dione Hydrochloride; BMY 13859; BMY 13859-1; MJ 13859-1; Tiaspirone Hydrochloride. Grades: Highly Purified. CAS No. 87691-92-7. Pack Sizes: 10mg. US Biological Life Sciences. USBiological 3
Worldwide
Tiotidine Tiotidine is a potent histamine H2 receptor antagonist with negligible activity against H1- and H3- receptors. Synonyms: 1-cyano-3-[2-[[2-(diaminomethylideneamino)-1,3-thiazol-4-yl]methylsulfanyl]ethyl]-2-methylguanidine. Grades: ≥99% by HPLC. CAS No. 69014-14-8. Molecular formula: C10H16N8S2. Mole weight: 312.41. BOC Sciences 10
Tiotropium Bromide Tiotropium Bromide. Uses: Designed for use in research and industrial production. Additional or Alternative Names: (1R,2R,4S,5S,7s)-7-(2-Hydroxy-2,2-di(thiophen-2-yl)acetoxy)-9,9-dimethyl-3-oxa-9-azatricyclo[3.3.1.02,4]nonan-9-ium bromide. Product Category: Thiophenes. Appearance: White Solid. CAS No. 136310-93-5. Molecular formula: C19H22BrNO4S2. Mole weight: 472.41. Purity: 0.99. Product ID: ACM136310935. Alfa Chemistry — ISO 9001:2015 Certified. Alfa Chemistry. 2
Tiotropium Bromide Muscarinic receptor antagonist. Bronchodilator. Group: Biochemicals. Alternative Names: (1α,2 β,4 β,5α,7 β )-7-[(2-Hydroxy-2, 2-di-2-thienylacetyl)oxy]-9, 9-dimethyl-3-oxa-9-azoniatricyclo[3. 3. 1. 02, 4]nonane Bromide. Grades: Highly Purified. CAS No. 136310-93-5. Pack Sizes: 5mg. US Biological Life Sciences. USBiological 3
Worldwide
Tiotropium Bromide Tiotropium Bromide (BA679 BR) is a muscarinic acetylcholine receptor (mAChR) antagonist that blocks the binding of the acetylcholine ligand and subsequent opening of the ligand-gated ion channel. Uses: Scientific research. Group: Signaling pathways. Alternative Names: BA679 BR. CAS No. 136310-93-5. Pack Sizes: 10 mM * 1 mL; 5 mg; 10 mg; 50 mg; 100 mg; 500 mg. Product ID: HY-17360. MedChemExpress MCE
Tiotropium Bromide anti-migraine agent. CAS No. 136310-93-5. Product ID: 8-04719. Molecular formula: C19H22BrNO4S2. Mole weight: 472.41. Purity: 0.99. CarboMer Inc
Tiotropium bromide hydrate Tiotropium Bromide hydrate is a monohydrate of tiotropium bromide (Spiriva; Tiova; BA 679BR; tiopropium) that is an anticholinergic and bronchodilator and a muscarinic receptor antagonist. Synonyms: BA 679BR. Grades: >98%. CAS No. 139404-48-1. Molecular formula: C19H22NO4S2.Br.xH2O. Mole weight: 490.43. BOC Sciences 8
Tiotropium Bromide Hydrate Tiotropium Bromide Hydrate. Uses: Designed for use in research and industrial production. Additional or Alternative Names: Tiotropium Bromide Monohydrate; Tiotropium Bromide Xhydrate. Product Category: Thiophenes. Appearance: White to Off-White Solid. CAS No. 139404-48-1. Molecular formula: C19H22NO4S2Br·H2O. Mole weight: 490.43. Purity: 95%+. Product ID: ACM139404481. Alfa Chemistry — ISO 9001:2015 Certified. Alfa Chemistry. 2
Tiotropium bromide monohydrate 100mg Pack Size. Group: Analytical Reagents, Biochemicals, Building Blocks, Organics. Formula: C19H22BrNO4S2.H2O. CAS No. 139404-48-1. Prepack ID 90025485-100mg. Molecular Weight 490.43. See USA prepack pricing. Molekula Americas
Tiotropium bromide monohydrate Tiotropium bromide monohydrate. Group: Biochemicals. Grades: Highly Purified. CAS No. 139404-48-1. Pack Sizes: 100mg, 250mg, 500mg, 1g, 2g. Molecular Formula: C19H22NO4S2·H2O·Br. US Biological Life Sciences. USBiological 8
Worldwide
Tiotropium bromide monohydrate ?98% (HPLC). Group: Fluorescence/luminescence spectroscopy. Alfa Chemistry Analytical Products
Tiotropium bromide monohydrate Tiotropium bromide (BA-679 BR) monohydrate is a long-acting muscarinic receptor antagonist [1] [2]. Uses: Scientific research. Group: Signaling pathways. Alternative Names: BA-679 BR monohydrate. CAS No. 411207-31-3. Pack Sizes: 10 mM * 1 mL; 50 mg; 100 mg. Product ID: HY-B0460. MedChemExpress MCE
Tiotropium-d3 Bromide Muscarinic receptor antagonist. Bronchodilator. Group: Biochemicals. Alternative Names: (1α,2 β,4 β,5α,7 β )-7-[(2-Hydroxy-2, 2-di-2-thienylacetyl)oxy]-9, 9-dimethyl-3-oxa-9-azoniatricyclo[3. 3. 1. 02, 4]nonane-d3 Bromide. Grades: Highly Purified. CAS No. 1127226-56-5. Pack Sizes: 1mg. US Biological Life Sciences. USBiological 3
Worldwide
Tioxidazole Tioxidazole. Uses: Designed for use in research and industrial production. Additional or Alternative Names: Tioxidazole, 61570-90-9, Sch-21480, NCGC00160481-01, methyl 6-propoxy-2-benzothiazolylcarbamate, methyl (6-propoxy-1,3-benzothiazol-2-yl)carbamate, (6-Propoxy-benzothiazol-2-yl)-carbamic acid methyl ester, Tioxidazol, Tioxidazolum, Tiox, Tiox (TN), ChemDivAM_000281, Tioxidazole (USAN/INN), ChemDiv1_000106, Tioxidazol [INN-Spanish], Tioxidazolum [INN-Latin], AC1L2HJ1, DSSTox_CID_26178, DSSTox_RID_81409, UNII-NZW046NI85. Product Category: Heterocyclic Organic Compound. CAS No. 61570-90-9. Molecular formula: C12H14N2O3S. Mole weight: 266.316160 [g/mol]. Purity: 0.96. IUPACName: methyl N-(6-propoxy-1,3-benzothiazol-2-yl)carbamate. Canonical SMILES: CCCOC1=CC2=C(C=C1)N=C(S2)NC(=O)OC. Density: 1.313g/cm³. ECNumber: 262-854-2. Product ID: ACM61570909. Alfa Chemistry — ISO 9001:2015 Certified. Alfa Chemistry. 5
Tioxolone Tioxolone is an inhibitor of the metalloenzyme carbonic anhydrase I and has anti-acne activity. Uses: Scientific research. Group: Signaling pathways. CAS No. 4991-65-5. Pack Sizes: 10 mM * 1 mL; 500 mg; 1 g. Product ID: HY-B0483. MedChemExpress MCE
Tioxolone Tioxolone is a metalloenzyme carbonic anhydrase I inhibitor with a Ki of 91 nM. Synonyms: 6-Hydroxy-1,3-benzoxathiol-2-one. Grades: >98%. CAS No. 4991-65-5. Molecular formula: C7H4O3S. Mole weight: 168.17. BOC Sciences 11
Tip-39 Tip-39. Uses: Designed for use in research and industrial production. Additional or Alternative Names: H-SER-LEU-ALA-LEU-ALA-ASP-ASP-ALA-ALA-PHE-ARG-GLU-ARG-ALA-ARG-LEU-LEU-ALA-ALA-LEU-GLU-ARG-ARG-HIS-TRP-LEU-ASN-SER-TYR-MET-HIS-LYS-LEU-LEU-VAL-LEU-ASP-ALA-PRO-OH;SLALADDAAFRERARLLAALERRHWLNSYMHKLLVLDAP;TIP-39;TUBEROINFUNDIBULAR NEUROPEPTIDE;H-SER-LEU-ALA-. Product Category: Heterocyclic Organic Compound. CAS No. 277302-47-3. Molecular formula: C202H325N61O54S. Product ID: ACM277302473. Alfa Chemistry — ISO 9001:2015 Certified. Categories: TIP39. Alfa Chemistry. 3
TIP 39, Tuberoinfundibular Neuropeptide It is a neuropeptide and parathyroid hormone 2 receptor (PTH2R) agonist. Synonyms: Ser-Leu-Ala-Leu-Ala-Asp-Asp-Ala-Ala-Phe-Arg-Glu-Arg-Ala-Arg-Leu-Leu-Ala-Ala-Leu-Glu-Arg-Arg-His-Trp-Leu-Asn-Ser-Tyr-Met-His-Lys-Leu-Leu-Val-Leu-Asp-Ala-Pro; TIP 39 (39 mer); L-seryl-L-leucyl-L-alanyl-L-leucyl-L-alanyl-L-alpha-aspartyl-L-alpha-aspartyl-L-alanyl-L-alanyl-L-phenylalanyl-L-arginyl-L-alpha-glutamyl-L-arginyl-L-alanyl-L-arginyl-L-leucyl-L-leucyl-L-alanyl-L-alanyl-L-leucyl-L-alpha-glutamyl-L-arginyl-L-arginyl-L-histidyl-L-tryptophyl-L-leucyl-L-asparagyl-L-seryl-L-tyrosyl-L-methionyl-L-histidyl-L-lysyl-L-leucyl-L-leucyl-L-valyl-L-leucyl-L-alpha-aspartyl-L-alanyl-L-proline. Grades: ≥95% by HPLC. CAS No. 277302-47-3. Molecular formula: C202H325N61O54S. Mole weight: 4504.17. BOC Sciences 3
Tipelukast Tipelukast could be used as an oral anti-inflammatory agent and has been found to exhibit potential activities against non-alcoholic fatty liver disease as a leukotriene receptor antagonist. Synonyms: 4-[6-Acetyl-3-[3-[(4-acetyl-3-hydroxy-2-propylphenyl)thio]propoxy]-2-propylphenoxy]-butanoic Acid; 4-[6-Acetyl-3-[3-(4-acetyl-3-hydroxy-2-propylphenylthio)propoxy]-2-propylphenoxy]butyric Acid. CAS No. 125961-82-2. Molecular formula: C29H38O7S. Mole weight: 530.69. BOC Sciences 7
Tipelukast Tipelukast (KCA 757) is a sulfidopeptide leukotriene receptor antagonist, an orally bioavailable anti-inflammatory agent and used for the treatment of asthma. Uses: Scientific research. Group: Signaling pathways. Alternative Names: KCA 757; MN 001. CAS No. 125961-82-2. Pack Sizes: 1 mg. Product ID: HY-14938. MedChemExpress MCE
Tipelukast ?98% (HPLC). Group: Fluorescence/luminescence spectroscopy. Alfa Chemistry Analytical Products
Tipepidine hydrochloride Tipepidine hydrochloride reversibly inhibits dopamine (DA) D 2 receptor-mediated GIRK currents (I DA(GIRK) ) with an IC 50 of 7.0 μM. Tipepidine hydrochloride subsequently activates VTA dopamine neuron [1]. Tipepidine hydrochloride, a non-narcotic antitussive, exerts an antidepressant-like effect [2]. Uses: Scientific research. Group: Signaling pathways. CAS No. 1449686-84-3. Pack Sizes: 10 mM * 1 mL; 5 mg; 10 mg; 50 mg; 100 mg. Product ID: HY-121685A. MedChemExpress MCE
Tiphenylphosphine-3,3',3''-trisulfonic acid trisodium salt Tiphenylphosphine-3,3',3''-trisulfonic acid trisodium salt. Group: Biochemicals. Grades: Highly Purified. CAS No. 63995-70-0. Pack Sizes: 50mg, 100mg, 250mg, 500mg, 1g. Molecular Formula: C18H12Na3O9PS3. US Biological Life Sciences. USBiological 8
Worldwide
Tipifarnib A farnesyltransferase inhibitor. Sensitizes human multiple myeloma cell to proteasome inhibition by blocking degradation of bortezomib-induced aggresomes. Also shown to inhibit the growth of myeloid leukemia cell lines and primary leukemia cells by inducing apoptosis and cell-cycle blockage when combined with rapamycin(R124000). Group: Biochemicals. Alternative Names: 6-[(R)-Amino(4-chlorophenyl)(1-methyl-1H-imidazol-5-yl)methyl]-4-(3-chlorophenyl)-1-methyl-2(1H)-quinolinone; (R)-(+)-R 115777; Zarnestra. Grades: Highly Purified. CAS No. 192185-72-1. Pack Sizes: 2.5mg. US Biological Life Sciences. USBiological 3
Worldwide
Tipifarnib Tipifarnib (IND 58359) binds to and inhibits farnesyltransferase (FTase) with an IC 50 of 0.86 nM. Antineoplastic activity and antiparasitic activity [1]. Uses: Scientific research. Group: Signaling pathways. Alternative Names: IND 58359; R115777. CAS No. 192185-72-1. Pack Sizes: 10 mM * 1 mL; 5 mg; 10 mg; 25 mg; 50 mg; 100 mg. Product ID: HY-10502. MedChemExpress MCE
Tipifarnib Tipifarnib is a nonpeptidomimetic quinolinone with potential antineoplastic activity. Tipifarnib binds to and inhibits the enzyme farnesyl protein transferase, an enzyme involved in protein processing (farnesylation) for signal transduction. By inhibiting the farnesylation of proteins, this agent prevents the activation of Ras oncogenes, inhibits cell growth, induces apoptosis, and inhibits angiogenesis. Uses: Antineoplastic agents. Synonyms: R115777; R 115777; R-115777; LX81; NSC702818; D03720; Tipifarnib; trade name Zarnestra. Grades: 0.97. CAS No. 192185-72-1. Molecular formula: C27H22Cl2N4O. Mole weight: 489.4. BOC Sciences 10
Tipifarnib ?98% (HPLC). Group: Fluorescence/luminescence spectroscopyenzyme activators, inhibitors & substrates. Alfa Chemistry Analytical Products
Tipifarnib S enantiomer Tipifarnib S enantiomer is the S enantiomer of Tipifarnib. Tipifarnib, also called as Zarnestra or R115777, is a farnesyltransferase inhibitor (IC50= 0.6 nM) with antitumor activity. Synonyms: 6-[(S)-amino-(4-chlorophenyl)-(3-methylimidazol-4-yl)methyl]-4-(3-chlorophenyl)-1-methylquinolin-2-one Tipifarnib (S enantiomer) CHEMBL243659 tipifarnib zarnestra (S)-TIPIFARNIB tipifarnib(r115777) SCHEMBL4429738 (r)-(+)-r 115777 FT-0675247 tipifarnib(zar. CAS No. 192185-71-0. Molecular formula: C27H22Cl2N4O. Mole weight: 489.40. BOC Sciences 10
Tipiracil Tipiracil is a thymidine phosphorylase ( TPase ) inhibitor. Uses: Scientific research. Group: Signaling pathways. CAS No. 183204-74-2. Pack Sizes: 5 mg; 10 mg; 25 mg; 50 mg; 100 mg; 200 mg. Product ID: HY-A0063A. MedChemExpress MCE
Tipiracil Tipiracil, a thymidine phosphorylase (TPase) inhibitor, has been found to be a potential drug candidate for metastatic colorectal cancer. Synonyms: TAS-102; TAS102. CAS No. 183204-74-2. Molecular formula: C9H11ClN4O2. Mole weight: 242.67. BOC Sciences 7
Tipiracil HCl Tipiralacil, also known as TPI, is a thymidine phosphorylase inhibitor (TPI). Tipiracil is one of the active components in TAS-102, which is an anticancer drug candidate currently in clinical trials. TAS-102 consists of the cytotoxin Trifluridine and the thymidine phosphorylase inhibitor (TPI) tipiracil. Trifluridine is incorporated into DNA during DNA synthesis and inhibits tumor cell growth. Tipiracil protects trifluridine from being broken down when taken orally. Synonyms: Tipiracil, TPI. Grades: 0.99. CAS No. 183204-72-0. Molecular formula: C9H12Cl2N4O2. Mole weight: 279.121. BOC Sciences 8
Tipiracil hydrochloride ?98% (HPLC). Group: Fluorescence/luminescence spectroscopy. Alfa Chemistry Analytical Products 2
Tipiracil hydrochloride Tipiracil (hydrochloride) is a thymidine phosphorylase inhibitor (TPI), used for cancer research. Uses: Scientific research. Group: Signaling pathways. CAS No. 183204-72-0. Pack Sizes: 10 mM * 1 mL; 5 mg; 10 mg; 25 mg; 50 mg; 100 mg; 200 mg. Product ID: HY-A0063. MedChemExpress MCE
Tipiracil Impurity 1 One of the impurities of Tipiracil, which is a thymidine phosphorylase (TPase) inhibitor and has been found to be a potential drug candidate for metastatic colorectal cancer. Molecular formula: C9H10ClN3O3. Mole weight: 243.65. BOC Sciences 7
Tipiracil Impurity 2 One of the impurities of Tipiracil, which is a thymidine phosphorylase (TPase) inhibitor and has been found to be a potential drug candidate for metastatic colorectal cancer. Molecular formula: C6H7ClN2O3. Mole weight: 190.59. BOC Sciences 7
Tipiracil Impurity 3 An impurity of Trifluridine. Trifluridine is a nucleoside analogue antiviral and nucleoside metabolic inhibitor used for the treatment of primary keratoconjunctivitis and recurrent epithelial keratitis due to HERPES SIMPLEX virus. Synonyms: Trifluridine Impurity 5; Methyl 5-chloro-2,6-dihydroxy-4-pyrimidinecarboxylate; Methyl 5-chloro-2,6-dihydroxypyrimidine-4-carboxylate; CD-0006; AK162189. CAS No. 91447-90-4. Molecular formula: C6H5ClN2O4. Mole weight: 204.57. BOC Sciences 7
Tiplaxtinin ?98% (HPLC). Group: Fluorescence/luminescence spectroscopy. Alfa Chemistry Analytical Products
Tiplaxtinin Tiplaxtinin is a novel plasminogen activator inhibitor-1 (PAI-1) inhibitor. It is an orally active prothrombolytic drug that inhibits PAI-1 and accelerates fibrinolysis while maintaining normal coagulation in a model of coronary occlusion. It exerts antithrombotic efficacy in rat models of arterial and venous vascular injury without effecting platelet aggregation. Synonyms: Tiplaxtinin; PAI039; PAI-039; PAI 039. Grades: >98%. CAS No. 393105-53-8. Molecular formula: C24H16F3NO4. Mole weight: 439.38. BOC Sciences 8
Tipranavir Tipranavir, a nonpeptidic HIV protease inhibitor (NPPI), inhibits the enzymatic activity and dimerization of HIV-1 protease, exerts potent activity against multi-PI-resistant HIV-1 isolates. Synonyms: PNU-140690; PNU 140690; PNU140690; Aptivus; N-[3-[(1R)-1-[(6R)-5,6-Dihydro-4-hydroxy-2-oxo-6-(2-phenylethyl)-6-propyl-2H-pyran-3-yl]propyl]phenyl]-5-(trifluoromethyl)-2-pyridinesulfonamide; 2-Pyridinesulfonamide, N-[3-[(1R)-1-[(6R)-5,6-dihydro-4-hydroxy-2-oxo-6-(2-phenylethyl)-6-propyl-2H-pyran-3-yl]propyl]phenyl]-5-(trifluoromethyl)-; 2-Pyridinesulfonamide, N-[3-[1-[5,6-dihydro-4-hydroxy-2-oxo-6-(2-phenylethyl)-6-propyl-2H-pyran-3-yl]propyl]phenyl]-5-(trifluoromethyl)-, [R-(R*,R*)]-; TPV; U 140690. Grades: ≥95%. CAS No. 174484-41-4. Molecular formula: C31H33F3N2O5S. Mole weight: 602.67. BOC Sciences 7
Tipranavir Storage and Stability. Group: Biochemicals. Alternative Names: N-[3-[(1R)-1-[(6R)-5,6-Dihydro-4-hydroxy-2-oxo-6-(2-phenylethyl)-6-propyl-2H-pyran-3-yl]propyl]phenyl]-5-(trifluoromethyl)-2-pyridinesulfonamide; PNU-140690; Aptivus. Grades: Highly Purified. CAS No. 174484-41-4. Pack Sizes: 1mg, 2mg, 5mg, 10mg, 25mg. US Biological Life Sciences. USBiological 8
Worldwide
Tipranavir Tipranavir (PNU-140690) inhibits the enzymatic activity and dimerization of HIV-1 protease, exerts potent activity against multi-protease inhibitor (PI)-resistant HIV-1 isolates with IC50s of 66-410 nM. Tipranavir inhibits SARS-CoV-2 3CLpro activity. Uses: Designed for use in research and industrial production. Additional or Alternative Names: PNU-140690;Aptivus;N-[3-[(1R)-1-[(6R)-5,6-Dihydro-4-hydroxy-2-oxo-6-(2-phenylethyl)-6-propyl-2H-pyran-3-yl]propyl]phenyl]-5-(trifluoromethyl)-2-pyridinesulfonamide;N-[3-[(1R)-1-[(6R)-2-Hydroxy-4-oxo-6-phenethyl-6-propyl-5H-pyran-3-yl]propyl]phenyl]-5-(trifluoromethyl)pyridine-2-sulfonamide;Tipranavir;Tipranavir(PNU-140690,Aptivus);2-PyridinesulfonaMide,N-[3-[(1R)-1-[(6R)-5,6-dihydro-4-hydroxy-2-oxo-6-(2-phenylethyl)-6-propyl-2H-pyran-3-yl]propyl]phenyl]-5-(trifluoroMethyl)-. Product Category: Inhibitors. Appearance: Solid. CAS No. 174484-41-4. Molecular formula: C31H33F3N2O5S. Mole weight: 602.66. Purity: 0.9808. Canonical SMILES: O=C1C([C@H](CC)C2=CC=CC(NS(C3=CC=C(C(F)(F)F)C=N3)(=O)=O)=C2)=C(O)C[C@](CCC4=CC=CC=C4)(CCC)O1. Product ID: ACM174484414. Alfa Chemistry — ISO 9001:2015 Certified. Alfa Chemistry.
Tipranavir Tipranavir (PNU-140690) inhibits the enzymatic activity and dimerization of HIV-1 protease , exerts potent activity against multi-protease inhibitor (PI)-resistant HIV-1 isolates with IC 50 s of 66-410 nM [1] [2]. Tipranavir inhibits SARS-CoV-2 3CL pro activity [3]. Uses: Scientific research. Group: Signaling pathways. Alternative Names: PNU-140690. CAS No. 174484-41-4. Pack Sizes: 10 mM * 1 mL; 1 mg; 5 mg; 10 mg. Product ID: HY-15148. MedChemExpress MCE
Tipranavir-d4 (N-[3-[(1R)-1-[(6R)-5,6-Dihydro-4-hydroxy-2-oxo-6-(2-phenylethyl)-6-propyl-2H-pyran-3-yl]propyl]phenyl]-5-(trifluoromethyl)-2-pyridinesulfonamide-d4,. PNU-140690-d4, Aptivus-d4,. ) Nonpeptidic HIV protease inhibitor (NPPI). Antiviral. Group: Biochemicals. Alternative Names: N-[3-[(1R)-1-[(6R)-5,6-Dihydro-4-hydroxy-2-oxo-6-(2-phenylethyl)-6-propyl-2H-pyran-3-yl]propyl]phenyl]-5-(trifluoromethyl)-2-pyridinesulfonamide-d4; PNU-140690-d4; Aptivus-d4. Grades: Highly Purified. Pack Sizes: 1mg. US Biological Life Sciences. USBiological 1
Worldwide
Tipranavir disodium salt Tipranavir disodium salt is the sodium salt form of Tipranavir. Tipranavir is a nonpeptidic protease inhibitor that can inhibit the HIV ptotease. Uses: Anti-hiv agents. Synonyms: Tipranavir disodium; disodium (2R)-4-oxo-2-(2-phenylethyl)-2-propyl-5-[(1R)-1-[3-[5-(trifluoromethyl)pyridin-2-yl]sulfonylazanidylphenyl]propyl]-3H-pyran-6-olate. CAS No. 191150-83-1. Molecular formula: C31H31F3N2Na2O5S. Mole weight: 646.633. BOC Sciences 7
Tipranavir. (N-[3-[(1R)-1-[(6R)-5,6-Dihydro-4-hydroxy-2-oxo-6-(2-phenylethyl)-6-propyl-2H-pyran-3-yl]propyl]phenyl]-5-(trifluoromethyl)-2-pyridinesulfonamide,. PNU-140690, Aptivus,. ) Nonpeptidic HIV protease inhibitor (NPPI). Antiviral. Group: Biochemicals. Alternative Names: N-[3-[(1R)-1-[(6R)-5,6-Dihydro-4-hydroxy-2-oxo-6-(2-phenylethyl)-6-propyl-2H-pyran-3-yl]propyl]phenyl]-5-(trifluoromethyl)-2-pyridinesulfonamide; PNU-140690; Aptivus. Grades: Highly Purified. CAS No. 174484-41-4. Pack Sizes: 1mg. US Biological Life Sciences. USBiological 1
Worldwide
Tipranovir b-D-glucuronide Tipranovir b-D-glucuronide is a metabolite of the anti-HIV drug Tipranavir. It is a glucuronide conjugate that is formed in the liver and excreted in bile. This metabolite has no known pharmacological activity but can be used as a biomarker to monitor Tipranavir therapy. CAS No. 947408-14-2. Molecular formula: C37H41F3N2O11S. Mole weight: 778.79. BOC Sciences 11
Tiprolisant Tiprolisant is potent and selective nonimidazole inverse agonist at the histamine H3 receptor. (Ki=0.16 nM). Uses: The histamine h3 receptor. Synonyms: Pitolisant; 1-[3-[3- (4-chlorophenyl) propoxy]propyl]piperidine. Grades: ≥95%. CAS No. 362665-56-3. Molecular formula: C17H26ClNO. Mole weight: 295.85. BOC Sciences 10
Tiq-a TIQ-A is a potent TNKS (poly-ART, PARP) inhibitor, with an IC50 of 24 nM for TNKS2. TIQ-A is a potential anti-ischemic agent. Uses: Designed for use in research and industrial production. Additional or Alternative Names: TIQ-A, 4H-Thieno[2,3-c]isoquinolin-5-one, PARP Inhibitor X, TIQ-A, Thieno[2,3-c]isoquinolin-5-one, 420849-22-5, SureCN422013, T2825_SIGMA, CTK1C8658, ZINC00003266, AG-F-49683, Thieno[2,3-c]isoquinolin-5(4H)-one, NCGC00165904-01, FT-0675250, G18. Product Category: Inhibitors. CAS No. 420849-22-5. Molecular formula: C11H7NOS. Mole weight: 201.24. Purity: ≥98%. IUPACName: 4H-thieno[2,3-c]isoquinolin-5-one. Canonical SMILES: C1=CC=C2C(=C1)C3=C(NC2=O)SC=C3. Density: 1.359g/cm³. Product ID: ACM420849225. Alfa Chemistry — ISO 9001:2015 Certified. Categories: TiQal. Alfa Chemistry.
TIQ-A TIQ-A is a PARP1 inhibitor with IC50 value of 450 nM. It exhibits neuroprotective effects in cultured mouse cortical neurons injured by oxygen-glucose deprivation (IC50 = 0.15 μM). Uses: Poly(adp-ribose) polymerase inhibitors. Synonyms: 4H-Thieno[2,3-c]isoquinolin-5-one; Thieno[2,3-c]isoquinolin-5(4H)-one; 4H,5H-thieno[2,3-c]isoquinolin-5-one. Grades: ≥98%. CAS No. 420849-22-5. Molecular formula: C11H7NOS. Mole weight: 201.2. BOC Sciences 10
TIQ-A TIQ-A. Group: Biochemicals. Alternative Names: Thieno[2,3-C]isoquinolin-5-one. Grades: Highly Purified. CAS No. 420849-22-5. Pack Sizes: 2mg, 5mg, 10mg, 25mg, 50mg. Molecular Formula: C11H7NOS. US Biological Life Sciences. USBiological 8
Worldwide
TIQ-A ?98% (HPLC), solid. Group: Fluorescence/luminescence spectroscopy. Alfa Chemistry Analytical Products
TIQ-A (Thieno[2,3-C]isoquinolin-5-one) TIQ-A (Thieno[2,3-C]isoquinolin-5-one). Group: Biochemicals. Alternative Names: Thieno[2,3-C]isoquinolin-5-one. Grades: Highly Purified. Pack Sizes: 5mg. US Biological Life Sciences. USBiological 1
Worldwide
Tiquizium Bromide Tiquizium Bromide is a antimuscarinic agent that was used on airway smooth muscle in vitro and in patients with chronic obstructive pulmonary disease. Group: Biochemicals. Alternative Names: HS 902; HSR 902; Thiaton; (5R, 9aR) -rel-3- (Di-2-thienylmethylene) octahydro-5-methyl-2H-quinolizinium Bromide; trans-3- (Di-2-thienylmethylene) octahydro-5-methyl-2H-quinolizinium Bromide. Grades: Highly Purified. CAS No. 71731-58-3. Pack Sizes: 100mg. US Biological Life Sciences. USBiological 4
Worldwide
Tirabrutinib Tirabrutinib (ONO-4059) is an orally active Brutons Tyrosine Kinase ( BTK ) inhibitor (can cross the blood-brain barrier (BBB)), with an IC 50 of 6.8 nM. Tirabrutinib irreversibly and covalently binds to BTK and inhibits aberrant B cell receptor signaling. Tirabrutinib can be used in studies of autoimmune diseases and hematological malignancies [1] [2] [3] [4]. Uses: Scientific research. Group: Signaling pathways. Alternative Names: ONO-4059; GS-4059. CAS No. 1351636-18-4. Pack Sizes: 10 mM * 1 mL; 5 mg; 10 mg; 25 mg; 50 mg; 100 mg. Product ID: HY-15771. MedChemExpress MCE
Tirabrutinib hydrochloride Tirabrutinib (ONO-4059) hydrochloride is an orally active Brutons Tyrosine Kinase ( BTK ) inhibitor (can cross the blood-brain barrier (BBB)), with an IC 50 of 6.8 nM. Tirabrutinib hydrochloride irreversibly and covalently binds to BTK and inhibits aberrant B cell receptor signaling. Tirabrutinib hydrochloride can be used in studies of autoimmune diseases and hematological malignancies [1] [2] [3] [4]. Uses: Scientific research. Group: Signaling pathways. Alternative Names: ONO-4059 hydrochloride; GS-4059 hydrochloride. CAS No. 1439901-97-9. Pack Sizes: 10 mM * 1 mL; 5 mg; 10 mg; 25 mg; 50 mg; 100 mg. Product ID: HY-15771A. MedChemExpress MCE
Tiragolumab Tiragolumab is an immune checkpoint inhibitor binding to T-cell immunoglobulin and ITIM domain ( TIGIT ). Tiragolumab, alone or in combination with the PD-L1 inhibitor Atezolizumab (HY-P9904), may be effective against multiple solid malignancies-most notably non-small cell lung cancer (NSCLC) [1] [2]. Uses: Scientific research. Group: Inhibitory antibodies. Alternative Names: MTIG-7192A; RG-6058. CAS No. 1918185-84-8. Pack Sizes: 1 mg; 5 mg; 10 mg. Product ID: HY-P9986. MedChemExpress MCE
Tiragolumab Tiragolumab is a humanized monoclonal antibody and immune checkpoint inhibitor that selectively binds to TIGIT, which suppresses the immune response to cancer. Synonyms: anti-TIGIT; RG6058; MTIG7192A. CAS No. 1918185-84-8. BOC Sciences 11
Tirandamycin A Tirandamycin A is originally isolated from Str. tirandis var. tirandis NRRL 3689, and it has anti-gram-positive bacteria effect. Synonyms: NSC 107067; 3-Pyrrolin-2-one, 4-hydroxy-3-(4-methyl-6-(1,2,7-trimethyl-5-oxo-3,9,10-trioxatricyclo(4.3.1.0(sup 2,4))dec-8-yl)-2,4-heptadienoyl)-, (E,E)-. Grades: 95% by HPLC. CAS No. 34429-70-4. Molecular formula: C22H27NO7. Mole weight: 417.45. BOC Sciences 6
Tirapazamine Tirapazamine (SR259075) is an anticancer agent that shows selective cytotoxicity for hypoxic cells in solid tumors, thereby inducing single-and double-strand breaks in DNA, base damage, and cell death. Tirapazamine is an anticancer and bioreductive agent.Tirapazamine (SR259075) can enhance the cytotoxic effects of ionizing radiation in hypoxic cells [1] [2]. Uses: Scientific research. Group: Signaling pathways. Alternative Names: SR259075; SR4233; Win59075; SML 0552; SR 259075; Tirazone. CAS No. 27314-97-2. Pack Sizes: 10 mM * 1 mL; 50 mg; 100 mg; 200 mg. Product ID: HY-13767. MedChemExpress MCE
Tirapazamine ?98% (HPLC). Group: Fluorescence/luminescence spectroscopy. Alfa Chemistry Analytical Products
Tirapazamine Tirapazamine is a benzotriazine di-N-oxide with potential antineoplastic activity. Tirapazamine is selectively activated by multiple reductases to form free radicals in hypoxic cells, thereby inducing single-and double-strand breaks in DNA, base damage, and cell death. This agent also sensitizes hypoxic cells to ionizing radiation and inhibits the repair of radiation-induced DNA strand breaks via inhibition of topoisomerase II. Check for active clinical trials or closed clinical trials using this agent. Synonyms: US brand name: Tirazone. Code names: SR 4233. WIN 59075. SR-259075, NSC-130181, Win-59075, SR-4233. Grades: 0.98. CAS No. 27314-97-2. Molecular formula: C7H6N4O2. Mole weight: 178.15. BOC Sciences 8
Tirasemtiv Tirasemtiv is a a small-molecule fast-skeletal-troponin activator, which is being developed as a potential treatment for diseases and conditions associated with aging, muscle weakness and wasting or neuromuscular dysfunction. Synonyms: CK2017357; CK-2017357; CK 2017357; Tirasemtiv. Grades: >98%. CAS No. 1005491-05-3. Molecular formula: C12H14N4O. Mole weight: 230.27. BOC Sciences 9
Tirasemtiv Tirasemtiv is an activator of the fast skeletal muscle troponin complex. Tirasemtiv is a click chemistry reagent, it contains an Alkyne group and can undergo copper-catalyzed azide-alkyne cycloaddition (CuAAc) with molecules containing Azide groups. Uses: Scientific research. Group: Signaling pathways. Alternative Names: CK-2017357. CAS No. 1005491-05-3. Pack Sizes: 10 mM * 1 mL; 5 mg; 10 mg; 25 mg; 50 mg; 100 mg. Product ID: HY-15964. MedChemExpress MCE
Tiratricol Tiratricol is an orally available thyroid hormone analog that inhibits pituitary thyroid-stimulating hormone secretion. Tiratricol is an intracellular toxin neutralizer that inhibits LPS and lipid A cytotoxicity with IC 50 s of 20 μM and 32 μM, respectively. Tiratricol reduces TNF production in lipopolysaccharide-stimulated macrophages. Tiratricol also has antiviral activity and is an inhibitor of yellow fever virus (Flavivirus). It can bind to the RdRp domain of the viral NS5 protein to hinder YFV replication. [2]. Uses: Scientific research. Group: Signaling pathways. Alternative Names: 3,3',5-Triiodothyroacetic acid. CAS No. 51-24-1. Pack Sizes: 10 mM * 1 mL; 50 mg; 100 mg. Product ID: HY-B1201. MedChemExpress MCE

Would you like to list your products on USA Chemical Suppliers?

Our database is helping our users find suppliers everyday.

Add Your Products