A directory of where to buy chemicals in the USA, including: distributors, industrial manufacturers, bulk supplies and wholesalers of raw ingredients & finished goods.
Tin Telluride (SnTe). Group: Magnetic nanoparticles. Alternative Names: Tin Telluride Powder, SnTe Powder, tin telluride; tin(II) telluride; stannous telluride. 99.999%.
Tin Telluride (SnTe) Sputtering Targets
Tin Telluride (SnTe) Sputtering Targets. Group: Sputtering targets. Alternative Names: Tin Telluride (SnTe) Sputtering Targets, SnTe Sputtering Target, SnTe Sputter Target, SnTe Target, Tin Telluride Sputtering Target, Tin Telluride Sputter Target, Tin Telluride Target. 99.9%-99.99%.
Tin tetrachloride
Tin tetrachloride. CAS No: 7646-78-8
Sarchem Laboratories New Jersey NJ
Tinurilimab
Tinurilimab is a humanized anti-CEACAM6 monoclonal antibody that binds to and blocks the activity of CEACAM6 expressed on various tumor and immune cells, including T cells. Synonyms: BAY 1834942; BAY-1834942; BAY1834942. CAS No. 2226224-30-0.
Tinurilimab
Tinurilimab (Bay 1834942) is an anti-CEACAM6 (carcinoembryonic antigen-related cell adhesion molecule 6) humanized IgG2 monoclonal antibody. CEACAM6 is an immune checkpoint regulator suppressing the activity of effector T-cells against tumors. Tinurilimab shows an increased tumor cell killing effect in the tumor-cell/T-cell co-culture system[1]. Uses: Scientific research. Group: Inhibitory antibodies. Alternative Names: BAY 1834942. CAS No. 2226224-30-0. Pack Sizes: 1 mg; 5 mg; 10 mg; 25 mg; 50 mg. Product ID: HY-P99051.
Tinuvin 571. Uses: Designed for use in research and industrial production. Additional or Alternative Names: 2-(2H-benzotriazo-2-yl)-6-dodecyl-4-methyl-Phennol. Appearance: clear viscous yellow liquid. CAS No. 23328-53-2. Molecular formula: C25H35N3O. Mole weight: 394. Purity: 0.95. IUPACName: 2-(benzotriazol-2-yl)-6-dodecyl-4-methylphenol. Canonical SMILES: CCCCCCCCCCCCC1=C(C(=CC(=C1)C)N2N=C3C=CC=CC3=N2)O. Density: 1.07. ECNumber: 603-051-2. Product ID: ACM23328532. Alfa Chemistry ISO 9001:2015 Certified.
Tinyatoxin
Tinyatoxin is a neurotoxin, acting via vanilloid receptors of sensory nerves. Synonyms: Tinyatoxin; Daphnetoxin, 6,7-deepoxy-6,7-didehydro-5-deoxy-21-dephenyl-21-(phenylmethyl)-, 20-(4-hydroxybenzeneacetate); [2-benzyl-6a-hydroxy-8,10-dimethyl-7-oxo-11a-(prop-1-en-2-yl)-3a,6,6a,7,9a,10,11,11a-octahydro-3bH-2,9b-epoxyazuleno[4',5':5,6]benzo[1,2-d][1,3]dioxol-5-yl]methyl (4-hydroxyphenyl)acetate; [(3aR,3bS,6aR,9aR,9bR,10R,11aR)-2-benzyl-6a-hydroxy-8,10-dimethyl-7-oxo-11a-(prop-1-en-2-yl)-3a,6,6a,7,9a,10,11,11a-octahydro-3bH-2,9b-epoxyazuleno[4',5':5,6]benzo[1,2-d][1,3]dioxol-5-yl]methyl (4-hydroxyphenyl)acetate. CAS No. 58821-95-7. Molecular formula: C36H38O8. Mole weight: 598.68.
Tin Zinc (Sn-Zn) Alloy Sputtering Targets
Tin Zinc (Sn-Zn) Alloy Sputtering Targets. Group: Sputtering targets. Alternative Names: Tin Zinc (Sn-Zn) Alloy Sputtering Targets, Sn-Zn Alloy Sputtering Target, Sn-Zn Alloy Sputter Target, Sn-Zn Alloy Target, Tin Zinc Alloy Sputtering Target, Tin Zinc Alloy Sputter Target, Tin Zinc Alloy Target. 99.9%-99.999%.
TiO2
TiO2. Group: Oxides nanoparticles. 99%.
TiO2 103-80G
TiO2 103-80G. Group: Polymers.
TiO2 coated Upconverting Nanoparticles(UV light)
TiO2 coated Upconverting Nanoparticles(UV light). Uses: Up conversion nanoparticles have excellent optical stability. they have been widely applied in biomedicine, including in vivo bioimaging, in vivo bioimaging, biodetection, immunohistochemistry, microarray detection, photodynamic therapy, and photoactivated drug activation. Group: Tio2 coated upconverting nanoparticles. Pack Sizes: 10 mg/20 mg/50 mg.
TiO2/graphene nanocomposite
TiO2/graphene composite is highly crystalline graphene sheets hybridized with titanium oxide nanocrystals. The graphene sheets act as substrate and thickness is about 1~10 nm. The attached particle size of TiO2 is between 10-40 nm, and the loading density is in the range of 30%-70%. X-ray diffraction pattern confirms that the graphene sheets are well crystallized and the attached particles are TiO2. Uses: Photocatalyst dye sensitized solar cells. Group: Carbon nano materials.
TiO2/graphene nanocomposite
10 mg/mL, dispersion (in acetone). Group: Carbon nanomaterials.
Tioclomarol. Uses: Designed for use in research and industrial production. Additional or Alternative Names: 3-[3-(4-Chlorophenyl)-1-(5-chloro-2-thienyl)-3-hydroxypropyl]-4-hydroxy-2H-1-benzopyran-2-one; Apegmone; 3-[5-Chloro-α-(p-chloro-β-hydroxyphenethyl)-2-thenyl]-4-hydroxy-coumarin. Product Category: Heterocyclic Organic Compound. CAS No. 22619-35-8. Molecular formula: C22H16Cl2O4S. Mole weight: 447.336. Product ID: ACM22619358. Alfa Chemistry ISO 9001:2015 Certified.
Tioconazole
Tioconazole (UK-20349) is a broad-spectrum antifungal imidazole derivative. Tioconazole inhibits several dermatophytes and yeasts, with MIC 50 values of less than 3.12 mg/L and 9 mg/L, respectively. Additionally, Tioconazole exhibits anti-parasitic activity. Tioconazole exerts anticancer activity by inhibiting the PI3K/AKT/mTOR signaling pathway and blocking autophagy. Tioconazole is applicable for research in the fields of anti-infection and anticancer therapy [1] [2] [3] [4] [5]. Uses: Scientific research. Group: Signaling pathways. Alternative Names: UK-20349. CAS No. 65899-73-2. Pack Sizes: 10 mM * 1 mL; 500 mg; 5 g; 10 g. Product ID: HY-B0319.
Tioconazole
United States Pharmacopeia (USP) Reference Standard. Group: Pharmacopeia & metrological institutes standardsapi standardsbritish pharmacopoeiapharmaceutical toxicologypharmacopoeial standards. Alternative Names: Tioconazole, 1-[(2RS)-2-[(2-Chlorothiophen-3-yl)methoxy]-2-(2,4-dichlorophenyl)ethyl]-1H-imidazole.
Tioconazole
Tioconazole is an antifungal medication of the imidazole class used to treat infections caused by a fungus or yeast, with an average IC50 of 1.7 μM. Synonyms: UK20,349; UK-20,349; UK 20,349; STS 557; STS557; STS-557. Grades: >98%. CAS No. 65899-73-2. Molecular formula: C16H13Cl3N2OS. Mole weight: 387.71.
Tioconazole
1-[2-[(2-Chloro-3-thienyl)methoxy]-2-(2,4-dichlorophenyl) ethyl]-1H-imidazole 1-[2,4-Dichloro-b-[(2-chloro-3-thienyl)-oxy]phenethyl] imidazole. CAS No. 65899-73-2. Product ID: 8-04578. Molecular formula: C16H13Cl3N2OS. Mole weight: 387.71. Properties: White or off-white crystalline powder.
Tioconazole Related Compound A
United States Pharmacopeia (USP) Reference Standard. Group: Pharmacopeia & metrological institutes standards.
Tioconazole Related Compound A
One impurity of Tioconazole, which could be used as an antifungal agent and exhibit activities against Candida glabrata mutant strains. Synonyms: 2-Deschlorothien-3-yl Tioconazole Hydrochloride; 1-[2-(2,4-Dichlorophenyl)-2-(3-thienylmethoxy)ethyl]-1H-imidazole Monohydrochloride. CAS No. 61709-33-9. Molecular formula: C16H14Cl2N2OS. HCl. Mole weight: 389.73.
Tioconazole Related Compound B
One impurity of Tioconazole, which could be used as an antifungal agent and exhibit activities against Candida glabrata mutant strains. Synonyms: 2,5-Dichlorothiophen-3-yl Tioconazole Hydrochloride; 1-(2-(2,4-Dichlorophenyl)-2-((2,5-dichlorothiophen-3-yl)methoxy)ethyl)-1H-imidazole Hydrochloride. CAS No. 61675-62-5. Molecular formula: C16H12Cl4N2OS HCl. Mole weight: 460.63.
Tioconazole Related Compound B
United States Pharmacopeia (USP) Reference Standard. Group: Pharmacopeia & metrological institutes standards.
Tioconazole Related Compound C
One impurity of Tioconazole, which could be used as an antifungal agent and exhibit activities against Candida glabrata mutant strains. Synonyms: 5-Bromo-2-chlorothien-3-yl Tioconazole Hydrochloride; 5-Bromo-2-chloro-3-thenyl)-oxy]-phenethyl]imidazole Hydrochlorid. Molecular formula: C16H12BrCl3N2OS HCl. Mole weight: 503.07.
TiOPC
TiOPC. Uses: Designed for use in research and industrial production. Additional or Alternative Names: Titanium oxide phthalocyanine. Product Category: Organic Light Emitting Diode (OLED). Appearance: Blue powder. CAS No. 26201-32-1. Molecular formula: C32H16N8OTi. Mole weight: 576.39 g/mol. Purity: 95%+. Product ID: ACM26201321. Alfa Chemistry ISO 9001:2015 Certified. Categories: Tiocfaidh ár lá.
Tiopronin
It is used as antidote against heavy metal poisoning; hepatoprotectant; mucolytic. Group: Biochemicals. Alternative Names: N-(2-Mercapto-1-oxopropyl)glycine. Grades: Highly Purified. CAS No. 1953-2-2. Pack Sizes: 1g. US Biological Life Sciences.
Worldwide
Tiopronin
Tiopronin is a diffusible antioxidant, an antidote to heavy metal poisoning and a radioprotective agent. Tiopronin can control the rate of cystine precipitation and excretion and has the potential for cystinuria, rheumatoid arthritis and hepatic disorders [1] [2]. Uses: Scientific research. Group: Natural products. CAS No. 1953-2-2. Pack Sizes: 10 mM * 1 mL; 500 mg; 1 g. Product ID: HY-B0373.
Tiopronin-cysteine disulfide
Tiopronin-cysteine disulfide is a disulfide formed by Tiopronin (HY-B0373) and cysteine [1]. Uses: Scientific research. Group: Signaling pathways. CAS No. 77591-18-5. Pack Sizes: 1 mg. Product ID: HY-131516.
Tiopronin Dimer Disodium Salt (Mixture of Diastereoisomers)
Tiopronin Dimer Disodium Salt (Mixture of Diastereoisomers) is an impurity of Tiopronin, which is used as an antidote against heavy metal poisoning. CAS No. 21269-37-4. Molecular formula: C10H14N2O6S2.2Na. Mole weight: 368.34.
Tiopronin Disulfide
Tiopronin Disulfide is used in the treatment of mitochondrial dysfunction and postischemic myocardial damage. Tiopronin Disulfide partly prevents and reverses mitochondrial uncoupling and improves deteriorated heart function. Group: Biochemicals. Grades: Highly Purified. CAS No. 21269-37-4. Pack Sizes: 250mg, 2.5g. Molecular Formula: C10H16N2O6S2. US Biological Life Sciences.
Worldwide
Tiopronin Impurity 1
Tiopronin Impurity 1 is an impurity of Tiopronin, which is used as an antidote against heavy metal poisoning. Synonyms: 2-(acetylthio)propanoyl)glycine. Grades: 98%. CAS No. 6182-96-3. Molecular formula: C7H11NO4S. Mole weight: 205.23.
Tiopronin Sulfinic Acid
Tiopronin Sulfone
One of the impurities of Tiopronin, which could be used as an antidote in poisoning caused by heavy metals. Molecular formula: C5H9NO5S. Mole weight: 195.20.
Tiopronin Sulfoxide
One of the impurities of Tiopronin, which could be used as an antidote in poisoning caused by heavy metals. Molecular formula: C5H9NO4S. Mole weight: 179.20.
Tiospirone Hydrochloride
Tiospirone is an atypical antipsychotic agent. Tiospirone is used in the treatment of schizophrenia. Tiospirone acts as a 5-HT1A receptor partial agonist, 5-HT2A, 5-HT2C, and 5-HT7 receptor inverse agonist, and D2, D4, and α1-adrenergic receptor antagonist. Group: Biochemicals. Alternative Names: 8-[4-[4-(1,2-Benzisothiazol-3-yl)-1-piperazinyl]butyl]-8-azaspiro[4.5]decane-7,9-dione Hydrochloride; BMY 13859; BMY 13859-1; MJ 13859-1; Tiaspirone Hydrochloride. Grades: Highly Purified. CAS No. 87691-92-7. Pack Sizes: 10mg. US Biological Life Sciences.
Worldwide
Tiotidine
Tiotidine is a potent histamine H2 receptor antagonist with negligible activity against H1- and H3- receptors. Synonyms: 1-cyano-3-[2-[[2-(diaminomethylideneamino)-1,3-thiazol-4-yl]methylsulfanyl]ethyl]-2-methylguanidine. Grades: ≥99% by HPLC. CAS No. 69014-14-8. Molecular formula: C10H16N8S2. Mole weight: 312.41.
Tiotropium Bromide
Muscarinic receptor antagonist. Bronchodilator. Group: Biochemicals. Alternative Names: (1α,2 β,4 β,5α,7 β )-7-[(2-Hydroxy-2, 2-di-2-thienylacetyl)oxy]-9, 9-dimethyl-3-oxa-9-azoniatricyclo[3. 3. 1. 02, 4]nonane Bromide. Grades: Highly Purified. CAS No. 136310-93-5. Pack Sizes: 5mg. US Biological Life Sciences.
Tiotropium Bromide. Uses: Designed for use in research and industrial production. Additional or Alternative Names: (1R,2R,4S,5S,7s)-7-(2-Hydroxy-2,2-di(thiophen-2-yl)acetoxy)-9,9-dimethyl-3-oxa-9-azatricyclo[3.3.1.02,4]nonan-9-ium bromide. Product Category: Thiophenes. Appearance: White Solid. CAS No. 136310-93-5. Molecular formula: C19H22BrNO4S2. Mole weight: 472.41. Purity: 0.99. Product ID: ACM136310935. Alfa Chemistry ISO 9001:2015 Certified.
Tiotropium Bromide
Tiotropium Bromide (BA679 BR) is a muscarinic acetylcholine receptor (mAChR) antagonist that blocks the binding of the acetylcholine ligand and subsequent opening of the ligand-gated ion channel. Uses: Scientific research. Group: Signaling pathways. Alternative Names: BA679 BR. CAS No. 136310-93-5. Pack Sizes: 10 mM * 1 mL; 5 mg; 10 mg; 50 mg; 100 mg; 500 mg. Product ID: HY-17360.
Tiotropium bromide hydrate
Tiotropium Bromide hydrate is a monohydrate of tiotropium bromide (Spiriva; Tiova; BA 679BR; tiopropium) that is an anticholinergic and bronchodilator and a muscarinic receptor antagonist. Synonyms: BA 679BR. Grades: >98%. CAS No. 139404-48-1. Molecular formula: C19H22NO4S2.Br.xH2O. Mole weight: 490.43.
Tiotropium Bromide Hydrate
Tiotropium Bromide Hydrate. Uses: Designed for use in research and industrial production. Additional or Alternative Names: Tiotropium Bromide Monohydrate; Tiotropium Bromide Xhydrate. Product Category: Thiophenes. Appearance: White to Off-White Solid. CAS No. 139404-48-1. Molecular formula: C19H22NO4S2Br·H2O. Mole weight: 490.43. Purity: 95%+. Product ID: ACM139404481. Alfa Chemistry ISO 9001:2015 Certified.
Tiotropium bromide monohydrate
Tiotropium bromide monohydrate. Group: Biochemicals. Grades: Highly Purified. CAS No. 139404-48-1. Pack Sizes: 100mg, 250mg, 500mg, 1g, 2g. Molecular Formula: C19H22NO4S2·H2O·Br. US Biological Life Sciences.
Worldwide
Tiotropium bromide monohydrate
Tiotropium bromide (BA-679 BR) monohydrate is a long-acting muscarinic receptor antagonist [1] [2]. Uses: Scientific research. Group: Signaling pathways. Alternative Names: BA-679 BR monohydrate. CAS No. 411207-31-3. Pack Sizes: 10 mM * 1 mL; 50 mg; 100 mg. Product ID: HY-B0460.
100mg Pack Size. Group: Analytical Reagents, Biochemicals, Building Blocks, Organics. Formula: C19H22BrNO4S2.H2O. CAS No. 139404-48-1. Prepack ID 90025485-100mg. Molecular Weight 490.43. See USA prepack pricing.
Tiotropium-d3 Bromide
Muscarinic receptor antagonist. Bronchodilator. Group: Biochemicals. Alternative Names: (1α,2 β,4 β,5α,7 β )-7-[(2-Hydroxy-2, 2-di-2-thienylacetyl)oxy]-9, 9-dimethyl-3-oxa-9-azoniatricyclo[3. 3. 1. 02, 4]nonane-d3 Bromide. Grades: Highly Purified. CAS No. 1127226-56-5. Pack Sizes: 1mg. US Biological Life Sciences.
Worldwide
Tioxidazole
Tioxidazole. Uses: Designed for use in research and industrial production. Additional or Alternative Names: Tioxidazole, 61570-90-9, Sch-21480, NCGC00160481-01, methyl 6-propoxy-2-benzothiazolylcarbamate, methyl (6-propoxy-1,3-benzothiazol-2-yl)carbamate, (6-Propoxy-benzothiazol-2-yl)-carbamic acid methyl ester, Tioxidazol, Tioxidazolum, Tiox, Tiox (TN), ChemDivAM_000281, Tioxidazole (USAN/INN), ChemDiv1_000106, Tioxidazol [INN-Spanish], Tioxidazolum [INN-Latin], AC1L2HJ1, DSSTox_CID_26178, DSSTox_RID_81409, UNII-NZW046NI85. Product Category: Heterocyclic Organic Compound. CAS No. 61570-90-9. Molecular formula: C12H14N2O3S. Mole weight: 266.316160 [g/mol]. Purity: 0.96. IUPACName: methyl N-(6-propoxy-1,3-benzothiazol-2-yl)carbamate. Canonical SMILES: CCCOC1=CC2=C(C=C1)N=C(S2)NC(=O)OC. Density: 1.313g/cm³. ECNumber: 262-854-2. Product ID: ACM61570909. Alfa Chemistry ISO 9001:2015 Certified.
Tioxolone
Tioxolone is a metalloenzyme carbonic anhydrase I inhibitor with a Ki of 91 nM. Synonyms: 6-Hydroxy-1,3-benzoxathiol-2-one. Grades: >98%. CAS No. 4991-65-5. Molecular formula: C7H4O3S. Mole weight: 168.17.
Tioxolone
Tioxolone is an inhibitor of the metalloenzyme carbonic anhydrase I and has anti-acne activity. Uses: Scientific research. Group: Signaling pathways. CAS No. 4991-65-5. Pack Sizes: 10 mM * 1 mL; 500 mg; 1 g. Product ID: HY-B0483.
Tip-39
Tip-39. Uses: Designed for use in research and industrial production. Additional or Alternative Names: H-SER-LEU-ALA-LEU-ALA-ASP-ASP-ALA-ALA-PHE-ARG-GLU-ARG-ALA-ARG-LEU-LEU-ALA-ALA-LEU-GLU-ARG-ARG-HIS-TRP-LEU-ASN-SER-TYR-MET-HIS-LYS-LEU-LEU-VAL-LEU-ASP-ALA-PRO-OH;SLALADDAAFRERARLLAALERRHWLNSYMHKLLVLDAP;TIP-39;TUBEROINFUNDIBULAR NEUROPEPTIDE;H-SER-LEU-ALA-. Product Category: Heterocyclic Organic Compound. CAS No. 277302-47-3. Molecular formula: C202H325N61O54S. Product ID: ACM277302473. Alfa Chemistry ISO 9001:2015 Certified. Categories: TIP39.
TIP 39, Tuberoinfundibular Neuropeptide
TIP 39, Tuberoinfundibular Neuropeptide is a neuropeptide and parathyroid hormone 2 receptor (PTH2R) agonist. TIP 39 is highly conserved among species. TIP39 from all species activates adenylyl cyclase and elevates intracellular calcium levels through parathyroid hormone 2 receptor (PTH2R)[1]. Uses: Scientific research. Group: Peptides. CAS No. 277302-47-3. Pack Sizes: 1 mg; 5 mg; 10 mg. Product ID: HY-P1852.
TIP 39, Tuberoinfundibular Neuropeptide
It is a neuropeptide and parathyroid hormone 2 receptor (PTH2R) agonist. Synonyms: Ser-Leu-Ala-Leu-Ala-Asp-Asp-Ala-Ala-Phe-Arg-Glu-Arg-Ala-Arg-Leu-Leu-Ala-Ala-Leu-Glu-Arg-Arg-His-Trp-Leu-Asn-Ser-Tyr-Met-His-Lys-Leu-Leu-Val-Leu-Asp-Ala-Pro; TIP 39 (39 mer); L-seryl-L-leucyl-L-alanyl-L-leucyl-L-alanyl-L-alpha-aspartyl-L-alpha-aspartyl-L-alanyl-L-alanyl-L-phenylalanyl-L-arginyl-L-alpha-glutamyl-L-arginyl-L-alanyl-L-arginyl-L-leucyl-L-leucyl-L-alanyl-L-alanyl-L-leucyl-L-alpha-glutamyl-L-arginyl-L-arginyl-L-histidyl-L-tryptophyl-L-leucyl-L-asparagyl-L-seryl-L-tyrosyl-L-methionyl-L-histidyl-L-lysyl-L-leucyl-L-leucyl-L-valyl-L-leucyl-L-alpha-aspartyl-L-alanyl-L-proline. Grades: ≥95% by HPLC. CAS No. 277302-47-3. Molecular formula: C202H325N61O54S. Mole weight: 4504.17.
Tipelukast
Tipelukast (KCA 757) is a sulfidopeptide leukotriene receptor antagonist, an orally bioavailable anti-inflammatory agent and used for the treatment of asthma. Uses: Scientific research. Group: Signaling pathways. Alternative Names: KCA 757; MN 001. CAS No. 125961-82-2. Pack Sizes: 1 mg. Product ID: HY-14938.
Tipelukast could be used as an oral anti-inflammatory agent and has been found to exhibit potential activities against non-alcoholic fatty liver disease as a leukotriene receptor antagonist. Synonyms: 4-[6-Acetyl-3-[3-[(4-acetyl-3-hydroxy-2-propylphenyl)thio]propoxy]-2-propylphenoxy]-butanoic Acid; 4-[6-Acetyl-3-[3-(4-acetyl-3-hydroxy-2-propylphenylthio)propoxy]-2-propylphenoxy]butyric Acid. CAS No. 125961-82-2. Molecular formula: C29H38O7S. Mole weight: 530.69.
Tipepidine hydrochloride
Tipepidine hydrochloride reversibly inhibits dopamine (DA) D 2 receptor-mediated GIRK currents (I DA(GIRK) ) with an IC 50 of 7.0 μM. Tipepidine hydrochloride subsequently activates VTA dopamine neuron [1]. Tipepidine hydrochloride, a non-narcotic antitussive, exerts an antidepressant-like effect [2]. Uses: Scientific research. Group: Signaling pathways. CAS No. 1449686-84-3. Pack Sizes: 10 mM * 1 mL; 5 mg; 10 mg; 50 mg; 100 mg. Product ID: HY-121685A.
Tiphenylphosphine-3,3',3''-trisulfonic acid trisodium salt
Tiphenylphosphine-3,3',3''-trisulfonic acid trisodium salt. Group: Biochemicals. Grades: Highly Purified. CAS No. 63995-70-0. Pack Sizes: 50mg, 100mg, 250mg, 500mg, 1g. Molecular Formula: C18H12Na3O9PS3. US Biological Life Sciences.
Worldwide
Tipifarnib
A farnesyltransferase inhibitor. Sensitizes human multiple myeloma cell to proteasome inhibition by blocking degradation of bortezomib-induced aggresomes. Also shown to inhibit the growth of myeloid leukemia cell lines and primary leukemia cells by inducing apoptosis and cell-cycle blockage when combined with rapamycin(R124000). Group: Biochemicals. Alternative Names: 6-[(R)-Amino(4-chlorophenyl)(1-methyl-1H-imidazol-5-yl)methyl]-4-(3-chlorophenyl)-1-methyl-2(1H)-quinolinone; (R)-(+)-R 115777; Zarnestra. Grades: Highly Purified. CAS No. 192185-72-1. Pack Sizes: 2.5mg. US Biological Life Sciences.
Tipifarnib is a nonpeptidomimetic quinolinone with potential antineoplastic activity. Tipifarnib binds to and inhibits the enzyme farnesyl protein transferase, an enzyme involved in protein processing (farnesylation) for signal transduction. By inhibiting the farnesylation of proteins, this agent prevents the activation of Ras oncogenes, inhibits cell growth, induces apoptosis, and inhibits angiogenesis. Uses: Antineoplastic agents. Synonyms: R115777; R 115777; R-115777; LX81; NSC702818; D03720; Tipifarnib; trade name Zarnestra. Grades: 0.97. CAS No. 192185-72-1. Molecular formula: C27H22Cl2N4O. Mole weight: 489.4.