American Chemical Suppliers

A directory of where to buy chemicals in the USA, including: distributors, industrial manufacturers, bulk supplies and wholesalers of raw ingredients & finished goods.

Search for products or services, then visit the suppliers website for prices or more information.

Product
mPEG-Chitosan mPEG-Chitosan,methoxypolyethylene glycol-Chitosan is an AB block copolymer,Chitosan is a Medicinal polysaccharide polymer can be used for drug delivery systems. Synonyms: methoxy polyethylene glycol-Chitosan. Product ID: MSMN-053. Category: Raw Materials. CD Formulation
mPEG-DMG mPEG-DMG. Product ID: PE-0344. Category: Excipients. Product Keywords: Pharmaceutical Excipients; Excipients; mPEG-DMG; PE-0344. Sample Provided: Yes. Standard: In-house standard. Grade: Pharmaceutical grade. CD Formulation
m-PEG-DMG (MW 2000) m-PEG-DMG (MW 2000) is a PEG lipid for the preparation of liposomes and can be used in drug delivery studies [1]. Uses: Scientific research. Group: Biochemical assay reagents. CAS No. 1019000-64-6. Pack Sizes: 5 mg; 10 mg. Product ID: HY-W440821. MedChemExpress MCE
MPEG-maleimide MPEG-maleimide. Group: Polyethylene (pe). CAS No. 99126-64-4. Molecular formula: ~5000. Mole weight: CH3O(C2H4O)n+1-CH2CH2 -C4H2NO2. Alfa Chemistry Materials 3
mPEG-PCL-PPEEA PCL has good compatibility and good solvent solubility,especially in aromatic compounds,ketones and polar solvents.It is widely used in controlled release drug carrier,cell and tissue culture medium. Synonyms: methoxy polyethylene glycol-Poly(ε-caprolactone)-PPEEA. Product ID: MSMN-063. Category: Raw Materials. CD Formulation
mPEG-PLA-PPEEA Polylactic acid (PLA) is a kind of non-toxic,non irritating synthetic polymer material with excellent biodegradability,compatibility and absorbability.It can be used as drug transport material and tissue engineering scaffold material. Synonyms: methoxy polyethylene glycol-Poly(D,L-lactide)-PPEEA. Product ID: MSMN-064. Category: Raw Materials. CD Formulation
mPEG-PLGA mPEG-PLGA is a mucus-penetrating polymer. mPEG-PLGA is a raw material to prepare nanomedicine [1]. Uses: Scientific research. Group: Signaling pathways. CAS No. 743423-15-6. Pack Sizes: 5 mg; 10 mg. Product ID: HY-164077. MedChemExpress MCE
MPEP MPEP is a selective mGlu5 receptor antagonist with IC50 of 36 nM, exhibiting no appreciable activity at mGlu1b/2/3/4a/7b/8a/6 receptors. Grades: >98%. CAS No. 96206-92-7. Molecular formula: C14H11N. Mole weight: 193.24. BOC Sciences 10
MPEP MPEP is a potent, selective, noncompetitive, orally active and systemically active mGlu5 receptor antagonist, with an IC 50 of 36 nM for completely inhibiting quisqualate-stimulated phosphoinositide (PI) hydrolysis. MPEP has anxiolytic-or antidepressant-like effects [1] [2]. MPEP is a click chemistry reagent, it contains an Alkyne group and can undergo copper-catalyzed azide-alkyne cycloaddition (CuAAc) with molecules containing Azide groups. Uses: Scientific research. Group: Signaling pathways. CAS No. 96206-92-7. Pack Sizes: 10 mM * 1 mL; 5 mg; 10 mg; 25 mg; 50 mg; 100 mg. Product ID: HY-14609A. MedChemExpress MCE
MPEP hydrochloride MPEP hydrochloride. Group: Biochemicals. Grades: Purified. CAS No. 219911-35-0. Pack Sizes: 10mg, 50mg. US Biological Life Sciences. USBiological 5
Worldwide
MPEP Hydrochloride MPEP Hydrochloride is a potent, selective, noncompetitive, orally active and systemically active mGlu5 receptor antagonist, with an IC 50 of 36 nM for completely inhibiting quisqualate-stimulated phosphoinositide (PI) hydrolysis. MPEP Hydrochloride has anxiolytic-or antidepressant-like effects [1] [2]. MPEP (Hydrochloride) is a click chemistry reagent, it contains an Alkyne group and can undergo copper-catalyzed azide-alkyne cycloaddition (CuAAc) with molecules containing Azide groups. Uses: Scientific research. Group: Signaling pathways. CAS No. 219911-35-0. Pack Sizes: 10 mM * 1 mL; 5 mg; 10 mg; 25 mg; 50 mg; 100 mg. Product ID: HY-14609. MedChemExpress MCE
MPEP Hydrochloride Potent and selective antagonist for metabotropic glutamate receptor subtype 5 (mGluR5); Systemically active in vivo. Synonyms: 2-Methyl-6-(phenylethynyl)pyridine Hydrochloride. Grades: >98%. CAS No. 219911-35-0. Molecular formula: C14H12ClN. Mole weight: 229.7. BOC Sciences 10
MPEP Hydrochloride (6-Methyl-2- (phenylethynyl) pyridine Hydrochloride) A non-competitive, highly potent antagonist selective for mGlu5 receptors (IC50 = 36nM). Also a positive allosteric modulator of mGlu4 and weak anatagonist of nMDA receptors. Biologically active admitted systematically. Widely used in assessing the functional roles of mGlu5 receptors in a variety of research areas, such as learning and memory, sleep, neuroprotection, depression, addiction, anxiety and stress related disorders, analgesia, locomotion, neural plasticity, and Parkinson's disease. Group: Biochemicals. Grades: Highly Purified. CAS No. 96206-92-7. Pack Sizes: 10mg. US Biological Life Sciences. USBiological 4
Worldwide
MPGΔNLS, HIV related It is a 27-residue peptide derived from the hydrophobic fusion peptide of HIV-1 gp41 (for efficient crossing of the cell membrane) and the hydrophilic nuclear localization sequence of SV40 large T antigen (for the nuclear addressing of the peptide). It contains a single mutation in which the second lysine in NLS has mutated to serine. Synonyms: H-Gly-Ala-Leu-Phe-Leu-Gly-Phe-Leu-Gly-Ala-Ala-Gly-Ser-Thr-Met-Gly-Ala-Trp-Ser-Gln-Pro-Lys-Ser-Lys-Arg-Lys-Val-OH. Grades: 97%. Molecular formula: C126H201N35O33S. Mole weight: 2766.27. BOC Sciences 4
MPH MPH. Pack Sizes: Milligram Quantities: 50 mg. Order Number: CL230. Prochem Inc
www.prochemonline.com
m-Phenoxybenzyl(1r-cis)-2,2-dimethyl-3-(2-methylprop-1-enyl)cyclopropanecarboxylate m-Phenoxybenzyl(1r-cis)-2,2-dimethyl-3-(2-methylprop-1-enyl)cyclopropanecarboxylate. Uses: Designed for use in research and industrial production. Additional or Alternative Names: m-phenoxybenzyl (1R-cis)-2,2-dimethyl-3-(2-methylprop-1-enyl)cyclopropanecarboxylate;Cyclopropanecarboxylic acid, 2,2-dimethyl-3-(2-methyl-1-propenyl)-, (3-phenoxyphenyl)methyl ester, (1R,3S)-. Product Category: Heterocyclic Organic Compound. CAS No. 51186-88-0. Molecular formula: C23H26O3. Mole weight: 350.45074. Purity: 0.96. IUPACName: (3-phenoxyphenyl)methyl (1R,3S)-2,2-dimethyl-3-(2-methylprop-1-enyl)cyclopropane-1-carboxylate. Canonical SMILES: CC(=CC1C(C1(C)C)C(=O)OCC2=CC(=CC=C2)OC3=CC=CC=C3)C. ECNumber: 257-040-9. Product ID: ACM51186880. Alfa Chemistry — ISO 9001:2015 Certified. Categories: d-cis-Phenothrin. Alfa Chemistry. 3
m-Phenoxytoluene m-Phenoxytoluene. Group: Biochemicals. Alternative Names: 1-Methyl-3-phenoxybenzene; 3-Methyldiphenyl ether; 3-Methylphenyl Phenyl Ether; 3-Phenoxytoluene; Phenyl m-Tolyl Ether; m-Methylphenyl Phenyl Ether. Grades: Highly Purified. CAS No. 3586-14-9. Pack Sizes: 10g. Molecular Formula: C13H12O, Molecular Weight: 184.23. US Biological Life Sciences. USBiological 3
Worldwide
m-Phenylenediamine 1kg Pack Size. Group: Amines, Building Blocks, Organics. Formula: C6H8N2. CAS No. 108-45-2. Prepack ID 13219509-1kg. Molecular Weight 108.14. See USA prepack pricing. Molekula Americas
m-Phenylenediamine 1,3-phenylenediamine appears as colorless or white colored needles that turn red or purple in air. Melting point 64-66 C. Density 1.14 g / cm³. Flash point 280 F. May irritate skin and eyes. Toxic by skin absorption, inhalation or ingestion. Used in aramid fiber manufacture, as a polymer additive, dye manufacturing, as a laboratory reagent, and in photography.;DryPowder; OtherSolid; PelletsLargeCrystals, Liquid;WHITE CRYSTALS. TURNS RED ON EXPOSURE TO AIR.;Colorless or white colored needles that turn red or purple in air. Group: Polymers. Product ID: benzene-1,3-diamine. Molecular formula: 108.14g/mol. Mole weight: C6H8N2;C6H4(NH2)2;C6H8N2. C1=CC(=CC(=C1)N)N. InChI=1S/C6H8N2/c7-5-2-1-3-6 (8)4-5/h1-4H, 7-8H2. WZCQRUWWHSTZEM-UHFFFAOYSA-N. Alfa Chemistry Materials 4
m-Phenylenediamine 1,3-phenylenediamine appears as colorless or white colored needles that turn red or purple in air. Melting point 64-66 C. Density 1.14 g / cm³. Flash point 280 F. May irritate skin and eyes. Toxic by skin absorption, inhalation or ingestion. Used in aramid fiber manufacture, as a polymer additive, dye manufacturing, as a laboratory reagent, and in photography.;DryPowder; OtherSolid; PelletsLargeCrystals, Liquid;WHITE CRYSTALS. TURNS RED ON EXPOSURE TO AIR.;Colorless or white colored needles that turn red or purple in air. Group: Polymers. CAS No. 108-45-2. Product ID: benzene-1,3-diamine. Molecular formula: 108.14g/mol. Mole weight: C6H8N2;C6H4(NH2)2;C6H8N2. C1=CC(=CC(=C1)N)N. InChI=1S/C6H8N2/c7-5-2-1-3-6 (8)4-5/h1-4H, 7-8H2. WZCQRUWWHSTZEM-UHFFFAOYSA-N. Alfa Chemistry Materials 4
m-Phenylenediamine m-Phenylenediamine. Group: Biochemicals. Alternative Names: 1,3-Diaminobenzene. Grades: Highly Purified. CAS No. 108-45-2. Pack Sizes: 5kg. US Biological Life Sciences. USBiological 8
Worldwide
m-Phenylenediamine 99+.9% m-Phenylenediamine 99+.9%. Group: Biochemicals. Grades: Reagent Grade. CAS No. 108-45-2. Pack Sizes: 25Kg, 100Kg. US Biological Life Sciences. USBiological 5
Worldwide
M-Phisyl-chloride M-Phisyl-chloride. Uses: Designed for use in research and industrial production. Additional or Alternative Names: 2-Methoxy-5-(N-phthalimidinyl)benzenesulfonylchloride. Product Category: Other Fluorophores. Appearance: Solid. CAS No. 126565-42-2. Molecular formula: C15H12ClNO4S. Mole weight: 337.78. Purity: 97%+. IUPACName: 2-methoxy-5-(3-oxo-1H-isoindol-2-yl)benzenesulfonylchloride. Canonical SMILES: COC1=C(C=C(C=C1)N2CC3=CC=CC=C3C2=O)S(=O)(=O)Cl. Product ID: ACM126565422-2. Alfa Chemistry — ISO 9001:2015 Certified. Alfa Chemistry.
MPI-0479605 MPI-0479605 is a potent and selective ATP competitive inhibitor of Mps1. Cells treated with MPI-0479605 undergo aberrant mitosis, resulting in aneuploidy and formation of micronuclei. In cells with wild-type p53, this promotes the induction of a postmitotic checkpoint characterized by the ATM- and RAD3-related-dependent activation of the p53-p21 pathway. In both wild-type and p53 mutant cells lines, there is a growth arrest and inhibition of DNA synthesis. Subsequently, cells undergo mitotic catastrophe and/or an apoptotic response. In xenograft models, MPI-0479605 inhibits tumor growth, suggesting that drugs targeting Mps1 may have utility as novel cancer therapeutics. Synonyms: MPI-0479605; MPI 0479605; MPI0479605. Grades: 0.98. CAS No. 1246529-32-7. Molecular formula: C22H29N7O. Mole weight: 407.522. BOC Sciences 10
MPI-0479605 hydrochloride ?98% (HPLC). Group: Fluorescence/luminescence spectroscopy. Alfa Chemistry Analytical Products
MPI-5a MPI-5a is a cell-permeable and potent histone deacetylase 6 (HDAC6) inhibitor. It is a cytoplasmic enzyme that targets α-tubulin, cortactin, and heat shock protein 90, leading to inhibition of cancer development, proliferation and invasion. Synonyms: N-hydroxy-2-(1-methyl-1H-pyrrole-2-carbonyl)-1,2,3,4-tetrahydroisoquinoline-6-carboxamide. Grades: ≥95%. CAS No. 1259296-46-2. Molecular formula: C16H17N3O3. Mole weight: 299.3. BOC Sciences 10
MPLA (Synthetic) Sterile Solution (Monophosphoryl Lipid A, Phosphorylated Hexaacyl Disaccharide, Glycopyranoside Lipid A, Glucopyranosyl Lipid Adjuvant, GLA) Toll-like receptor 4 (TLR4) activator. Activates TLR4 but does not activate TLR2 even at high concentrations. Defined structure of MPLA. Synthetic lipid A is structurally very similar to natural MPLA but does not exist in nature. Group: Biochemicals. Grades: Cell Culture Grade. CAS No. 1246298-63-4. Pack Sizes: 100ug. US Biological Life Sciences. USBiological 4
Worldwide
Mp_mastoparan MP Mp_mastoparan MP was found in Venom, wasps, Mischocyttarusphthisicus. Mp_mastoparan MP has antimicrobial activity. BOC Sciences 4
MPMP MPMP. Uses: Designed for use in research and industrial production. Additional or Alternative Names: Bis(4-N,N-diethylamino-2-methylphenyl)-4-methylphenylmethane. Product Category: Organic Light Emitting Diode (OLED). CAS No. 70895-80-6. Molecular formula: C30H40N2. Mole weight: 428.65 g/mol. Product ID: ACM70895806. Alfa Chemistry — ISO 9001:2015 Certified. Categories: Pecazine, MPM (psychedelic). Alfa Chemistry.
MPO-IN-28 MPO-IN-28 is a myeloperoxidase (MPO) inhibitor with IC50 of 44 nM. Synonyms: GNF-Pf-3346; 1-(7-methoxy-4-methylquinazolin-2-yl)guanidine; (7-methoxy-4-methyl-quinazolin-2-yl)-guanidine. CAS No. 37836-90-1. Molecular formula: C11H13N5O. Mole weight: 231.25. BOC Sciences 8
MPP dihydrochloride MPP dihydrochloride is a potent and selective ER (estrogen receptor) modulator. MPP dihydrochloride induces significant apoptosis in the endometrial cancer and oLE cell lines. MPP dihydrochloride reverses the positive effects of beta-estradiol. MPP dihydrochloride has mixed agonist/antagonist action on murine uterine ERalpha in vivo [1] [2] [3]. Uses: Scientific research. Group: Signaling pathways. CAS No. 911295-24-4. Pack Sizes: 10 mM * 1 mL; 5 mg; 10 mg; 25 mg; 50 mg; 100 mg. Product ID: HY-103454. MedChemExpress MCE
MPP dihydrochloride MPP dihydrochloride is a selective, high affinity silent antagonist at ERα receptors, with > 200-fold selectivity for ERα over Erβ (Ki= 2.7 and 1800 nM at ERα and ERβ receptors respectively). It cannot block EE2 induced luciferase activity with any isoform of zebrafish estrogen receptor. Synonyms: 1,3-Bis(4-hydroxyphenyl)-4-methyl-5-[4-(2-piperidinylethoxy)phenol]-1H-pyrazole dihydrochloride. Grades: ≥98% by HPLC. CAS No. 911295-24-4. Molecular formula: C29H31N3O3.2HCl. Mole weight: 542.5. BOC Sciences 10
MPPG MPPG is a potent antagonist of L-AP4-induced effects in rat spinal cord, thalamic and hippocampal neurons, showing selectivity over (1S,3S)-ACPD-induced effects. MPPG should be useful in determining the roles of group II and III mGluRs in the central nervous system. Synonyms: (RS)-α-Methyl-4-phosphonophenylglycine. CAS No. 169209-65-8. Molecular formula: C9H12NO5P. Mole weight: 245.17. BOC Sciences 11
MPPG ?97% (NMR), solid. Group: Fluorescence/luminescence spectroscopy. Alfa Chemistry Analytical Products 2
MPPG MPPG. Group: Biochemicals. Grades: Purified. CAS No. 169209-65-8. Pack Sizes: 10mg, 50mg. US Biological Life Sciences. USBiological 5
Worldwide
MPP hydrochloride MPP hydrochloride is a potent and selective ER (estrogen receptor) modulator. MPP hydrochloride induces significant apoptosis in the endometrial cancer and oLE cell lines. MPP hydrochloride reverses the the positive effects of beta-estradiol. MPP hydrochloride has mixed agonist/antagonist action on murine uterine ERalpha in vivo [1]. Uses: Scientific research. Group: Signaling pathways. CAS No. 2863676-89-3. Pack Sizes: 10 mM * 1 mL; 5 mg; 10 mg; 25 mg; 50 mg; 100 mg. Product ID: HY-103454B. MedChemExpress MCE
MPP+ iodide MPP+ iodide, a toxic metabolite of the neurotoxin MPTP, causes symptom of Parkinson's disease in animal models by selectively destroying dopaminergic neurons in substantia nigra. MPP+ iodide is taken up by the dopamine transporter into dopaminergic neurons where it exerts its neurotoxic action on mitochondria by affecting complex I of the respiratory chain. MPP+ iodide is also a high affinity substrate for the serotonin transporter (SERT) [1] [2]. Uses: Scientific research. Group: Signaling pathways. CAS No. 36913-39-0. Pack Sizes: 10 mM * 1 mL; 10 mg; 25 mg; 50 mg; 100 mg. Product ID: HY-W008719. MedChemExpress MCE
MPP+ iodide ?98% (HPLC), powder. Group: Fluorescence/luminescence spectroscopy. Alfa Chemistry Analytical Products
m-(Propionamido)anilinodiethyl diacetate m-(Propionamido)anilinodiethyl diacetate. Uses: Designed for use in research and industrial production. Additional or Alternative Names: m-(propionamido)anilinodiethyl diacetate;3-propanoylamino-N,N-bis(2-acetoxyethyl)benzenamine;N,N-Diacetoxyethyl-3-propionylaminoaniline;Diacetic acid [(3-propionylaminophenyl)imino]bisethylene ester;Einecs 246-153-9;Propanamide, N-(3-(bis(2-(acetyloxy)et. Product Category: Heterocyclic Organic Compound. CAS No. 24311-37-3. Molecular formula: C17H24N2O5. Mole weight: 336.38286. Product ID: ACM24311373. Alfa Chemistry — ISO 9001:2015 Certified. Alfa Chemistry. 4
MPS MPS. CAS No. 55750-62-4. Pack Sizes: Milligram Quantities: 100 mg. Order Number: CL228. Prochem Inc
www.prochemonline.com
Mps1-IN-1 Mps1-IN-1 is a highly potent and selectibe Mpsl inhibitor with IC50 of 367 nM; >1000-fold selectivity relative to the 352 member kinase panel with the major exceptions of Alk and Ltk. Synonyms: Mps1-IN-1; 1125593-20-5; 1-(4-(4-(2-(Isopropylsulfonyl)phenylamino)-1H-pyrrolo[2,3-b]pyridin-6-ylamino)-3-methoxyphenyl)piperidin-4-ol; 1-[3-methoxy-4-[[4-(2-propan-2-ylsulfonylanilino)-1H-pyrrolo[2,3-b]pyridin-6-yl]amino]phenyl]piperidin-4-ol; 1MPS1-IN-1; 3gfw; 1-(4-((4-((2-(isopropylsulfonyl)phenyl)amino)-1H-pyrrolo[2,3-b]pyridin-6-yl)amino)-3-methoxyphenyl)piperidin-4-ol; MLS003230944; GTPL9271; SCHEMBL4051419; CHEMBL1235786; BDBM36485; CHEBI:91379; DTXSID60649015; AVB59320; BCP27688; AKOS027422816; CS-3776; NCGC00387463-01; NCGC00387463-04; HY-13298; MS-29898; SMR001913509; F85109; A925638; J-503190; Q27087728; 1-(3-methoxy-4-{[4-({2-[(1-methylethyl)sulfonyl]phenyl}amino)-1H-pyrrolo[2,3-b]pyridin-6-yl]amino}phenyl)piperidin-4-ol; 1-[3-Methoxy-4-({4-[2-(propane-2-sulfonyl)anilino]-1H-pyrrolo[2,3-b]pyridin-6-yl}amino)phenyl]piperidin-4-ol; s22. Grades: >98%. CAS No. 1125593-20-5. Molecular formula: C28H33N5O4S. Mole weight: 535.66. BOC Sciences 9
Mps1-IN-1 dihydrochloride Mps1-IN-1 is a selective inhibitor of monopolar spindle 1 (Mps1) kinase (IC50 = 367 nM), which displays >1000 fold-selectivity against a panel of 352 kinases with the exceptions of ALK and Ltk. Synonyms: 1-[3-Methoxy-4-[[4-[[2-[(1-methylethyl)sulfonyl]phenyl]amino]-1H-pyrrolo[2,3-b]pyridin-6-yl]amino]phenyl]-4-piperidinol dihydrochloride. Grades: ≥98% by HPLC. CAS No. 1883548-93-3. Molecular formula: C28H35Cl2N5O4S. Mole weight: 608.58. BOC Sciences 9
Mps1-IN-1 dihydrochloride Mps1-IN-1 dihydrochloride. Group: Biochemicals. Grades: Purified. Pack Sizes: 10mg. US Biological Life Sciences. USBiological 5
Worldwide
Mps1-IN-2 ?98% (HPLC). Group: Fluorescence/luminescence spectroscopy. Alfa Chemistry Analytical Products
Mps1-IN-2 Small-molecule inhibitor of Mps1 kinase (IC50 values 145 nM) with greater than 1000-fold selectivity relative to the 352-member kinase panel, with the major exceptions of Gak and Plk1 (Ambit essay Kd values 12 nM, 140 nM, and 61 nM for Mps1, Gak, and Plk1, respectively). Mps1-IN-2 induces bypass of a checkpoint-mediated mitotic arrest and provides a unique tool to investigate the combined inhibition of Plk1 and Mps1. Synonyms: Mps1-IN-2. Grades: >98%. CAS No. 1228817-38-6. Molecular formula: C26H36N6O3. Mole weight: 480.6. BOC Sciences 9
Mps1-IN-3 MPS1-IN-3 is a selective and potent MPS1 inhibitor with phenotypic consequences similar to those reported for published MPS1 inhibitors such as MPS1-IN-1, MPS1-IN-2, and AZD3146. Treatment with MPS1-IN-3 at 5 μM sensitized all glioblastoma cells to 3 nM of vincristine as measured by cell counts 11 days posttreatment. U251-FM cells were stereotactically injected into the brain of nude mice. Ten days postinjection, 2 mg/kg of MPS1-IN-3 and/or 0.5 mg/kg of vincristine were administered concomitantly by intravenous injections twice per week for 3 weeks. Synonyms: Mps1-IN-3; Mps1 IN3; Mps1-IN3. Grades: >98%. CAS No. 1609584-72-6. Molecular formula: C26H31N7O4S. Mole weight: 537.63. BOC Sciences 9
Mps1-IN-3 ?98% (HPLC). Group: Fluorescence/luminescence spectroscopy. Alfa Chemistry Analytical Products 3
Mps1-IN-3 Mps1-IN-3 is a potent and selective MPS1 kinase inhibitor, with an IC 50 of 50 nM. Uses: Scientific research. Group: Signaling pathways. CAS No. 1609584-72-6. Pack Sizes: 10 mM * 1 mL; 5 mg; 10 mg; 25 mg; 50 mg; 100 mg. Product ID: HY-12401. MedChemExpress MCE
Mps1-IN-3 hydrochloride Mps1-IN-3 hydrochloride is a potent and selective Mps1 inhibitor with an IC 50 value of 50 nM. Mps1-IN-3 hydrochloride can inhibit the proliferation of glioblastoma cells, and effectively sensitizes glioblastomas to Vincristine in orthotopic glioblastoma xenograft model [1]. Uses: Scientific research. Group: Signaling pathways. CAS No. 2989453-29-2. Pack Sizes: 5 mg; 10 mg; 25 mg; 50 mg; 100 mg. Product ID: HY-12401A. MedChemExpress MCE
Mps1-IN-5 Mps1-IN-5, also called as BAY1161909, a derivative of triazolopyridine, is an inhibitor of Mps1 kinase (IC50< 10 nmol/L) and in combination with antimitotic cancer drugs it can enhance their efficacy and potentially overcome resistance. Synonyms: BAY1161909; BAY-1161909; BAY 1161909; Empesertib, Mps1-IN-5; (2R)-2-(4-fluorophenyl)-N-[4-[2-(2-methoxy-4-methylsulfonylanilino)-[1,2,4]triazolo[1,5-a]pyridin-6-yl]phenyl]propanamideMps1-IN-5SCHEMBL15036597. CAS No. 1443763-60-7. Molecular formula: C29H26FN5O4S. Mole weight: 559.61. BOC Sciences 9
MPS1 Inhibitor, NMS-P715 ( (N- (2, 6-diethylphenyl) -1-methyl-8- ({4-[ (1-methylpiperidin-4-yl) carbamoyl]-2- (trifluoromethoxy) phenyl}amino) -4, 5-dihydro-1H-pyrazolo[4, 3-h]quinazoline-3-carboxamide) ) An orally bioavailable, ATP-competitive, pyrazolo-quinazoline, MPS1 inhibitor (IC50=182nM, Ki=0.99nM) that is shown to act in a reversible and time-dependent manner. It demonstrates selectivity for MPS1 against a panel of 60 kinases, displaying activity against only three kinases, CK2, MELK, and NEK6 (<10uM), but not against other mitotic kinases including PLK1, CDK1, Aurora A, Aurora B, or the SAC kinase BUB1, in an in vitro kinase assay. It promotes massive SAC (spindle assembly checkpoint) override (EC50=65nM) in nocodazole-arrested U20S cells and elicits a reduction in the G1 and G2/M phase of the cell cycle in A2780 ovarian cancer cells, similar to RNAi-mediated MPS1 silencing. In addition, it is shown to inactivate SAC, delocalize kinetochore components, and inhibit the proliferation of select cancer cell lines (IC50 ~1uM), without marked activity among a panel of 127 normal cell lines. Also, it inhibits A2780 tumor xenograft growth in mice (90mg/kg/day, o.s., in vivo) by 53% wit… Group: Biochemicals. Grades: Highly Purified. Pack Sizes: 5mg. US Biological Life Sciences. USBiological 4
Worldwide
MPS1/TTK Inhibitor MPS1/TTK inhibitor is an inhibitor of monopolar spindle 1 (MPS1/TTK), a dual-specificity kinase playing an essential role in mitotic spindle checkpoint signaling that is overexpressed in certain cancerous tumors. Synonyms: N-(2,6-diethylphenyl)-4,5-dihydro-8-[[2-methoxy-4-(4-methyl-1-piperazinyl)phenyl]amino]-1-methyl-1H-pyrazolo[4,3-h]quinazoline-3-carboxamide. Grades: ≥98%. CAS No. 1202055-39-7. Molecular formula: C33H40N8O2. Mole weight: 580.72. BOC Sciences 9
Mps BAY 2a Mps BAY 2a is a potent and selective Mps1 inhibitor (IC50 = 1 nM for human enzyme), which is selective for Mps1 over a panel of 220 kinases. It exhibits anticancer activity in human cancer cells, preparation of combination containing imidazopyridazine derivative useful for the treatment of cancer. Synonyms: N-Cyclopropyl-4-[8-[(2-methylpropyl)amino]-6-(5-quinolinyl)imidazo[1,2-a]pyrazin-3-yl]benzamide; MpsBAY2a; Mps-BAY-2a; Mps BAY 2a. Grades: ≥98% by HPLC. CAS No. 1382477-96-4. Molecular formula: C29H28N6O. Mole weight: 476.57. BOC Sciences 9
MPS-Gαi3 It is a cell penetrating peptide. Synonyms: H-Ala-Ala-Val-Ala-Leu-Leu-Pro-Ala-Val-Leu-Leu-Ala-Leu-Leu-Ala-Lys-Asn-Asn-Leu-Lys-Glu-Cys-Gly-Leu-Tyr-OH. Grades: >95%. Molecular formula: C120H205N29O31S. Mole weight: 2582.19. BOC Sciences 4
MPT0B014 ?98% (HPLC). Group: Fluorescence/luminescence spectroscopy. Alfa Chemistry Analytical Products
MPT0B098 MPT0B098 is a potent microtubule inhibitor through binding to the colchicine-binding site of tubulin. MPT0B098 is active against the growth of various human cancer cells, including chemoresistant cells with IC50 values ranging from 70 to 150 nmol/L. MPT0B098 arrests cells in the G2-M phase and subsequently induces cell apoptosis. In addition, MPT0B098 effectively suppresses VEGF-induced cell migration and capillary-like tube formation of HUVECs. Distinguished from other microtubule inhibitors, MPT0B098 not only inhibited the expression levels of HIF-1α protein but also destabilized HIF-1α mRNA. The mechanism of causing unstable of HIF-1α mRNA by MPT0B098 is through decreasing RNA-binding protein, HuR, translocation from the nucleus to the cytoplasm. Notably, MPT0B098 effectively suppresses tumor growth and microvessel density of tumor specimens in vivo. Taken together, our results provide a novel mechanism of inhibiting HIF-1α of a microtubule inhibitor MPT0B098. MPT0B098 is a promising anticancer drug candidate with potential for the treatment of human malignancies. Synonyms: MPT 0B098; MPT-0B098; 1-(4-methoxyphenylsulfonyl)-7-(pyridin-4-yl)indoline. CAS No. 1254363-89-7. Molecular formula: C20H18N2O3S. Mole weight: 366.43. BOC Sciences 11
MPT0B214 MPT0B214 is a novel and potent microtubule inhibitor with potential anticancer activity. MPT0B214 inhibited tubulin polymerization through strongly binding to the tubulin's colchicine-binding site and had cytotoxic activity in a variety of human tumor cell lines. After treatment with MPT0B214, KB cells were arrested in the G2-M phase before cell death occurred, which were associated with upregulation of cyclin B1, dephosphorylation of Cdc2, phosphorylation of Cdc25C and elevated expression of the mitotic marker MPM-2. Furthermore, the compound induced apoptotic cell death through mitochondria/caspase 9-dependent pathway. Notably, several KB-derived multidrug-resistant cancer cell lines were also sensitive to MPT0B214 treatment. Synonyms: MPT0B214; MPT 0B214; MPT-0B214. Grades: 98%. CAS No. 1215208-65-3. Molecular formula: C20H20N2O5. Mole weight: 368.38. BOC Sciences 11
MPT0E028 MPT0E028 is a novel N-hydroxyacrylamide-derived HDAC inhibitor, inhibited human colorectal cancer HCT116 cell growth in vitro and in vivo. The results of NCI-60 screening showed that MPT0E028 inhibited proliferation in both solid and hematological tumor cell lines at micromolar concentrations, and was especially potent in HCT116 cells. MPT0E028 had a stronger apoptotic activity and inhibited HDACs activity more potently than SAHA, the first therapeutic HDAC inhibitor proved by FDA. In vivo murine model, the growth of HCT116 tumor xenograft was delayed and inhibited after treatment with MPT0E028 in a dose-dependent manner. Based on in vivo study, MPT0E028 showed stronger anti-cancer efficacy than SAHA. No significant body weight difference or other adverse effects were observed in both MPT0E028-and SAHA-treated groups. Taken together, our results demonstrate that MPT0E028 has several properties and is potential as a promising anti-cancer therapeutic drug. Synonyms: 3-(1-(Benzenesulfonyl)-2,3-dihydro-1H-indol-5-yl)-N-hydroxyacrylamide; MPT-0E028; MPT 0E028. Grades: 98%. CAS No. 1338320-94-7. Molecular formula: C17H16N2O4S. Mole weight: 344.38. BOC Sciences 11
MPT0G211 MPT0G211 is a potent, orally active and selective HDAC6 inhibitor ( IC 50=0.291 nM). MPT0G211 displays >1000-fold selective for HDAC6 over other HDAC isoforms. MPT0G211 can penetrate the blood-brain barrier. MPT0G211 ameliorates tau phosphorylation and cognitive deficits in an Alzheimers disease model. MPT0G211 has anti-metastatic and neuroprotective effects. Anticancer activities [1] [2] [3]. Uses: Scientific research. Group: Signaling pathways. CAS No. 2151853-97-1. Pack Sizes: 10 mM * 1 mL; 5 mg; 10 mg. Product ID: HY-123976. MedChemExpress MCE
mPTC mPTC. Uses: Designed for use in research and industrial production. Additional or Alternative Names: 2'-(10H-Phenoxazin-10-yl)-[1,1':3',1''-terphenyl]-5'-carbonitrile. Product Category: Organic Light Emitting Diode (OLED). CAS No. 1948247-74-2. Molecular formula: C31H20N2O. Mole weight: 436.50 g/mol. Product ID: ACM1948247742. Alfa Chemistry — ISO 9001:2015 Certified. Alfa Chemistry. 2
MPTP hydrochloride A dopaminergic neurotoxin that causes permanent symptoms of Parkinson's disease by killing certain neurons in the substantia nigra of the brain. Useful tool compound for Parkinson's disease related studies. Synonyms: MPTP. Grades: >98%. CAS No. 23007-85-4. Molecular formula: C12H16ClN. Mole weight: 209.72. BOC Sciences 9
MPTP hydrochloride MPTP hydrochloride is a brain penetrant dopamine neurotoxin. MPTP hydrochloride can be used to induces Parkinsons Disease model. MPTP hydrochloride, a precusor of MPP + , induces apoptosis [1] [2] [3]. MPTP hydrochloride has been verified by MCE with professional biological experiments. Uses: Scientific research. Group: Signaling pathways. CAS No. 23007-85-4. Pack Sizes: 10 mM * 1 mL; 5 mg; 10 mg; 25 mg; 50 mg; 100 mg; 200 mg; 500 mg. Product ID: HY-15608. MedChemExpress MCE
MPTP hydrochloride MPTP hydrochloride Inhibitor. Uses: Scientific use. Product Category: T4081. CAS No. 23007-85-4. TARGETMOL CHEMICALS
MPTP Hydrochloride (Dopaminergic Neurotoxin, MPTP) A neurotoxin that is a precusor of MPP+ which is toxic to dopaminergic neurons and causes Parkinsonism. Widely used in research to induce Parkinson's disease models in primates. Group: Biochemicals. Grades: Highly Purified. CAS No. 23007-85-4. Pack Sizes: 10mg. Molecular Formula: C??H??N·HCl. US Biological Life Sciences. USBiological 4
Worldwide
MPTS MPTS. Uses: Designed for use in research and industrial production. Additional or Alternative Names: 8-Methoxypyrene-1,3,6-trisulfonicacidtrisodiumsalt. Product Category: Other Fluorophores. Appearance: Light brown to beige crystalline powder. CAS No. 82962-86-5. Molecular formula: C17H93O10S3. Mole weight: 538.41. Purity: 98%+. IUPACName: Trisodium;8-methoxypyrene-1,3,6-trisulfonate. Canonical SMILES: COC1=CC(=C2C=CC3=C(C=C(C4=C3C2=C1C=C4)S(=O)(=O)[O-])S(=O)(=O)[O-])S(=O)(=O)[O-].[Na+].[Na+].[Na+]. Product ID: ACM82962865-1. Alfa Chemistry — ISO 9001:2015 Certified. Alfa Chemistry. 2
MP-VB1 MP-VB1 showed strong antimicrobial activities against bacteria and fungi and induced mast cell degranulation, but displayed almost no hemolytic activity towards human blood red cells. BOC Sciences 4
MQAB MQAB. Uses: Designed for use in research and industrial production. Additional or Alternative Names: (Z)-6-Mesityl-N-(6-mesitylquinolin-2(1H)-ylidene)quinolin-2-amine-BF2 complex. Product Category: Organic Light Emitting Diode (OLED). CAS No. 1338788-44-5. Molecular formula: C36H32BF2N3. Mole weight: 555.47 g/mol. Product ID: ACM1338788445. Alfa Chemistry — ISO 9001:2015 Certified. Categories: Mqabba. Alfa Chemistry. 2
MQAE MQAE is a chloride ion (Cl - ) fluorescent probe that can be used to measure chloride concentrations. The fluorescence intensity of MQAE decreases proportionally as Cl - ions increase. MQAE has high cell permeability and is suitable for fluorescence detection such as confocal microscopy and flow cytometry (Ex/Em=350/460 nm) [1] [2]. Uses: Scientific research. Group: Fluorescent dye. CAS No. 162558-52-3. Pack Sizes: 50 mg; 100 mg; 200 mg; 500 mg. Product ID: HY-D0090. MedChemExpress MCE
MQAE MQAE. Uses: Designed for use in research and industrial production. Additional or Alternative Names: N-(Ethoxycarbonylmethyl)-6-methoxyquinolinium bromide. Product Category: Other Fluorophores. Appearance: Yellow powder. CAS No. 162558-52-3. Molecular formula: C14H16BrNO3. Mole weight: 326.19. Purity: 95%+. IUPACName: Ethyl2-(6-methoxyquinolin-1-ium-1-yl)acetate;bromide. Canonical SMILES: CCOC(=O)C[N+]1=CC=CC2=C1C=CC(=C2)OC.[Br-]. Product ID: ACM162558523-2. Alfa Chemistry — ISO 9001:2015 Certified. Categories: Maersk. Alfa Chemistry.
MQRGNFRNQRKIVKCFNCGKEGHTARNCRAPRKKGC WKCGKEGHQMKDCTERQAN It is an HIV retrovirus NC peptide with superior cell membrane penetration activity. Synonyms: HIV-NC peptide SEQ ID NO: 12. BOC Sciences 6

Would you like to list your products on USA Chemical Suppliers?

Our database is helping our users find suppliers everyday.

Add Your Products