American Chemical Suppliers
A directory of where to buy chemicals in the USA, including: distributors, industrial manufacturers, bulk supplies and wholesalers of raw ingredients & finished goods.
Search for products or services, then visit the suppliers website for prices or more information.
Product | Description | |
---|---|---|
Maltol Natural Quick inquiry Where to buy Suppliers range | Maltol Natural. CAS No. 118-71-8. FEMA No. 2656. Kosher: Y. VIGON Item # 504140. Categories: Speciality Ingrdients Suppliers, Flavors, Fragrances, Perfumers, Aromatherapy, Essetial Oils. | America & Internationally |
Maltol Propionate Quick inquiry Where to buy Suppliers range | Maltol Propionate. CAS No. 68555-63-5. FEMA No. 3941. Kosher: Y. VIGON Item # 500763. Categories: Speciality Ingrdients Suppliers, Flavors, Fragrances, Perfumers. | America & Internationally |
Maltononaose Quick inquiry Where to buy Suppliers range | Maltononaose is a synthetic compound used in the biomedical industry to study and study glycosylation-related diseases. It acts as a glycosidase inhibitor, aiding in the understanding of enzyme mechanisms and the research of disorders such as Pompe disease, lysosomal storage diseases and cancer metastasis. CAS No. 6471-60-9. Molecular formula: C54H92O46. Mole weight: 1477.28. | |
Maltooctaose Quick inquiry Where to buy Suppliers range | Maltooctaose. Group: Biobased Products. Grades: 98%. CAS No. 6156-84-9. Product ID: BBC6156849. Molecular formula: C48H82O41. Mole weight: 1315.13. Appearance: Solid. SMILES: C (C1[C@H] ([C@@H] (C ([C@H] (O1)O[C@H]2[C@@H] (C ([C@H] (OC2CO)O[C@H]3[C@@H] (C ([C@H] (OC3CO)O[C@. | |
Maltooctaose Quick inquiry Where to buy Suppliers range | Maltooctaose, an intriguing carbohydrate compound, holds significant importance in the realm of biomedical research. This compound's utilization lies in its profound impact on deciphering the intricate mechanisms of carbohydrate metabolism and digestion within the human body. Researchers have long delved into the depths of Maltooctaose to unravel the enigmatic role of distinctive enzymes involved in the intricate breakdown of complex carbohydrates. Synonyms: Maltooctaose; 6156-84-9; (2R,3R,4S,5S,6R)-2-[(2R,3S,4R,5R,6R)-6-[(2R,3S,4R,5R,6R)-6-[(2R,3S,4R,5R,6R)-6-[(2R,3S,4R,5R,6R)-6-[(2R,3S,4R,5R,6R)-6-[(2R,3S,4R,5R,6R)-4,5-dihydroxy-2-(hydroxymethyl)-6-[(2R,3S,4R,5R)-4,5,6-trihydroxy-2-(hydroxymethyl)oxan-3-yl]oxyoxan-3-yl]oxy-4,5-dihy; Glc(a1-4)Glc(a1-4)Glc(a1-4)Glc(a1-4)Glc(a1-4)Glc(a1-4)Glc(a1-4)Glc;(2R,3R,4S,5S,6R)-2-{[(2R,3S,4R,5R,6R)-6-{[(2R,3S,4R,5R,6R)-6-{[(2R,3S,4R,5R,6R)-6-{[(2R,3S,4R,5R,6R)-6-{[(2R,3S,4R,5R,6R)-6-{[(2R,3S,4R,5R,6R)-4,5-dihydroxy-2-(hydroxymethyl)-6-{[(2R,3S,4R,5R)-4,5,6-trihydroxy-2-(hydroxymethyl)oxan-3-yl]oxy}oxan-3-yl]oxy}; alpha-D-gluco-hexopyranosyl-(1->4)-alpha-D-gluco-hexopyranosyl-(1->4)-alpha-D-gluco-hexopyranosyl-(1->4)-alpha-D-gluco-hexopyranosyl-(1->4)-alpha-D-gluco-hexopyranosyl-(1->4)-alpha-D-gluco-hexopyranosyl-(1->4)-alpha-D-gluco-hexopyranosyl-(1->4)-D-gluco-hexopyranose. CAS No. 6156-84-9. Molecular formula: C48H82O41. Mole weight: 1315.16. | |
Maltooctaose hexacosaacetate Quick inquiry Where to buy Suppliers range | Maltooctaose hexacosaacetate is an intricate compound playing a pivotal role in studying diverse ailments, including diabetes and obesity. Its exceptional chemical configuration renders it a highly promising compound in terms of effectively studying glycemic control. CAS No. 126971-67-3. Molecular formula: C100H134O67. Mole weight: 2408.09. | |
Maltooligosaccharides Quick inquiry Where to buy Suppliers range | ||
Maltopentadecaose Quick inquiry Where to buy Suppliers range | Maltopentadecaose, an intricate carbohydrate substrate, exhibits immense prospects in the biomedical realm. Focusing primarily on its prebiotic functionality, current research propagates that it elicits flourishing growth of favorable gut microbiota, inevitably leading to amelioration of digestive health. Furthermore, as a potent therapeutic candidate, this compound holds merit in treating a variety of ailments. Owing to its unparalleled chemical structure, maltopentadecaose presents itself as an attractive entity for further scrutiny as a prospective drug or therapeutic agent. Grades: 95%. CAS No. 100307-88-8. Molecular formula: C90H152O76. Mole weight: 2450.12. | |
Maltopentaose Quick inquiry Where to buy Suppliers range | Maltopentaose. Group: Heterocyclic Organic Compound. Alternative Names: MALTOPENTAOSE;AMYLOPENTAOSE;d-glucose,o-alpha-d-glucopyranosyl-(1.fwdarw.4)-o-alpha-d-glucopyranosyl-(1.;fwdarw.4)-o-alpha-d-glucopyranosyl-(1.fwdarw.4)-o-alpha-d-glucopyranosyl-(1.f;wdarw.4)-;O-alpha-D-glucopyranosyl-(1->4)-O-alpha-D-glucopyranosyl-(1->4)-O-alpha-D-glucopyranosyl-(1->4)-O-alpha-D-glucopyranosyl-(1->4)-D-glucose;MALTOPENTAOSE, DP5, 100MG NEAT;D-Glucose, O-.alpha.-D-glucopyranosyl-(1?4)-O-.alpha.-D-glucopyranosyl-(1?4)-O-.alpha.-D-glucopyranosyl-(1?4)-O-.alpha.-D-glucopyranosyl-(1?4)-. CAS No. 34620-76-3. Molecular formula: C30H52O26. Mole weight: 828.72. Safty Description: 22-24/25. | |
Maltopentaose Quick inquiry Where to buy Suppliers range | Maltopentaose is a pivotal pharmaceutical compound entrenched in the realm of biomedical sciences is admirably endeavors to study diabetes and other afflictions. Synonyms: D-Glucose, O-α-D-glucopyranosyl-(1?4)-O-α-D-glucopyranosyl-(1?4)-O-α-D-glucopyranosyl-(1?4)-O-α-D-glucopyranosyl-(1?4)-; O-α-D-glucopyranosyl-(1?4)-O-α-D-glucopyranosyl-(1?4)-O-α-D-glucopyranosyl-(1?4)-O-α-D-glucopyranosyl-(1?4)-D-Glucose; Amylopentaose; 4-O-[4-O-[4-O-(4-O-d-D-Glucopyranosyl-a-D-glucopyranosyl)-a-D-glucopyranosyl]-a-D-glucopyranosyl]-a-D-glucopyranose; Maltopentose. Grades: ≥95%. CAS No. 34620-76-3. Molecular formula: C30H52O26. Mole weight: 828.72. | |
Maltopentose Quick inquiry Where to buy Suppliers range | Maltopentose. Uses: For analytical and research use. Group: Carbohydrates. CAS No. 34620-76-3. Pack Sizes: 5MG. IUPAC Name: (2R,3R,4R,5R)-4-[(2R,3R,4R,5S,6R)-5-[(2R,3R,4R,5S,6R)-5-[(2R,3R,4R,5S,6R)-3,4-dihydroxy-6-(hydroxymethyl)-5-[(2R,3R,4S,5S,6R)-3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]oxyoxan-2-yl]oxy-3,4-dihydroxy-6-(hydroxymethyl)oxan-2-yl]oxy-3,4-dihydroxy-6-(hydroxymethyl)oxan-2-yl]oxy-2,3,5,6-tetrahydroxyhexanal. Molecular formula: C30H52O26. Mole weight: 828.72. Catalog: APS34620763. SMILES: OC[C@@H] (O)[C@@H] (O[C@H]1O[C@H] (CO)[C@@H] (O[C@H]2O[C@H] (CO)[C@@H] (O[C@H]3O[C@H] (CO)[C@@H] (O[C@H]4O[C@H] (CO)[C@@H] (O)[C@H] (O)[C@H]4O)[C@H] (O)[C@H]3O)[C@H] (O)[C@H]2O)[C@H] (O)[C@H]1O)[C@H] (O)[C@@H] (O)C=O. Format: Neat. Shipping: Room Temperature. | |
Maltopentose Peracetate Quick inquiry Where to buy Suppliers range | Maltopentose Peracetate is an intermediate in the synthesis of Maltopentaose, which is a maltooligosaccharide that is used for research and diagnostic purposes. Maltooligosaccharide can also be used in nutrients and healthcare. Synonyms: Peracetyl maltopentaose; Heptadecaacetyl-D-maltopentaose; O-2,3,4,6-Tetra-O-acetyl-α-D-glucopyranosyl-(1?4)-O-2,3,6-tri-O-acetyl-α-D-glucopyranosyl-(1?4)-O-2,3,6-tri-O-acetyl-α-D-glucopyranosyl-(1?4)-O-2,3,6-tri-O-acetyl-α-D-glucopyranosyl-(1?4)-D-glucopyranose Tetraacetate; O-2,3,4,6-Tetra-O-acetyl-α-D-glucopyranosyl-(1?4)-O-2,3,6-tri-O-acetyl-α-D-glucopyranosyl-(1?4)-O-2,3,6-tri-O-acetyl-α-D-glucopyranosyl-(1?4)-O-2,3,6-tri-O-acetyl-α-D-glucopyranosyl-(1?4)-D-glucopyranose 1,2,3,6-Tetraacetate. CAS No. 70681-32-2. Molecular formula: C64H86O43. Mole weight: 1543.34. | |
Maltophilin Quick inquiry Where to buy Suppliers range | It is produced by the strain of Stenotrophomonas maltophilia. It is a broad-spectrum antifungal antibiotic that has no antibacterial effect against gram-positive and gram-negative bacteria. Molecular formula: C29H38N2O6. Mole weight: 510.62. | |
Maltopyranosyl-CTP Quick inquiry Where to buy Suppliers range | Maltopyranosyl-CTP is a distinctive derivative of Cytidine triphosphate (CTP) assuming an indispensable role in multifarious cellular processes. Its paramount significance lies in orchestrating nucleic acid synthesand facilitating energy transfer. Synonyms: 2-Deoxycytidine 5-triphosphate-a-D-maltopyranoside sodium salt. Molecular formula: C21H32N2Na3O24P3. Mole weight: 858.37. | |
Maltosan Quick inquiry Where to buy Suppliers range | Maltosan is a reputable biomedical compound, aiding in studying the intricate complexities associated with diabetes and diverse metabolic ailments. This cutting-edge compound encapsulates the essence of maltose, an all-natural saccharide sourced from starch. Synonyms: 1,6-Anhydro-4-O-a-D-glucopyranosyl-b-D-glucopyranose; 1,6-Anhydro-b-D-maltose. CAS No. 6983-27-3. Molecular formula: C12H20O10. Mole weight: 324.28. | |
Maltose Quick inquiry Where to buy Suppliers range | Maltose. Group: Heterocyclic Organic Compound. Alternative Names: 4-(alpha-D-Glucopyranosido)-alpha-glucopyranose;4-(alpha-D-Glucosido)-D-glucose;4-o-alpha-d-glucopyranosyl-d-glucos;4-O-Hexopyranosylhexose;alpha-Malt sugar;alpha-maltsugar;Cextromaltose;Maltos. CAS No. 69-79-4. Molecular formula: C12H22O11. Mole weight: 342.3. Melting Point: 110°C. | |
Maltose Quick inquiry Where to buy Suppliers range | Maltose is commonly used as a nutrient, and it can be also used in the preparation of culture media. Synonyms: D-(+)-Maltose. CAS No. 69-79-4. Molecular formula: C12H22O11. Mole weight: 342.297. | |
Maltose Quick inquiry Where to buy Suppliers range | Maltose. Uses: Used for research and manufacturing. Group: Pharmaceutical Excipients. CAS No. 69-79-4. Product ID: PE-0491. Categories: beta- 133-99-3, d- maltobiose, beta-d- beta-, cextro finetose. | |
Maltose alternan oligosaccharide Quick inquiry Where to buy Suppliers range | Maltose alternan oligosaccharide is a biomedical product used to study various health condition such as diabetes. Additionally, research suggests that it may have antioxidant and anti-inflammatory properties, making it useful in studying oxidative stress-related diseases. Synonyms: MAOS. | |
Maltose Monohydrate Quick inquiry Where to buy Suppliers range | United States Pharmacopeia (USP) Reference Standard. Uses: For analytical and research use. Group: Pharmacopeia & Metrological Institutes Standards; API Standards. Alternative Names: 5,6-Dimethoxy-1-indanone,Maltose Monohydrate. CAS No. 6363-53-7. Pack Sizes: 500MG. IUPAC Name: (2R,3R,4R,5R)-2,3,5,6-tetrahydroxy-4-[(2R,3R,4S,5S,6R)-3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]oxyhexanal;hydrate. Molecular formula: C12H22O11.H2O. Mole weight: 360.31. Catalog: APS6363537. SMILES: O. OC[C@@H] (O)[C@@H] (O[C@H]1O[C@H] (CO)[C@@H] (O)[C@H] (O)[C@H]1O)[C@H] (O)[C@@H] (O)C=O. Format: Neat. Product Type: API. Shipping: Room Temperature. | |
Maltose, Reagent Grade, 100 g Quick inquiry Where to buy Suppliers range | Formula: C12H22O11. H2O. Formula Wt: 360. 32. Storage Code: Green; general chemical storage. Alternative Names: Malt sugar. Grades: chem-grade reagent. CAS No. 6363-53-7. Product ID: 873750. -- SOLD FOR EDUCATIONAL USE ONLY -- | |
Maltose syrup Quick inquiry Where to buy Suppliers range | ||
Maltosine Quick inquiry Where to buy Suppliers range | Maltosine. Group: Biochemicals. Alternative Names: (a-S)-a-Amino-3-hydroxy-2-methyl-4-oxo-1(4H)-pyridinehexanoic acid; (S)-a-amino-3-hydroxy-2-methyl-4-oxo-1(4H)-pyridinehexanoic acid. Grades: Highly Purified. CAS No. 121502-04-3. Pack Sizes: 10g. Molecular Formula: C12H18N2O4. US Biological Life Sciences. | Worldwide |
Maltosyl-ascorbic acid Quick inquiry Where to buy Suppliers range | ||
Maltosyl trehalose Quick inquiry Where to buy Suppliers range | Maltosyl trehalose is a groundbreaking compound extensively employed in the biomedical sector, aiding in studying neurological afflictions like Alzheimer's disease. This compound exhibits noteworthy neuroprotective properties that can curb neuronal impairment. CAS No. 25545-20-4. Molecular formula: C24H42O21. Mole weight: 666.58. | |
Maltotetradecaose Quick inquiry Where to buy Suppliers range | Maltotetradecaose is a long branched chain of Maltose units, molecules which arecommonly found in foods and commonly utilized in brewing processes. Synonyms: O-α-D-glucopyranosyl-(1?4)-O-α-D-glucopyranosyl-(1?4)-O-α-D-glucopyranosyl-(1?4)-O-α-D-glucopyranosyl-(1?4)-O-α-D-glucopyranosyl-(1?4)-O-α-D-glucopyranosyl-(1?4)-O-α-D-glucopyranosyl-(1?4)-O-α-D-glucopyranosyl-(1?4)-O-α-D-glucopyranosyl-(1?4)-O-α-D-glucopyranosyl-(1?4)-O-α-D-glucopyranosyl-(1?4)-O-α-D-glucopyranosyl-(1?4)-O-α-D-glucopyranosyl-(1?4)-D-Glucose. CAS No. 107882-52-0. Molecular formula: C84H142O71. Mole weight: 2287.98. | |
Maltotetraitol Quick inquiry Where to buy Suppliers range | Maltotetraitol is a valuable compound aiding in studying various diseases such as diabetes and obesity. Its multifunctional nature enables it to enhance drug delivery systems, improve the stability of formulations and serve as an excipient in pharmaceutical preparations. Synonyms: a-D-glucopyranosyl-(1-4)-a-D-glucopyranosyl-(1-4)-a-D-glucopyranosyl-(1-4)-D-glucitol. CAS No. 66767-99-5. Molecular formula: C24H44O21. Mole weight: 668.59. | |
Maltotetraose Quick inquiry Where to buy Suppliers range | Maltotetraose is a resplendent biomedical compound, used for studying diabetes, orchestrating commendable blood glucose regulation. Synonyms: O-α-D-glucopyranosyl-(1?4)-O-α-D-glucopyranosyl-(1?4)-O-α-D-glucopyranosyl-(1?4)-D-Glucose; Amylotetraose; α-1,4-Tetraglucose; a-D-Glucopyranosyl-1,4-O-a-D-glucopyranosyl-1,4-O-a-D-glucopyranosyl-1,4-D-glucopyranose; D-maltotetraose. Grades: ≥95%. CAS No. 34612-38-9. Molecular formula: C24H42O21. Mole weight: 666.58. | |
Maltotetraose Quick inquiry Where to buy Suppliers range | Maltotetraose. Group: Biobased Products. Alternative Names: α-1,4-Tetraglucose. Grades: 97%. CAS No. 34612-38-9. Product ID: BBC34612389. Molecular formula: C24H42O21. Mole weight: 666.58. IUPAC Name: (2R,3R,4S,5S,6R)-2-[(2R,3S,4R,5R,6R)-6-[(2R,3S,4R,5R,6R)-4,5-Dihydroxy-2-(hydroxymethyl)-6-[(2R,3S,4R,5R,6S)-4,5,6-trihydroxy-2-(hydroxymethyl)oxan-3-yl]oxyoxan-3-yl]oxy-4,5-dihydroxy-2-(hydroxymethyl)oxan-3-yl]oxy-6-(hydroxymethyl)oxane-3,4,5-triol. Appearance: Viscous liquid. Density: 1.3922 g/cm³. SMILES: C (C1C (C (C (C (O1)OC2C (OC (C (C2O)O)OC3C (OC (C (C3O)O)OC4C (OC (C (C4O)O)O)CO)CO)CO)O)O)O)O. | |
Maltotetraose 2-aminobenzamide Quick inquiry Where to buy Suppliers range | Maltotetraose 2-aminobenzamide is a diagnostic compound widely used in the biomedical industry. It aids in the identification and analysis of various drugs and diseases. This product plays a crucial role in chemical research and drug discovery by providing accurate data on drug interactions, target identification and molecular mechanisms. Synonyms: Maltotetraose 2-AB. | |
Maltotetraose-APD-HSA Quick inquiry Where to buy Suppliers range | ||
Maltotetraose Deuterated Quick inquiry Where to buy Suppliers range | Maltotetraose Deuterated is an unlabelled form of Maltotetraose. Maltotetraose is a maltooligosaccharide that is used for research and diagnostic purposes. They can also be used in nutrients and healthcare. Uses: Sweetening agents. Synonyms: O-α-D-glucopyranosyl-(1?4)-O-α-D-glucopyranosyl-(1?4)-O-α-D-glucopyranosyl-(1?4)-D-Glucose; Amylotetraose; α-1,4-Tetraglucose Deuterated. Grades: 95%. Molecular formula: C24H42O21. Mole weight: 666.58. | |
Maltotetraosyl-b-cyclodextrin Quick inquiry Where to buy Suppliers range | ||
Maltotridecaose Quick inquiry Where to buy Suppliers range | Maltotridecaose is a long branched chain of Maltose units, molecules which arecommonly found in foods and commonly utilized in brewing processes. Synonyms: O-α-D-glucopyranosyl-(1?4)-O-α-D-glucopyranosyl-(1?4)-O-α-D-glucopyranosyl-(1?4)-O-α-D-glucopyranosyl-(1?4)-O-α-D-glucopyranosyl-(1?4)-O-α-D-glucopyranosyl-(1?4)-O-α-D-glucopyranosyl-(1?4)-O-α-D-glucopyranosyl-(1?4)-O-α-D-glucopyranosyl-(1?4)-O-α-D-glucopyranosyl-(1?4)-O-α-D-glucopyranosyl-(1?4)-O-α-D-glucopyranosyl-(1?4)-. CAS No. 100307-91-3. Molecular formula: C78H132O66. Mole weight: 2125.84. | |
Maltotriitol Quick inquiry Where to buy Suppliers range | Maltotriitol. Group: Biobased Products. Alternative Names: 4-O-(4-O-α-D-Glucopyranosyl-α-D-glucopyranosyl)-D-glucitol. Grades: 98%. CAS No. 32860-62-1. Product ID: BBC32860621. Molecular formula: C18H34O16. Mole weight: 506.45. IUPAC Name: (2S,3R,4R,5R)-4-[(2R,3R,4R,5S,6R)-3,4-dihydroxy-6-(hydroxymethyl)-5-[(2R,3R,4S,5S,6R)-3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]oxyoxan-2-yl]oxyhexane-1,2,3,5,6-pentol. Appearance: Solid. Density: 1.75±0.1 g/ml. SMILES: C ([C@@H]1[C@H] ([C@@H] ([C@H] ([C@H] (O1)O[C@@H]2[C@H] (O[C@@H] ([C@@H] ([C@H]2O)O)O[C@H] ([C@@H] (CO)O)[C@@H] ([C@H] (CO)O)O)CO)O)O)O)O. | |
Maltotriitol Quick inquiry Where to buy Suppliers range | Maltotriitol is a biomedical product used for the research of various digestive disorders and intestinal dysfunctions like irritable bowel syndrome, Crohn's disease and ulcerative colitis. Maltotriitol usually acts as a prebiotic. Synonyms: a-D-Glucopyranosyl-a-1,4-O-a-D-glucopyranosyl-1,4-D-glucitol. CAS No. 32860-62-1. Molecular formula: C18H34O16. Mole weight: 506.45. | |
Maltotriose Quick inquiry Where to buy Suppliers range | Maltotriose. Group: Heterocyclic Organic Compound. Alternative Names: O-ALPHA-D-GLUCOPYRANOSYL-(1->4)-O-ALPHA-D-GLUCOPYRANOSYL-(1->4)-D-GLUCOSE;O-ALPHA-D-GLUCOPYRANOSYL-(1->4)-O-ALPHA-D-GLUCOPYRANOSYL-(1->4)-O-ALPHA-D-GLUCOSE;TRIOMALTOSE;ALPHA-D-GLC-[1->4]-ALPHA-D-GLC-[1->4]-D-GLC;AMYLOTRIOSE;A-1,4-GLUCOTRIOSE;MALTOTRIOSE;MALTOTRIOSE, D-(+)-. CAS No. 1109-28-0. Molecular formula: C18H32O16. Mole weight: 504.44. Melting Point: 132-135°C. Safty Description: 24/25. | |
Maltotriose Quick inquiry Where to buy Suppliers range | It is a trisaccharide produced by the digestion of α-maltose enzyme. Synonyms: a-1,4-Glucotriose; O-α-D-Glucopyranosyl-(1->4)-O-α-D-glucopyranosyl-(1->4)-D-glucose; Amylotriose; NSC 170180; Triomaltose; D-Maltotriose; alpha-D-Glc-(1->4)-alpha-D-Glc-(1->4)-D-Glc. Grades: ≥98%. CAS No. 1109-28-0. Molecular formula: C18H32O16. Mole weight: 504.44. | |
Maltotriose Hydrate Quick inquiry Where to buy Suppliers range | White to off-white crystalline powder. Alternative Names: D-(+)-Maltotriose Hydrate. CAS No. 207511-08-8. Molecular Weight: 522.50. Molecular Formula: C18H34O17. | |
Maltotriose monohydrate Quick inquiry Where to buy Suppliers range | Maltotriose monohydrate is a specialized compound used in the research of glycogen storage diseases and diabetes-related complications. It acts as a glucose-releasing compound is assisting in the controlled delivery of glucose. Synonyms: Maltotriose xhydrate; Maltotriose hydrate, 95%; MALTOTRIOSE HYDRATE 95; (2R,3R,4S,5S,6R)-2-[(2R,3S,4R,5R,6R)-4,5-dihydroxy-2-(hydroxymethyl)-6-[(2R,3S,4R,5R)-4,5,6-trihydroxy-2-(hydroxymethyl)oxan-3-yl]oxyoxan-3-yl]oxy-6-(hydroxymethyl)oxane-3,4,5-triol; hydrate; (3R,4R,5S,6R)-5-(((2R,3R,4R,5S,6R)-3,4-Dihydroxy-6-(hydroxymethyl)-5-(((2R,3R,4S,5S,6R)-3,4,5-trihydroxy-6-(hydroxymethyl)tetrahydro-2H-pyran-2-yl)oxy)tetrahydro-2H-pyran-2-yl)oxy)-6-(hydroxymethyl)tetrahydro-2H-pyran-2,3,4-triol hydrate; D-(+)-Maltotriose hydrate; Maltotriose hydrate,95%; alpha-D-Glucopyranosyl-(1->4)-alpha-D-glucopyranosyl-(1->4)-D-glucopyranose--water (1/1); O-alpha-D-Glucopyranosyl-(1->4)-O-alpha-D-glucopyranosyl-(1->4)-O-alpha-D-glucose; D-Glucose, O-alpha-D-glucopyranosyl-(1-->4)-O-alpha-D-glucopyranosyl-(1-->4)-, hydrate (9CI). CAS No. 207511-08-8. Molecular formula: C18H32O16 H2O. Mole weight: 522.45. | |
Maltotriosemonohydrate Quick inquiry Where to buy Suppliers range | Maltotriosemonohydrate. Group: Biobased Products. Alternative Names: O-alpha-D-glucopyranosyl-(1-4)-O-alpha-D-glucopyranosyl-(1-4)-D-Glucose hydrate. Grades: 98%. CAS No. 207511-08-8. Product ID: BBC207511088. Molecular formula: C18H32O16. Mole weight: 504.44. IUPAC Name: (2R,3R,4S,5S,6R)-2-[(2R,3S,4R,5R,6R)-4,5-dihydroxy-2-(hydroxymethyl)-6-[(2R,3S,4R,5R)-4,5,6-trihydroxy-2-(hydroxymethyl)oxan-3-yl]oxyoxan-3-yl]oxy-6-(hydroxymethyl)oxane-3,4,5-triol;hydrate. SMILES: C ([C@@H]1[C@H] ([C@@H] ([C@H] ([C@H] (O1)O[C@@H]2[C@H] (O[C@@H] ([C@@H] ([C@H]2O)O)O[C@@H]3[C@H] (OC ([C@@H] ([C@H]3O)O)O)CO)CO)O)O)O)O. O. | |
Maltotriose - Technical Quick inquiry Where to buy Suppliers range | Maltotriose - Technical is an intricate carbohydrate compound, exhibiting paramount significance in the biomedical realm due to its multi-faceted and manifold applications in the spheres of molecular biology research and drug delivery systems. Esteemed for its exceptional attributes, it serves as an efficacious substrate for enzyme assays while also acting as a proficient and sophisticated complexing compound for specific pharmaceutical compounds. Consequently, its distinctive and unparalleled properties render it highly suitable for a diverse array of drug formulations devised to study formidable maladies including diabetes and obesity. Molecular formula: C18H32O16. Mole weight: 504.44. | |
Maltotriosyltrehalose Quick inquiry Where to buy Suppliers range | Maltotriosyltrehalose is a compound product used in the research of diabetes and metabolic disorders. Derived from maltose, it possesses potential antioxidant and anti-inflammatory properties. Synonyms: Maltotriosyltrehalose; 5HKU557F95; 142831-49-0; UNII-5HKU557F95; alpha-D-Glucopyranoside, alpha-D-glucopyranosyl o-alpha-D-glucopyranosyl-(1->4)-o-alpha-D-glucopyranosyl-(1->4)-o-alpha-D-glucopyranosyl-(1->4)-; Q27262207.ALPHA.-D-GLUCOPYRANOSIDE. ALPHA.-D-GLUCOPYRANOSYL O-.ALPHA.-D-GLUCOPYRANOSYL-(1->4)-O-.ALPHA.-D-GLUCOPYRANOSYL-(1->4)-O-.ALPHA.-D-GLUCOPYRANOSYL-(1->4)-. CAS No. 142831-49-0. Molecular formula: C20H52O26. Mole weight: 708.61. | |
Maltoundecaose Quick inquiry Where to buy Suppliers range | Maltoundecaose, an eminent biomedical product, acclaimed for its efficaciousness in tackling an array of ailments, epitomizes the pinnacle of scientific advancement. Its utilization as a robust adjunctive therapeutic agent in diabetes management stems from its unparalleled potential to meticulously regulate blood glucose levels. Furthermore, the extraordinary implications of maltoundecaose extend to the formidable combat against cardiovascular maladies and the relentless battle against cancer. Synonyms: Maltoundecose; Maltoundecaose; 50270-86-5; E87155. Molecular formula: C66H112O56. Mole weight: 1801.6. | |
Maltoundecose Quick inquiry Where to buy Suppliers range | Maltoundecose is a long branched chain of Maltose units, molecules which arecommonly found in foods and commonly utilized in brewing processes. Synonyms: O-α-D-glucopyranosyl-(1?4)-O-α-D-glucopyranosyl-(1?4)-O-α-D-glucopyranosyl-(1?4)-O-α-D-glucopyranosyl-(1?4)-O-α-D-glucopyranosyl-(1?4)-O-α-D-glucopyranosyl-(1?4)-O-α-D-glucopyranosyl-(1?4)-O-α-D-glucopyranosyl-(1?4)-O-α-D-glucopyranosyl-(1?4)-O-α-D-glucopyranosyl-(1?4)-D-Glucose. CAS No. 50270-86-5. Molecular formula: C66H112O56. Mole weight: 1801.56. | |
Maltulose H2O Quick inquiry Where to buy Suppliers range | Maltulose H2O is a cutting-edge compound, aiding in studying both obesity and diabetes. To revolutionize the development of conventional sweeteners, Maltulose H2O materializes as an indispensable instrument in the meticulous research of these intricate conditions. Synonyms: Maltulose monohydrate. Grades: >98.0%(GC). CAS No. 17606-72-3. Molecular formula: C12H20O10·H2O. Mole weight: 360.32. | |
Maltulose monohydrate Quick inquiry Where to buy Suppliers range | Maltulose monohydrate is a naturally occurring disaccharide widely utilized in the biomedical sector, used for the research of diabetes and obesity. Synonyms: 4-O-a-D-Glucopyranosyl-D-fructose monohydrate. CAS No. 207511-09-9. Molecular formula: C12H22O11 H2O. Mole weight: 360.32. | |
Malva Sylvestris Leaf Extract Quick inquiry Where to buy Suppliers range | Malva Sylvestris Leaf Extract. Uses: Conditioning agent in personal care products. Alternative Names: Malva Sylvestris (Mallow) Leaf Extract. CAS No. 84082-57-5. Product ID: ACM84082575-1. | |
Malvidin 3,5-diglucoside Quick inquiry Where to buy Suppliers range | Malvidin 3,5-diglucoside is a significant compound present in diverse fruits and vegetables, exhibiting remarkable antioxidant attributes and has been subject to extensive investigation regarding its prospective role in averting chronic ailments such as cancer, cardiovascular diseases and neurodegenerative disorders. Synonyms: Malvoside; Malvidin chloride 3,5-diglucoside; Malvin(chloride). CAS No. 16727-30-3. Molecular formula: C29H35O17Cl. Mole weight: 691.03. | |
Malvidin-3-galactoside chloride Quick inquiry Where to buy Suppliers range | Malvidin-3-galactoside chloride is a profoundly influential compound widely employed in the biomedical industry due to its immense therapeutic potential. With well-established acclaim for its formidable antioxidant prowess and remarkable anti-inflammatory attributes, this product showcases exceptional efficacy in combating an extensive range of afflictions including cancer, cardiovascular disorders, and neurodegenerative conditions. Synonyms: Primulin. CAS No. 30113-37-2. Molecular formula: C23H25ClO12. Mole weight: 528.9. | |
Malvidin 3-glucoside Quick inquiry Where to buy Suppliers range | Cas No. 7228-78-6. | |
Malvidin-3-O-arabinoside chloride Quick inquiry Where to buy Suppliers range | Malvidin-3-O-arabinoside chloride is found in the fruits of Vaccinium myrtillus, it shows antioxidant activity.It has potential preventive effect in colorectal diseases. Synonyms: Malvidin 3-arabinoside. Grades: > 95%. CAS No. 28500-04-1. Molecular formula: C22H23ClO11. Mole weight: 498.87. | |
Mambalgin 1 Quick inquiry Where to buy Suppliers range | Mambalgin-1 is a blocker of ASIC1 channels. Through inhibiting acid-sensing ion channels (ASICs) expressed either in central or peripheral neurons, Mambalgin-1 is able to abolish pain, thus it acts as an analgesic. Uses: Peptide Inhibitors. CAS No. 1609937-15-6. Product ID: R0971. | |
Mambalgin 1 Quick inquiry Where to buy Suppliers range | Mambalgin 1, a toxin isolated from black mamba venom, is a disulfide-rich polypeptide consisting of 57 amino acids and belongs to the family of three-finger toxins. Mambalgin 1 is a selective ASIC1a inhibitor (IC50= 192 and 72 nM for human ASIC1a and ASIC1a/1b dimer, respectively), and binds to closed/inactive channel. Synonyms: LKCYQHGKVVTCHRDMKFCYHNTGMPFRNLKLILQG CSSSCSETENNKCCSTDRCNK. Grades: >98%. CAS No. 1609937-15-6. Molecular formula: C272H429N85O84S10. Mole weight: 6554.51. | |
m-Aminobenzoic acid Quick inquiry Where to buy Suppliers range | m-Aminobenzoic acid. CAS No: 99-05-8 | Sarchem Laboratories New Jersey NJ |
m-Aminophenylboronic acid-Agarose Quick inquiry Where to buy Suppliers range | m-Aminophenylboronic acid-Agarose. Group: Salt. | |
M-Aminophenyltrimethoxysilane Quick inquiry Where to buy Suppliers range | M-Aminophenyltrimethoxysilane. Group: Silane Compound; Methoxysilane; Silsesquioxane and Organosilicone. CAS No. 70411-42-6. Pack Sizes: 10 g; 100 g. Product ID: ACM70411426-1. Molecular formula: C9H15NO3Si. Mole weight: 213.31 g/mol. Boiling Point: 110 °C. Flash Point: 106 °C. Density: 1.19 g/mL. | |
Mammaglobin-A (23-31) Quick inquiry Where to buy Suppliers range | Mammaglobin-A. Uses: Tumor Antigen Derived Peptides. CAS No. Product ID: ta-272. | |
Mammaglobin-A (23-31) Quick inquiry Where to buy Suppliers range | Mammaglobin-A (23-31) is a truncated fragment of Mammaglobin-A. Mammaglobin-A is an attractive target for immune-based therapy for patients with breast cancer because of its exclusive expression in breast cancer. | |
Mammaglobin-A precursor (2-10) Quick inquiry Where to buy Suppliers range | A peptide fragment of Mammaglobin-A precursor. Mammaglobin-A is an attractive target for immune-based therapy for patients with breast cancer because of its exclusive expression in breast cancer. | |
Mammaglobin-A precursor (2-10) Quick inquiry Where to buy Suppliers range | Mammaglobin-A. Uses: Tumor Antigen Derived Peptides. CAS No. Product ID: ta-092. | |
Mammaglobin-A precursor (32-40) Quick inquiry Where to buy Suppliers range | A peptide fragment of Mammaglobin-A precursor. Mammaglobin-A is an attractive target for immune-based therapy for patients with breast cancer because of its exclusive expression in breast cancer. | |
Mammaglobin-A precursor (32-40) Quick inquiry Where to buy Suppliers range | Mammaglobin-A. Uses: Tumor Antigen Derived Peptides. CAS No. Product ID: ta-100. | |
Mammaglobin-A precursor (4-12) Quick inquiry Where to buy Suppliers range | Mammaglobin-A. Uses: Tumor Antigen Derived Peptides. CAS No. Product ID: ta-096. | |
Mammaglobin-A precursor (4-12) Quick inquiry Where to buy Suppliers range | A peptide fragment of Mammaglobin-A precursor. Mammaglobin-A is an attractive target for immune-based therapy for patients with breast cancer because of its exclusive expression in breast cancer. | |
Mammaglobin-A precursor (66-74) Quick inquiry Where to buy Suppliers range | Mammaglobin-A. Uses: Tumor Antigen Derived Peptides. CAS No. Product ID: ta-087. | |
Mammaglobin-A precursor (66-74) Quick inquiry Where to buy Suppliers range | A peptide fragment of Mammaglobin-A precursor. Mammaglobin-A is an attractive target for immune-based therapy for patients with breast cancer because of its exclusive expression in breast cancer. | |
Mammaglobin-A precursor (83-92) Quick inquiry Where to buy Suppliers range | A peptide fragment of Mammaglobin-A precursor. Mammaglobin-A is an attractive target for immune-based therapy for patients with breast cancer because of its exclusive expression in breast cancer. | |
Mammaglobin-A precursor (83-92) Quick inquiry Where to buy Suppliers range | Mammaglobin-A. Uses: Tumor Antigen Derived Peptides. CAS No. Product ID: ta-094. | |
Mamu-A_01 SIV gag tetramer-CTPYDINQM-APC labeled Quick inquiry Where to buy Suppliers range | Mamu-A_01 SIV gag tetramer-CTPYDINQM-APC labeled. Uses: MHC-peptides Tetramer Class ?. Product ID: CPM-1-0485. |