A directory of where to buy chemicals in the USA, including: distributors, industrial manufacturers, bulk supplies and wholesalers of raw ingredients & finished goods.
Maltooligosyl trehalose trehalohydrolase from Bradyrhizobium sp., Recombinant
4-alpha-D-{(1->4)-alpha-D-glucano}trehalose trehalohydrolase (EC 3.2.1.141, malto-oligosyltrehalose trehalohydrolase) is an enzyme with system name 4-alpha-D-((1->4)-alpha-D-glucano)trehalose glucanohydrolase (trehalose-producing).This enzyme catalyses the following chemical reaction: hydrolysis of (1->4)-alpha-D-glucosidic linkage in 4-alpha-D-[(1->4)-alpha-D-glucanosyl]n trehalose to yield trehalose and (1->4)-alpha-D-glucan. Group: Enzymes. Synonyms: 4-α-D-{(1?4)-α-D-Glucano}trehalose trehalohydrolase; 4-α-D-(1,4-α-D-glucano)trehalose glucanohydrolase (trehalose-producing); 4-alpha-D. Enzyme Commission Number: EC 3.2.1.141. CAS No. 170780-50-4. Purity: > 95 % as judged by SDS-PAGE. Maltooligosyl trehalose trehalohydrolase. Mole weight: 69634.7 Da. Storage: Store at 4°C (shipped at room temperature). Form: Supplied in 3.2 M ammonium sulphate. Source: Bradyrhizobium sp. BTAi1. 4-α-D-{(1?4)-α-D-Glucano}trehalose trehalohydrolase; 4-α-D-(1,4-α-D-glucano)trehalose glucanohydrolase (trehalose-producing); 4-alpha-D-{(1?4)-alpha-D-glucano}trehalose trehalohydrolase; 4-alpha-D-(1,4-alpha-D-glucano)trehalose glucanohydrolase (trehalose-producing); Malto-oligosyltrehalose trehalohydrolase; EC 3.2.1.141; Maltooligosyl trehalose trehalohydrolase. Cat No: NATE-1215.
Maltopentaose
Maltopentaose is the shortest chain oligosaccharide. Maltopentaose is a substrate for ?-amylases. Maltopentaose can be classified as maltodextrin and is also used in a study to investigate glycation and phosphorylation of ?-lactalbumin. Maltopentaose is used to study the inhibition kinetics of human pancreatic ?-amylase by dehydrodieugenol B[1][2][3]. Uses: Scientific research. Group: Natural products. Alternative Names: Maltopentose. CAS No. 34620-76-3. Pack Sizes: 10 mM * 1 mL; 5 mg; 10 mg. Product ID: HY-N1495.
Maltopentaose-[UL-13C30]
Labelled Maltopentaose. Maltopentaose is used in a study to investigate glycation and phosphorylation of α-lactalbumin. Molecular formula: [13C]30H52O26. Mole weight: 858.49.
Maltophilin
It is produced by the strain of Stenotrophomonas maltophilia. It is a broad-spectrum antifungal antibiotic that has no antibacterial effect against gram-positive and gram-negative bacteria. Molecular formula: C29H38N2O6. Mole weight: 510.62.
Maltose
Beta-maltose is a maltose that has beta-configuration at the reducing end anomeric centre. It has a role as a geroprotector. Alternative Names: beta-maltose. 133-99-3. D-Maltose. CAS No. 69-79-4. Product ID: CHE69794. Molecular formula: C12H22O11. Mole weight: 342.3. EINECS: 200-716-5. SMILES: C([C@@H]1[C@H]([C@@H]([C@H]([C@H](O1)O[C@@H]2[C@H](OC([C@@H]([C@H]2O)O)O)CO)O)O)O)O. Appearance: White odorless crystals. Category: Food Additives.
Maltose
Maltose. CAS No. 69-79-4. Product ID: PE-0491. Category: Sweetening agent. Product Keywords: Pharmaceutical Excipients; Excipients for Solid Dosage Form; Maltose; Sweeteners Excipients; Sweetening agent; 69-79-4; 69-79-4. UNII: NA. Chemical Name: 4-O-α-D-Glucopyranosyl-β-D-Glucopyranose anhydrous; 4-O-α-D-Glucopyranosyl-β-D-Glucopyranose monohydrate. Administration route: Oral; Injection. Dosage Form: Oral solutions; Injections. Stability and Storage Conditions: Maltose should be stored in an airtight container in a cool, dry place. Source and Preparation: Maltose monohydrate was prepared by enzymic degradation of starch. Applications: Maltose is a disaccharide widely used in food and pharmaceutical preparations. In injectable products, maltose can be used as a sugar source, especially for diabetics. Maltose crystals can be used as direct tablet excipients for chewable tablets and non-chewable tablets.
Maltose
Maltose is a disaccharide formed from two units of glucose joined with an α(1→4) bond, a reducing sugar. Maltose monohydrate can be used as a energy source for bacteria. Uses: Scientific research. Group: Natural products. CAS No. 69-79-4. Pack Sizes: 500 mg; 1 g; 5 g. Product ID: HY-N2024.
Hydrolyses a variety of 6-phospho-α-D-glucosides, including α-maltose 6'-phosphate, α,α-trehalose 6-phosphate, sucrose 6-phosphate and p-nitrophenyl-α-D-glucopyranoside 6-phosphate (as a chromogenic substrate). The enzyme is activated by FeII, MnII, CoII and NiII. It is rapidly inactivated in air. Group: Enzymes. Synonyms: phospho-α-glucosidase; maltose-6'-phosphate 6-phosphoglucohydrolase. Enzyme Commission Number: EC 3.2.1.122. CAS No. 98445-08-0. Storage: Store it at +4 ?C for short term. For long term storage, store it at -20 ?C?-80 ?C. Form: Liquid or lyophilized powder. EXWM-3805; maltose-6'-phosphate glucosidase; EC 3.2.1.122; 98445-08-0; phospho-α-glucosidase; maltose-6'-phosphate 6-phosphoglucohydrolase. Cat No: EXWM-3805.
maltose 6'-phosphate phosphatase
The enzyme from the bacterium Enterococcus faecalis also has activity with the sucrose isomer turanose 6'-phosphate (α-D-glucopyranosyl-(1?3)-D-fructose 6-phosphate). Group: Enzymes. Synonyms: maltose 6'-P phosphatase; mapP (gene name). Enzyme Commission Number: EC 3.1.3.90. Storage: Store it at +4 ?C for short term. For long term storage, store it at -20 ?C?-80 ?C. Form: Liquid or lyophilized powder. EXWM-3697; maltose 6'-phosphate phosphatase; EC 3.1.3.90; maltose 6'-P phosphatase; mapP (gene name). Cat No: EXWM-3697.
This enzyme belongs to the family of isomerases, specifically those intramolecular transferases transferring other groups. This enzyme participates in starch and sucrose metabolism. Group: Enzymes. Synonyms: trehalose synthase; maltose glucosylmutase. Enzyme Commission Number: EC 5.4.99.16. CAS No. 395644-91-4. Storage: Store it at +4 ?C for short term. For long term storage, store it at -20 ?C?-80 ?C. Form: Liquid or lyophilized powder. EXWM-5555; maltose α-D-glucosyltransferase; EC 5.4.99.16; 395644-91-4; trehalose synthase; maltose glucosylmutase. Cat No: EXWM-5555.
This enzyme belongs to the family of isomerases, specifically those intramolecular transferases transferring other groups. This product with the indicated enzyme activity was briefly purified from engineered E.coli. Applications: Synthesis; medicine. Group: Enzymes. Synonyms: trehalose synthase; maltose glucosylmutase. Enzyme Commission Number: EC 5.4.99.16. CAS No. 147994-22-7. Activity: Undetermined. Appearance: Clear to translucent yellow solution. Storage: at -20 °C or lower, for at least 1 month. Source: E. coli. trehalose synthase; maltose glucosylmutase. Pack: 100ml. Cat No: NATE-1858.
The enzyme catalyses the interconversion of α and β anomers of maltose more effectively than those of disaccharides such as lactose and cellobiose. Group: Enzymes. Enzyme Commission Number: EC 5.1.3.21. CAS No. 166799-98-0. MER. Storage: Store it at +4 ?C for short term. For long term storage, store it at -20 ?C?-80 ?C. Form: Liquid or lyophilized powder. EXWM-5407; maltose epimerase; EC 5.1.3.21; 166799-98-0. Cat No: EXWM-5407.
Maltose monohydrate
Maltose monohydrate is the energy source for bacteria. Uses: Scientific research. Group: Natural products. CAS No. 6363-53-7. Pack Sizes: 10 mM * 1 mL; 10 g; 25 g. Product ID: HY-N2024A.
Maltose Monohydrate
United States Pharmacopeia (USP) Reference Standard. Group: Pharmacopeia & metrological institutes standardsapi standards. Alternative Names: 5,6-Dimethoxy-1-indanone,Maltose Monohydrate.
United States Pharmacopeia (USP) Reference Standard. Uses: For analytical and research use. Group: Pharmacopeia & metrological institutes standards; api standards. Alternative Names: 5,6-Dimethoxy-1-indanone,Maltose Monohydrate. CAS No. 6363-53-7. Pack Sizes: 500MG. IUPAC Name: (2R,3R,4R,5R)-2,3,5,6-tetrahydroxy-4-[(2R,3R,4S,5S,6R)-3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]oxyhexanal;hydrate. Molecular formula: C12H22O11.H2O. Mole weight: 360.31. Catalog: APS6363537. SMILES: O.OC[C@@H](O)[C@@H](O[C@H]1O[C@H](CO)[C@@H](O)[C@H](O)[C@H]1O)[C@H](O)[C@@H](O)C=O. Format: Neat. Shipping: Room Temperature.
Maltose monohydrate (Standard)
Maltose monohydrate (Standard) is the analytical standard of Maltose monohydrate. This product is intended for research and analytical applications. Maltose monohydrate is the energy source for bacteria. Uses: Scientific research. Group: Natural products. CAS No. 6363-53-7. Pack Sizes: 25 mg; 50 mg; 100 mg; 250 mg. Product ID: HY-N2024AR.
maltose O-acetyltransferase
Not identical with EC 2.3.1.18, galactoside O-acetyltransferase. The acetyl group is added exclusively to the C6 position of glucose and to the C6 position of the non-reducing glucose residue of maltose. Other substrates of this enzyme are glucose, which is a better substrate than maltose, and mannose and frucose, which are poorer substrates than maltose. Isopropyl-β-thio-galactose, which is a good substrate for EC 2.3.1.118 is a poor substrate for this enzyme. Group: Enzymes. Synonyms: maltose transacetylase; maltose O-acetyltransferase; MAT. Enzyme Commission Number: EC 2.3.1.79. CAS No. 81295-47-8. Storage: Store it at +4 ?C for short term. For long term storage, store it at -20 ?C?-80 ?C. Form: Liquid or lyophilized powder. EXWM-2259; maltose O-acetyltransferase; EC 2.3.1.79; 81295-47-8; maltose transacetylase; maltose O-acetyltransferase; MAT. Cat No: EXWM-2259.
maltose phosphorylase
This enzyme belongs to the family of glycosyltransferases, specifically the hexosyltransferases. The systematic name of this enzyme class is maltose:phosphate 1-beta-D-glucosyltransferase. This enzyme participates in starch and sucrose metabolism. Group: Enzymes. Enzyme Commission Number: EC 2.4.1.8. CAS No. 9030-19-7. MP. Storage: Store it at +4 ?C for short term. For long term storage, store it at -20 ?C?-80 ?C. Form: Liquid or lyophilized powder. EXWM-2620; maltose phosphorylase; EC 2.4.1.8; 9030-19-7. Cat No: EXWM-2620.
Maltose phosphorylase
Maltose phosphorylase is a dimerase which catalyzes the transformation of maltose and inorganic phosphate into β-D-glucose-1-phosphate and glucose. Maltose phosphorylases have been classified in family 65 of the glycoside hydrolases [1]. Uses: Scientific research. Group: Signaling pathways. Alternative Names: E.C. 2.4.1.8. CAS No. 9030-19-7. Pack Sizes: 50 U; 250 U. Product ID: HY-P2741.
Maltose Phosphorylase from E. coli, Recombinant
Maltose phosphorylase (MP) is a dimeric enzyme that catalyzes maltose and inorganic phosphate into β-D-glucose-1-phosphate and glucose. Group: Enzymes. Synonyms: maltose phosphorylase; maltose:phosphate 1-β-D-glucosyltransferase; EC 2.4.1.8; 9030-19-7; MP. Enzyme Commission Number: EC 2.4.1.8. CAS No. 9030-19-7. MP. Mole weight: ca. 220 kDa. Activity: > 10 U/mg lyophilizate. Stability: Stability (liquid form) stable at 37°C for at least one week Stability (powder form) stable at 30°C for at least four weeks. Appearance: White lyophilizate. Storage: at -20°C. Source: E. coli. Species: E. coli. maltose phosphorylase; maltose:phosphate 1-β-D-glucosyltransferase; EC 2.4.1.8; 9030-19-7; MP. Cat No: NATE-1250.
Maltose Phosphorylase from Enterococcus sp., Recombinant
Maltose phosphorylase (MP) is a dimeric enzyme that catalyzes maltose and inorganic phosphate into β-D-glucose-1-phosphate and glucose. Maltose phosphorylase (mp) is a dimeric enzyme that catalyzes maltose and inorganic phosphate into β-d-glucose-1-phosphate and glucose. Applications: Maltose phosphorylase from enter oc occus has been used in a study to describe a new pathway for maltose utilization in lactic acid bacteria. it has also been used in a study to describe the transfer of glucosyl moiety of maltose to acceptors with alcoholic oh groups. Group: Enzymes. Synonyms: maltose phosphorylase; maltose:phosphate 1-β-D-glucosyltransferase; EC 2.4.1.8; 9030-19-7; MP. Enzyme Commission Number: EC 2.4.1.8. CAS No. 9030-19-7. MP. Mole weight: mol wt 90 kDa by SDS-PAGE. Storage: -20°C. Form: lyophilized powder. Source: E. coli. Species: Enterococcus sp. maltose phosphorylase; maltose:phosphate 1-β-D-glucosyltransferase; EC 2.4.1.8; 9030-19-7; MP. Cat No: NATE-0456.
Maltose, Reagent Grade, 100 g
Formula: C12H22O11. H2O. Formula Wt: 360. 32. Storage Code: Green; general chemical storage. Alternative Names: Malt sugar. Grades: chem-grade reagent. CAS No. 6363-53-7. Product ID: 873750. -- SOLD FOR EDUCATIONAL USE ONLY --
maltose synthase
Neither free phosphate nor maltose 1-phosphate is an intermediate in the reaction. Group: Enzymes. Enzyme Commission Number: EC 2.4.1.139. CAS No. 81669-74-1. Storage: Store it at +4 ?C for short term. For long term storage, store it at -20 ?C?-80 ?C. Form: Liquid or lyophilized powder. EXWM-2364; maltose synthase; EC 2.4.1.139; 81669-74-1. Cat No: EXWM-2364.
maltose-transporting ATPase
ABC-type (ATP-binding cassette-type) ATPase, characterized by the presence of two similar ATP-binding domains. Does not undergo phosphorylation during the transport process. Comprises bacterial enzymes that import maltose and maltose oligosaccharides. Group: Enzymes. Enzyme Commission Number: EC 7.5.2.1 (Formerly EC 3.6.3.19). Storage: Store it at +4 ?C for short term. For long term storage, store it at -20 ?C?-80 ?C. Form: Liquid or lyophilized powder. EXWM-4655; maltose-transporting ATPase; EC 3.6.3.19. Cat No: EXWM-4655.
Maltosine
Maltosine. Group: Biochemicals. Alternative Names: (a-S)-a-Amino-3-hydroxy-2-methyl-4-oxo-1(4H)-pyridinehexanoic acid; (S)-a-amino-3-hydroxy-2-methyl-4-oxo-1(4H)-pyridinehexanoic acid. Grades: Highly Purified. CAS No. 121502-04-3. Pack Sizes: 10g. Molecular Formula: C12H18N2O4. US Biological Life Sciences.
Worldwide
Maltotetraose
Maltotetraose can serve as a substrate for enzyme-linked assays to measure amylase activity in biological fluids. Maltotetraose has oral active, and reduces TNF-α -induced inflammatory responses by inhibiting NF-κB activity and decreasing ICAM-1 expression. Maltotetraose also inhibits PDGF -induced vascular smooth muscle cell migration and neovascularization. Additionally, Maltotetraose derivatives can function as probes for detecting bacterial infections by targeting the maltodextrin transporter. With good long-term safety, Maltotetraose holds promise for research in atherosclerosis-related diseases [1] [2] [3] [4]. Uses: Scientific research. Group: Natural products. Alternative Names: Amylotetraose; Fujioligo 450; α-1,4-Tetraglucose. CAS No. 34612-38-9. Pack Sizes: 10 mM * 1 mL; 5 mg; 10 mg; 25 mg; 50 mg. Product ID: HY-N2464.
Maltotetraose-[UL-13C24]
Maltotetraose-[UL-13C24] is a 13C labelled analogue of Maltotetraose, which is a maltooligosaccharide that is used for research and diagnostic purposes. Maltotetraose-[13C2] itself can be also used as a standard in diagnostic purposes. Molecular formula: [13C]24H42O21. Mole weight: 690.39.
Maltotriose
United States Pharmacopeia (USP) Reference Standard. Group: Pharmacopeia & metrological institutes standards.
Maltotriose
Maltotriose, the second most abundant sugar present in brewing, is an inducer of the maltose regulon of Escherichia coli. Maltotriose can induce beta-galactosidase synthesis [1] [2]. Uses: Scientific research. Group: Natural products. CAS No. 1109-28-0. Pack Sizes: 10 mM * 1 mL; 100 mg. Product ID: HY-113011.
Maltotriose
Maltotriose is a trisaccharide (three-part sugar) consisting of three glucose molecules linked with α-1,4 glycosidic bonds.It is most commonly produced by the digestive enzyme alpha-amylase (a common enzyme in human saliva) on amylose in starch. The creation of both maltotriose and maltose during this process is due to the random manner in which alpha amylase hydrolyses α-1,4 glycosidic bonds.It is the shortest chain oligosaccharide that can be classified as maltodextrin. Group: Polysaccharide. Alternative Names: 4-O-[4-O-(α-D-Glucopyranosyl)-α-D-glucopyranosyl]-D-glucose. CAS No. 1109-28-0. Product ID: (2R,3R,4S,5S,6R)-2-[(2R,3S,4R,5R,6R)-4,5-Dihydroxy-2-(hydroxymethyl)-6-[(2R,3S,4R,5R)-4,5,6-trihydroxy-2-(hydroxymethyl)oxan-3-yl]oxyoxan-3-yl]oxy-6-(hydroxymethyl)oxane-3,4,5-triol. Molecular formula: 504.44. Mole weight: C18H32O16. C (C1C (C (C (C (O1)OC2C (OC (C (C2O)O)OC3C (OC (C (C3O)O)O)CO)CO)O)O)O)O. InChI=1S/C18H32O16/c19-1-4-7 (22)8 (23)12 (27)17 (31-4)34-15-6 (3-21)32-18 (13 (28)10 (15)25)33-14-5 (2-20)30-16 (29)11 (26)9 (14)24/h4-29H, 1-3H2/t4-, 5-, 6-, 7-, 8+, 9-, 10-, 11-, 12-, 13-, 14-, 15-, 16?, 17-, 18-/m1/s1. FYGDTMLNYKFZSV-DZOUCCHMSA-N. 98%.
Maltotriose
?90% (HPLC). Group: Polysaccharide.
Maltotriose Hydrate
Maltotriose Hydrate. Uses: Designed for use in research and industrial production. Additional or Alternative Names: D-(+)-Maltotriose Hydrate. Appearance: White to off-white crystalline powder. CAS No. 207511-08-8. Molecular formula: C18H34O17. Mole weight: 522.5. Purity: 0.95. Product ID: ACM207511088. Alfa Chemistry ISO 9001:2015 Certified.
Maltulose monohydrate (4-O-α-D-Glucopyranosyl-D-fructose monohydrate) can be used as an energy source for bacteria. Maltulose monohydrate is a biomaterial or organic compound that can be used in life science research [1]. Uses: Scientific research. Group: Biochemical assay reagents. Alternative Names: 4-O-α-D-Glucopyranosyl-D-fructose monohydrate. CAS No. 207511-09-9. Pack Sizes: 50 mg; 100 mg. Product ID: HY-W415909.
Mal-Val-Ala-PAB-N(SO2Me)-Exatecan
Mal-Val-Ala-PAB-N(SO2Me)-Exatecan (Compound LE14) is a conjugate of an ADC toxin Exatecan (HY-13631) and a linker Mal-Val-Ala-PAB-N(SO2Me). Mal-Val-Ala-PAB-N(SO2Me)-Exatecan can be used for synthesis of ADC FZ-AD005. FZ-AD005 is a delta-like ligand 3 (DLL3, KD=58.3 pM) targeting ADC, that exhibits antitumor efficacy against SCLC cancer[1][2]. Uses: Scientific research. Group: Signaling pathways. CAS No. 2575682-08-3. Pack Sizes: 1 mg; 5 mg; 10 mg. Product ID: HY-159072.
Mal-VC-PAB-DM1
Mal-VC-PAB-DM1 is a agent-linker conjugate for ADC with potent antitumor activity by using DM1 (a potent microtubule-disrupting agent), linked via the ADC linker Mal-VC-PAB [1]. Uses: Scientific research. Group: Signaling pathways. CAS No. 1464051-44-2. Pack Sizes: 1 mg; 5 mg; 10 mg; 25 mg; 50 mg; 100 mg. Product ID: HY-126682.
Malvidin-3-galactoside chloride
Malvidin-3-galactoside chloride, an anthocyanin monomer, induces hepatocellular carcinoma (HCC) cells cycle arrest and apoptosis. Malvidin-3-galactoside chloride inhibits the production and accumulation of ROS. Malvidin-3-galactoside chloride has anti-tumor function [1]. Uses: Scientific research. Group: Natural products. CAS No. 30113-37-2. Pack Sizes: 1 mg; 5 mg. Product ID: HY-N6623.
Malvidin-3-galactoside chloride
analytical standard. Group: Chemical class.
Malvidin-3-glucoside chloride
Malvidin-3-glucoside chloride (Malvidin-3-O-glucoside chloride), a major wine anthocyanin, is effective in promoting resilience against stress by modulating brain synaptic plasticity and peripheral inflammation [1]. Uses: Scientific research. Group: Natural products. Alternative Names: Malvidin-3-O-glucoside chloride; Oenin chloride. CAS No. 7228-78-6. Pack Sizes: 1 mg; 5 mg. Product ID: HY-125740.
Malvidin chloride
Malvidin (chloride) is a bioactive compound isolated from grape. Malvidin shows cytotoxicity through the arrest of the G 2 /M phase of cell cycle and induction of apoptosis. Malvidin can be used for the research of cancer [1]. Uses: Scientific research. Group: Natural products. Alternative Names: Syringidin. CAS No. 643-84-5. Pack Sizes: 5 mg; 10 mg. Product ID: HY-122496.
Malvin(chloride)
?90% (HPLC). Group: Chemical class.
malyl-CoA lyase
The enzyme from the bacterium Chloroflexus aurantiacus, which participates in the 3-hydroxypropanoate cycle for carbon assimilation, also has the activity of EC 4.1.3.25, (3S)-citramalyl-CoA lyase. The enzymes from Rhodobacter species are part of acetate assimilation pathways. The reactions are reversible. Group: Enzymes. Synonyms: malyl-coenzyme A lyase; (3S)-3-carboxy-3-hydroxypropanoyl-CoA glyoxylate-lyase; mclA (gene name); mcl1 (gene name); (3S)-3-carboxy-3-hydroxypropanoyl-CoA glyoxylate-lyase (acetyl-CoA-forming); L-malyl-CoA lyase. Enzyme Commission Number: EC 4.1.3.24. CAS No. 37290-67-8. Storage: Store it at +4 ?C for short term. For long term storage, store it at -20 ?C?-80 ?C. Form: Liquid or lyophilized powder. EXWM-4904; malyl-CoA lyase; EC 4.1.3.24; 37290-67-8; malyl-coenzyme A lyase; (3S)-3-carboxy-3-hydroxypropanoyl-CoA glyoxylate-lyase; mclA (gene name); mcl1 (gene name); (3S)-3-carboxy-3-hydroxypropanoyl-CoA glyoxylate-lyase (acetyl-CoA-forming); L-malyl-CoA lyase. Cat No: EXWM-4904.
An isotope labelled of MAM2201 N-(4-hydroxypentyl). MAM2201 N-(4-hydroxypentyl) is a synthetic cannabinoid (CB) agonist that displays high affinity for CB receptors. Grade: 95% by HPLC; 98% atom D. Molecular formula: C25H19D5FNO2. Mole weight: 394.5.
Mambalgin 1
Mambalgin 1, a toxin isolated from black mamba venom, is a disulfide-rich polypeptide consisting of 57 amino acids and belongs to the family of three-finger toxins. Mambalgin 1 is a selective ASIC1a inhibitor (IC50= 192 and 72 nM for human ASIC1a and ASIC1a/1b dimer, respectively), and binds to closed/inactive channel. Synonyms: LKCYQHGKVVTCHRDMKFCYHNTGMPFRNLKLILQGCSSSCSETENNKCCSTDRCNK. Grade: >98%. CAS No. 1609937-15-6. Molecular formula: C272H429N85O84S10. Mole weight: 6554.51.
m-Aminobenzoic acid
m-Aminobenzoic acid. CAS No: 99-05-8
Sarchem Laboratories New Jersey NJ
M-AMINOBENZYL CYANIDE
M-AMINOBENZYL CYANIDE. Uses: Designed for use in research and industrial production. Additional or Alternative Names: M-AMINOBENZYL CYANIDE;3-AMINOBENZYL CYANIDE;2-(3-Aminophenyl)acetonitrile. Product Category: Heterocyclic Organic Compound. CAS No. 4623-24-9. Molecular formula: C8H8N2. Mole weight: 132.16. Product ID: ACM4623249. Alfa Chemistry ISO 9001:2015 Certified. Categories: (3-AMINO-PHENYL)-ACETONITRILE.
m-Aminoglutethimide
United States Pharmacopeia (USP) Reference Standard. Group: Pharmacopeia & metrological institutes standards.
m-Aminophenylboronic acid-Agarose
m-Aminophenylboronic acid-Agarose. Group: Salt.
Mammaglobin-A (23-31)
Mammaglobin-A (23-31) is a truncated fragment of Mammaglobin-A. Mammaglobin-A is an attractive target for immune-based therapy for patients with breast cancer because of its exclusive expression in breast cancer.
Mammaglobin-A precursor (2-10)
A peptide fragment of Mammaglobin-A precursor. Mammaglobin-A is an attractive target for immune-based therapy for patients with breast cancer because of its exclusive expression in breast cancer.
Mammaglobin-A precursor (32-40)
A peptide fragment of Mammaglobin-A precursor. Mammaglobin-A is an attractive target for immune-based therapy for patients with breast cancer because of its exclusive expression in breast cancer.
Mammaglobin-A precursor (4-12)
A peptide fragment of Mammaglobin-A precursor. Mammaglobin-A is an attractive target for immune-based therapy for patients with breast cancer because of its exclusive expression in breast cancer.
Mammaglobin-A precursor (66-74)
A peptide fragment of Mammaglobin-A precursor. Mammaglobin-A is an attractive target for immune-based therapy for patients with breast cancer because of its exclusive expression in breast cancer.
Mammaglobin-A precursor (83-92)
A peptide fragment of Mammaglobin-A precursor. Mammaglobin-A is an attractive target for immune-based therapy for patients with breast cancer because of its exclusive expression in breast cancer.
Mancozeb is a fungicide used to protect crops in agriculture. Synonyms: Manganese Zinc ethylenebis(dithiocarbamate). CAS No. 8018-1-7. Molecular formula: C8H12MnN4S8Zn. Mole weight: 541.1.
Mancozeb is a widely used fungicide that is effective against fungal diseases in most cereals, vegetables, fruits and ornamental plants. In addition, Mancozeb can cause liver damage in mice by activating the Keap1/Nrf2 signaling pathway. Mancozeb upregulates lactate dehydrogenase and cytochrome c to alter cell metabolism and induce cell death. Mancozeb has reproductive toxicity and can induce apoptosis in ovarian cells [1] [2] [3] [4]. Uses: Scientific research. Group: Signaling pathways. CAS No. 8018-1-7. Pack Sizes: 500 mg; 1 g. Product ID: HY-B0854.
Mandarin oil. Uses: Designed for use in research and industrial production. Additional or Alternative Names: Citrus nobilis oil. Product Category: Heterocyclic Organic Compound. CAS No. 8008-31-9. Molecular formula: CAS: 8008-31-9. Density: 0.846 g/mL at 25 °C. Product ID: ACM8008319. Alfa Chemistry ISO 9001:2015 Certified. Categories: Mandarin Films Distribution Co. Ltd.
This enzyme belongs to the family of hydrolases, those acting on carbon-nitrogen bonds other than peptide bonds, specifically in linear amides. The systematic name of this enzyme class is mandelamide hydrolase. This enzyme is also called Pseudomonas mandelamide hydrolase. Group: Enzymes. Synonyms: Pseudomonas mandelamide hydrolase. Enzyme Commission Number: EC 3.5.1.86. Storage: Store it at +4 ?C for short term. For long term storage, store it at -20 ?C?-80 ?C. Form: Liquid or lyophilized powder. EXWM-4477; mandelamide amidase; EC 3.5.1.86; Pseudomonas mandelamide hydrolase. Cat No: EXWM-4477.
mandelate 4-monooxygenase
Requires Fe2+. Group: Enzymes. Synonyms: L-mandelate 4-hydroxylase; mandelic acid 4-hydroxylase. Enzyme Commission Number: EC 1.14.16.6. CAS No. 39459-82-0. Storage: Store it at +4 ?C for short term. For long term storage, store it at -20 ?C?-80 ?C. Form: Liquid or lyophilized powder. EXWM-0958; mandelate 4-monooxygenase; EC 1.14.16.6; 39459-82-0; L-mandelate 4-hydroxylase; mandelic acid 4-hydroxylase. Cat No: EXWM-0958.