A directory of where to buy chemicals in the USA, including: distributors, industrial manufacturers, bulk supplies and wholesalers of raw ingredients & finished goods.
Also acts on N-acyl-L-arginine and, more slowly, on L-arginine esters. Group: Enzymes. Synonyms: peptidylarginine deiminase; PAD. Enzyme Commission Number: EC 3.5.3.15. CAS No. 75536-80-0. PAD. Storage: Store it at +4 ?C for short term. For long term storage, store it at -20 ?C?-80 ?C. Form: Liquid or lyophilized powder. EXWM-4517; protein-arginine deiminase; EC 3.5.3.15; 75536-80-0; peptidylarginine deiminase; PAD. Cat No: EXWM-4517.
protein arginine kinase
The enzyme, characterized from Gram-positive bacteria, is involved in the regulation of the bacterial stress response. Group: Enzymes. Synonyms: McsB. Enzyme Commission Number: EC 2.7.14.1. Storage: Store it at +4 ?C for short term. For long term storage, store it at -20 ?C?-80 ?C. Form: Liquid or lyophilized powder. EXWM-3166; protein arginine kinase; EC 2.7.14.1; McsB. Cat No: EXWM-3166.
protein arginine phosphatase
The enzyme, characterized from Gram-positive bacteria, hydrolyses the phosphoramidate (P-N) bond of Nω-phospho-L-arginine residues in proteins and peptides that were phosphorylated by EC 2.7.14.1, protein-arginine-kinase. Group: Enzymes. Synonyms: YwlE. Enzyme Commission Number: EC 3.9.1.2. Storage: Store it at +4 ?C for short term. For long term storage, store it at -20 ?C?-80 ?C. Form: Liquid or lyophilized powder. EXWM-4750; protein arginine phosphatase; EC 3.9.1.2; YwlE. Cat No: EXWM-4750.
Proteinase, Aspergillus oryzae refers to the enzymes with proteolytic activity. Uses: Scientific research. Group: Biochemical assay reagents. CAS No. 9001-92-7. Pack Sizes: 500 mg; 1 g. Product ID: HY-B2228.
Proteinase, bacterial
Type XXIV, 7.0-14.0 units/mg solid, lyophilized powder. Group: Fluorescence/luminescence spectroscopy.
Proteinase K
100mg Pack Size. Group: Biochemicals, Diagnostic Raw Materials, Research Organics & Inorganics. Formula: C29H27N2O12P. CAS No. 39450-01-6. Prepack ID 49085587-100mg. Molecular Weight 626.5. See USA prepack pricing.
Proteinase K
Proteinase K (Protease K) is a nonspecific serine protease that is useful for general digestion of proteins. Proteinase K is active in the presence of SDS or urea and over a wide range of pH (4-12), salt concentrations, and temperatures. Proteinase K can be use for promoting methods of viral nucleic acid extraction, and detection [1] [2] [3] [4]. Uses: Scientific research. Group: Signaling pathways. Alternative Names: Protease K. CAS No. 39450-01-6. Pack Sizes: 25 mg; 50 mg; 100 mg; 500 mg. Product ID: HY-108717.
Proteinase K
Proteinase K is a subtilisin-related serine protease. It was discovered from the fungus Engyodontium album. It can be used for removal of endogenous nucleases during the preparation of DNA and RNA, and for preparation of tissue sections for in situ hybridization. It is often used in pH range 7.5-9.0 and 37-70°C. Specific activity is ≥ 34 units/mg of protein. Synonyms: EC 3.4.21.64; endopeptidase K; Tritirachium alkaline proteinase; Tritirachium album serine proteinase; Tritirachium album proteinase K. CAS No. 39450-01-6.
Proteinase K from Tritirachium album limber, Recombinant
Proteinase K is a stable and highly reactive serine protease. Evidence from crystal and molecular structure studies indicates the enzyme belongs to the subtilisin family with an active-site catalytic triad (Asp39-His69-Ser224). It is stable in a broad range of environments:pH, buffer salts, detergents (SDS), and temperature. In the presence of 0.1-0.5% SDS, proteinase K retains activity and will digest a variety of proteins and nucleases in DNA preparations without compromising the integrity of the isolated DNA. Group: Enzymes. Synonyms: Proteinase K; EC 3.4.21.64; Tritirachium alkaline proteinase; Tritirachium album serine proteinase; Tritirachium album proteinase K; endopeptidase K; 39450-01-6; protease K. CAS No. 39450-01-6. Purity: > 95%. Proteinase K. Activity: > 30U/mg. Storage: 4°C~-20°C. Form: Powder. Source: Pichia pastoris. Species: Tritirachium album limber. Proteinase K; EC 3.4.21.64; Tritirachium alkaline proteinase; Tritirachium album serine proteinase; Tritirachium album proteinase K; endopeptidase K; 39450-01-6; protease K. Cat No: NATE-1240.
Proteinase L5
Proteinase L5 is an antimicrobial peptide found in Lysobacter sp. (strain XL1), and has antibacterial activity. Synonyms: Recombinant Lysobacter sp. Proteinase L5. Grade: ≥95%. Molecular formula: C52H83N15O14S. Mole weight: 1303.73.
protein C (activated)
A peptidase of family S1 (trypsin family), one of the γ-carboxyglutamic acid-containing coagulation factors. Formed from protein C, the proenzyme that circulates in plasma, by the action of a complex of thrombin with thrombomodulin, or by serine endopeptidases present in several snake venoms. Group: Enzymes. Synonyms: blood-coagulation factor XIVa; activated blood coagulation factor XIV; activated protein C; autoprothrombin II-A; protein Ca; APC; GSAPC. Enzyme Commission Number: EC 3.4.21.69. CAS No. 42617-41-4. Protein C. Storage: Store it at +4 ?C for short term. For long term storage, store it at -20 ?C?-80 ?C. Form: Liquid or lyophilized powder. EXWM-4160; protein C (activated); EC 3.4.21.69; 42617-41-4; blood-coagulation factor XIVa; activated blood coagulation factor XIV; activated protein C; autoprothrombin II-A; protein Ca; APC; GSAPC. Cat No: EXWM-4160.
Needs reducing agents or partly reduced enzyme; the reaction depends on sulfhydryl-disulfide interchange. Group: Enzymes. Synonyms: S-S rearrangase. Enzyme Commission Number: EC 5.3.4.1. CAS No. 37318-49-3. PDI. Storage: Store it at +4 ?C for short term. For long term storage, store it at -20 ?C?-80 ?C. Form: Liquid or lyophilized powder. EXWM-5507; protein disulfide-isomerase; EC 5.3.4.1; 37318-49-3; S-S rearrangase. Cat No: EXWM-5507.
Protein Disulfide Isomerase from Human, Recombinant
Protein disulfide isomerases (PDIs) constitute a family of structurally related enzymes which catalyze disulfide bonds formation, reduction, or isomerization of newly synthesized proteins in the lumen of the endoplasmic reticulum (ER). They act also as chaperones, and are, therefore, part of a quality-control system for the correct folding of the proteins in the same subcellular compartment. PDI has been found to have moderate effects (25-fold) on the rate of oxidative folding of proteins in vitro. Recombinant Human Protein Disulfide Isomerase is involved in disulphide-bond formation and isomerization, as well as the reduction of disulphide bonds in proteins. Recomb. EC 5.3.4.1. CAS No. 37318-49-3. Purity: Greater than 95.0% as determined by (a) Analysis by RP-HPLC. (b) Analysis by SDS-PAGE. PDI. Mole weight: 62.4 kDa. Stability: Lyophilized Protein Disulfide Isomerase although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution Human PDI should be stored at 4°C between 2-7 days and for future use below -18°C. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA). Please avoid freeze-thaw cycles. Appearance: Sterile Filtered White lyophilized (freeze-dried) powder. Source: E. coli. Species: Human. Protein Disulfide Isomerase; PDI; EC 5.3.4.1; Prolyl 4-.
protein-disulfide reductase
This enzyme belongs to the family of oxidoreductases, specifically those acting on a sulfur group of donors with NAD+ or NADP+ as acceptor. Group: Enzymes. Synonyms: protein disulphide reductase; insulin-glutathione transhydrogenase; disulfide reductase; NAD(P)H2:protein-disulfide oxidoreductase. Enzyme Commission Number: EC 1.8.1.8. CAS No. 9029-19-0. Storage: Store it at +4 ?C for short term. For long term storage, store it at -20 ?C?-80 ?C. Form: Liquid or lyophilized powder. EXWM-1652; protein-disulfide reductase; EC 1.8.1.8; 9029-19-0; protein disulphide reductase; insulin-glutathione transhydrogenase; disulfide reductase; NAD(P)H2:protein-disulfide oxidoreductase. Cat No: EXWM-1652.
protein-disulfide reductase (glutathione)
Reduces insulin and some other proteins. Group: Enzymes. Synonyms: glutathione-insulin transhydrogenase; insulin reductase; reductase, protein disulfide (glutathione); protein disulfide transhydrogenase; glutathione-protein disulfide oxidoreductase; protein disulfide reductase (glutathione); GSH-insulin transhydrogenase; protein-disulfide interchange enzyme; protein-disulfide isomerase/oxidoreductase; thiol:protein-disulfide oxidoreductase; thiol-protein disulphide oxidoreductase. Enzyme Commission Number: EC 1.8.4.2. CAS No. 9082-53-5. Storage: Store it at +4 ?C for short term. For long term storage, store it at -20 ?C?-80 ?C. Form: Liquid or lyophilized powder. EXWM-1670; protein-disulfide reductase (glutathione); EC 1.8.4.2; 9082-53-5; glutathione-insulin transhydrogenase; insulin reductase; reductase, protein disulfide (glutathione); protein disulfide transhydrogenase; glutathione-protein disulfide oxidoreductase; protein disulfide reductase (glutathione); GSH-insulin transhydrogenase; protein-disulfide interchange enzyme; protein-disulfide isomerase/oxidoreductase; thiol:protein-disulfide oxidoreductase; thiol-protein disulphide oxidoreductase. Cat No: EXWM-1670.
Protein Electroporation Buffer (30 ml)
Electroporation buffer optimized for high transfection efficacy of proteins into primary cultures and hard-to-transfect cell lines. Uses: Electroporation of DNA, RNA, protein and small molecules. Product ID: 4068.
Nevada, Texas, USA
Protein enabled homolog (443-451)
Protein enabled homolog (443-451) is a truncated fragment of protein enabled homolog. Protein enabled homolog is encoded by ENAH gene. Ena/VASP proteins are actin-associated proteins involved in a range of processes dependent on cytoskeleton remodeling and cell polarity such as axon guidance and lamellipodial and filopodial dynamics in migrating cells.
Protein enabled homolog (502-510)
Protein enabled homolog (502-510) is a truncated fragment of protein enabled homolog. Protein enabled homolog is encoded by ENAH gene. Ena/VASP proteins are actin-associated proteins involved in a range of processes dependent on cytoskeleton remodeling and cell polarity such as axon guidance and lamellipodial and filopodial dynamics in migrating cells.
protein farnesyltransferase
This enzyme, along with protein geranylgeranyltransferase types I (EC 2.5.1.59) and II (EC 2.5.1.60), constitutes the protein prenyltransferase family of enzymes. Catalyses the formation of a thioether linkage between the C-1 of an isoprenyl group and a cysteine residue fourth from the C-terminus of the protein. These protein acceptors have the C-terminal sequence CA1A2X, where the terminal residue, X, is preferably serine, methionine, alanine or glutamine; leucine makes the protein a substrate for EC 2.5.1.59. The enzymes are relaxed in specificity for A1, but cannot act if A2 is aromatic. Substrates of the prenyltransferases include Ras, Rho, Rab, other Ras-related small GTP-binding proteins, γ-subunits of heterotrimeric G-proteins, nuclear lamins, centromeric proteins and many proteins involved in visual signal transduction. A zinc metalloenzyme that requires Mg2+ for activity. Group: Enzymes. Synonyms: FTase. Enzyme Commission Number: EC 2.5.1.58. CAS No. 131384-38-8. Storage: Store it at +4 ?C for short term. For long term storage, store it at -20 ?C?-80 ?C. Form: Liquid or lyophilized powder. EXWM-2795; protein farnesyltransferase; EC 2.5.1.58; 131384-38-8; FTase. Cat No: EXWM-2795.
protein-fructosamine 3-kinase
Non-enzymic glycation is an important factor in the pathogenesis of diabetic complications. Key early intermediates in this process are fructosamines, such as [protein]-N6-D-fructosyl-L-lysine. Fructosamine-3-kinase is part of an ATP-dependent system for removing carbohydrates from non-enzymically glycated proteins. The phosphorylation destablilizes the [protein]-N6-D-fructosyl-L-lysine adduct and leads to its spontaneous decomposition. cf. EC 2.7.1.172, protein-ribulosamine 3-kinase. Group: Enzymes. Synonyms: FN3K; fructosamine 3-kinase. Enzyme Commission Number: EC 2.7.1.171. Storage: Store it at +4 ?C for short term. For long term storage, store it at -20 ?C?-80 ?C. Form: Liquid or lyophilized powder. EXWM-3002; protein-fructosamine 3-kinase; EC 2.7.1.171; FN3K; fructosamine 3-kinase. Cat No: EXWM-3002.
Protein G (3xC), BioSeparation
BioSeparation rProtein G (3xC) is a 25.21kD synthetic derivative of the natural protein G molecule, produced by recombinant expression in E. coli and purified using a highly efficient, immunoglobulin-free process. rProtein G (3xC) comprises the Fc binding domain of natural Protein G, devoid of its BSA-binding region. Immobilized rProtein G (3xC) exhibits strong IgG binding capacity suitable for antibody capture and elution under standard conditions. Group: Molecular Biology. US Biological Life Sciences.
Worldwide
Protein G-Agarose
lyophilized powder, Contains lactose stabilizers that must be removed prior to use. Group: Fluorescence/luminescence spectroscopy.
protein geranylgeranyltransferase type I
This enzyme, along with protein farnesyltransferase (EC 2.5.1.58) and protein geranylgeranyltransferase type II (EC 2.5.1.60), constitutes the protein prenyltransferase family of enzymes. Catalyses the formation of a thioether linkage between the C-1 atom of the geranylgeranyl group and a cysteine residue fourth from the C-terminus of the protein. These protein acceptors have the C-terminal sequence CA1A2X, where the terminal residue, X, is preferably leucine; serine, methionine, alanine or glutamine makes the protein a substrate for EC 2.5.1.58. The enzymes are relaxed in specificity for A1, but cannot act if A2 is aromatic. Known targets of this enzyme include most γ-subunits of heterotrimeric G proteins and Ras-related GTPases such as members of the Ras and Rac/Rho families. A zinc metalloenzyme. The Zn2+ is required for peptide, but not for isoprenoid, substrate binding. Group: Enzymes. Synonyms: GGTase-I; GGTaseI. Enzyme Commission Number: EC 2.5.1.59. CAS No. 135371-29-8. Storage: Store it at +4 ?C for short term. For long term storage, store it at -20 ?C?-80 ?C. Form: Liquid or lyophilized powder. EXWM-2796; protein geranylgeranyltransferase type I; EC 2.5.1.59; 135371-29-8; GGTase-I; GGTaseI. Cat No: EXWM-2796.
protein geranylgeranyltransferase type II
This enzyme, along with protein farnesyltransferase (EC 2.5.1.58) and protein geranylgeranyltransferase type I (EC 2.5.1.59), constitutes the protein prenyltransferase family of enzymes. Attaches geranylgeranyl groups to two C-terminal cysteines in Ras-related GTPases of a single family, the Rab family (Ypt/Sec4 in lower eukaryotes) that terminate in XXCC, XCXC and CCXX motifs. Reaction is entirely dependent on the Rab substrate being bound to Rab escort protein (REP). Post-translational modification with the geranylgeranyl moiety is essential for Rab GTPases to be able to control the processes of membrane docking and fusion. Group: Enzymes. Synonyms: GGTaseII; Rab geranylgeranyltransferase; RabGGTase; geranylgeranyl-diphosphate,geranylgeranyl-diphosphate:protein-cysteine geranyltransferase. Enzyme Commission Number: EC 2.5.1.60. CAS No. 135371-29-8. Storage: Store it at +4 ?C for short term. For long term storage, store it at -20 ?C?-80 ?C. Form: Liquid or lyophilized powder. EXWM-2798; protein geranylgeranyltransferase type II; EC 2.5.1.60; 135371-29-8; GGTaseII; Rab geranylgeranyltransferase; RabGGTase; geranylgeranyl-diphosphate,geranylgeranyl-diphosphate:protein-cysteine geranyltransferase. Cat No: EXWM-2798.
Requires free, positively charged ε-amino group of hydroxylysine. Group: Enzymes. Synonyms: 2-O-α-D-glucopyranosyl-5-O-α-D-galactopyranosylhydroxy-L-lysine glucohydrolase; protein-α-D-glucosyl-1,2-β-D-galactosyl-L-hydroxylysine glucohydrolase. Enzyme Commission Number: EC 3.2.1.107. CAS No. 72829-45-9. Storage: Store it at +4 ?C for short term. For long term storage, store it at -20 ?C?-80 ?C. Form: Liquid or lyophilized powder. EXWM-3790; protein-glucosylgalactosylhydroxylysine glucosidase; EC 3.2.1.107; 72829-45-9; 2-O-α-D-glucopyranosyl-5-O-α-D-galactopyranosylhydroxy-L-lysine glucohydrolase; protein-α-D-glucosyl-1,2-β-D-galactosyl-L-hydroxylysine glucohydrolase. Cat No: EXWM-3790.
protein-glutamate methylesterase
Hydrolyses the products of EC 2.1.1.77 (protein-L-isoaspartate(D-aspartate) O-methyltransferase), EC 2.1.1.78 (isoorientin 3'-O-methyltransferase), EC 2.1.1.80 (protein-glutamate O-methyltransferase) and EC 2.1.1.100 (protein-S-isoprenylcysteine O-methyltransferase). Group: Enzymes. Synonyms: chemotaxis-specific methylesterase; methyl-accepting chemotaxis protein methyl-esterase; CheB methylesterase; methylesterase CheB; protein methyl-esterase; protein carboxyl methylesterase; PME; protein methylesterase; protein-L-glutamate-5-O-methyl-ester acylhydrolase. Enzyme Commission Number: EC 3.1.1.61. CAS No. 69552-31-4. Storage: Store it at +4 ?C for short term. For long term storage, store it at -20 ?C?-80 ?C. Form: Liquid or lyophilized powder. EXWM-3490; protein-glutamate methylesterase; EC 3.1.1.61; 69552-31-4; chemotaxis-specific methylesterase; methyl-accepting chemotaxis protein methyl-esterase; CheB methylesterase; methylesterase CheB; protein methyl-esterase; protein carboxyl methylesterase; PME; protein methylesterase; protein-L-glutamate-5-O-methyl-ester acylhydrolase. Cat No: EXWM-3490.
protein-glutamate O-methyltransferase
Forms ester groups with L-glutamate residues in a number of membrane proteins. Group: Enzymes. Synonyms: methyl-accepting chemotaxis protein O-methyltransferase; S-adenosylmethionine-glutamyl methyltransferase; methyl-accepting chemotaxis protein methyltransferase II; S-adenosylmethionine:protein-carboxyl O-methyltransferase; protein methylase II; MCP methyltransferase I; MCP methyltransferase II; protein O-methyltransferase; protein(aspartate)methyltransferase; protein(carboxyl)methylt. Enzyme Commission Number: EC 2.1.1.80. CAS No. 9055-9-8. Storage: Store it at +4 ?C for short term. For long term storage, store it at -20 ?C?-80 ?C. Form: Liquid or lyophilized powder. EXWM-1982; protein-glutamate O-methyltransferase; EC 2.1.1.80; 9055-09-8; methyl-accepting chemotaxis protein O-methyltransferase; S-adenosylmethionine-glutamyl methyltransferase; methyl-accepting chemotaxis protein methyltransferase II; S-adenosylmethionine:protein-carboxyl O-methyltransferase; protein methylase II; MCP methyltransferase I; MCP methyltransferase II; protein O-methyltransferase; protein(aspartate)methyltransferase; protein(carboxyl)methyltransferase; protein carboxyl-methylase; protein carboxyl-O-methyltransferase; protein carboxylmethyltransferase II; protein carboxymethylase; protein carboxymethyltransferase; protein methyltransferase II. Cat No: EXWM-1982.
protein-glutamine γ-glutamyltransferase
Requires Ca2+. The γ-carboxamide groups of peptide-bound glutamine residues act as acyl donors, and the 6-amino-groups of protein- and peptide-bound lysine residues act as acceptors, to give intra- and inter-molecular N6-(5-glutamyl)-lysine crosslinks. Formed by proteolytic cleavage from plasma Factor XIII. Group: Enzymes. Synonyms: transglutaminase; Factor XIIIa; fibrinoligase; fibrin stabilizing factor; glutaminylpeptide γ-glutamyltransferase; polyamine transglutaminase; tissue transglutaminase; R-glutaminyl-peptide:amine γ-glutamyl transferase. Enzyme Commission Number: EC 2.3.2.13. CAS No. 80146-85-6. Transglutaminase. Storage: Store it at +4 ?C for short term. For long term storage, store it at -20 ?C?-80 ?C. Form: Liquid or lyophilized powder. EXWM-2286; protein-glutamine γ-glutamyltransferase; EC 2.3.2.13; 80146-85-6; transglutaminase; Factor XIIIa; fibrinoligase; fibrin stabilizing factor; glutaminylpeptide γ-glutamyltransferase; polyamine transglutaminase; tissue transglutaminase; R-glutaminyl-peptide:amine γ-glutamyl transferase. Cat No: EXWM-2286.
protein-glutamine glutaminase
Specific for the hydrolysis of the γ-amide of glutamine substituted at the carboxyl position or both the α-amino and carboxyl positions, e.g., L-glutaminylglycine and L-phenylalanyl-L-glutaminylglycine. Group: Enzymes. Synonyms: peptidoglutaminase II; glutaminyl-peptide glutaminase; destabilase; peptidylglutaminase II. Enzyme Commission Number: EC 3.5.1.44. CAS No. 62213-11-0. Storage: Store it at +4 ?C for short term. For long term storage, store it at -20 ?C?-80 ?C. Form: Liquid or lyophilized powder. EXWM-4433; protein-glutamine glutaminase; EC 3.5.1.44; 62213-11-0; peptidoglutaminase II; glutaminyl-peptide glutaminase; destabilase; peptidylglutaminase II. Cat No: EXWM-4433.
Protein G Magnetic Nanoparticles
The surface of the supperparamagnetic Fe3O4 nanoparticles is covalently functionalized with Protein G, and can be used to bind IgG antibodies to the particle surface. Uses: Protein g coupled magnetic nanoparticles can be used in the industry of immunoprecipitation, antibody purification. Group: Nanospheres.
Protein G?Peroxidase from Streptococcus sp.
recombinant, expressed in unspecified host, lyophilized powder. Group: Fluorescence/luminescence spectroscopy.
Protein G recombinant
from Escherichia coli, ?90%. Group: Fluorescence/luminescence spectroscopy.
protein-histidine N-methyltransferase
Highly specific for histidine residues, for example, in actin. Group: Enzymes. Synonyms: protein methylase IV; protein (histidine) methyltransferase; actin-specific histidine methyltransferase; S-adenosyl methionine:protein-histidine N-methyltransferase. Enzyme Commission Number: EC 2.1.1.85. CAS No. 108022-17-9. Storage: Store it at +4 ?C for short term. For long term storage, store it at -20 ?C?-80 ?C. Form: Liquid or lyophilized powder. EXWM-1986; protein-histidine N-methyltransferase; EC 2.1.1.85; 108022-17-9; protein methylase IV; protein (histidine) methyltransferase; actin-specific histidine methyltransferase; S-adenosyl methionine:protein-histidine N-methyltransferase. Cat No: EXWM-1986.
protein-histidine pros-kinase
A number of histones can act as acceptor. Group: Enzymes. Synonyms: ATP:protein-L-histidine N-pros-phosphotransferase; histidine kinase (ambiguous); histidine protein kinase (ambiguous); protein histidine kinase (ambiguous); protein kinase (histidine) (ambiguous); HK2. Enzyme Commission Number: EC 2.7.13.1. CAS No. 99283-67-7. Storage: Store it at +4 ?C for short term. For long term storage, store it at -20 ?C?-80 ?C. Form: Liquid or lyophilized powder. EXWM-3163; protein-histidine pros-kinase; EC 2.7.13.1; 99283-67-7; ATP:protein-L-histidine N-pros-phosphotransferase; histidine kinase (ambiguous); histidine protein kinase (ambiguous); protein histidine kinase (ambiguous); protein kinase (histidine) (ambiguous); HK2. Cat No: EXWM-3163.
protein-histidine tele-kinase
A number of histones can act as acceptor. Group: Enzymes. Synonyms: ATP:protein-L-histidine N-tele-phosphotransferase; histidine kinase (ambiguous); histidine protein kinase (ambiguous); protein histidine kinase (ambiguous); protein kinase (histidine) (ambiguous); HK3. Enzyme Commission Number: EC 2.7.13.2. CAS No. 99283-67-7. Storage: Store it at +4 ?C for short term. For long term storage, store it at -20 ?C?-80 ?C. Form: Liquid or lyophilized powder. EXWM-3164; protein-histidine tele-kinase; EC 2.7.13.2; 99283-67-7; ATP:protein-L-histidine N-tele-phosphotransferase; histidine kinase (ambiguous); histidine protein kinase (ambiguous); protein histidine kinase (ambiguous); protein kinase (histidine) (ambiguous); HK3. Cat No: EXWM-3164.
Protein Kinase A Catalytic Subunit ?, Active human
Protein Kinase A Catalytic Subunit β, Active human, Recombinant
cAMP-dependent protein kinase catalytic subunit beta is an enzyme that in humans is encoded by the PRKACB gene. cAMP is a signaling molecule important for a variety of cellular functions. cAMP exerts its effects by activating the protein kinase A (PKA), which transduces the signal through phosphorylation of different target proteins. The inactive holoenzyme of PKA is a tetramer composed of two regulatory and two catalytic subunits. cAMP causes the dissociation of the inactive holoenzyme into a dimer of regulatory subunits bound to four cAMP and two free monomeric catalytic subunits. Four different regulatory subunits and three catalytic subunits of PKA have.e crebtide substrate peptide per minute per mg protein at 30°c using a final concentration of 50 μm [32p] atp. Group: Enzymes. Synonyms: PKA Catalytic Subunit β, Active human; PKA-Cβ; cAMP-dependent protein kinase; PKACB; PRKACB; PKA C-beta; Protein Kinase A Catalytic Subunit &beta. Purity: > 85% (SDS-PAGE). PKAC. Mole weight: protein apparent mol wt ~65 kDa. Stability: -70°C. Form: buffered aqueous glycerol solution. Source: baculovirus infected Sf9 cells. Species: Human. PKA Catalytic Subunit β, Active human; PKA-Cβ; cAMP-dependent protein kinase; PKACB; PRKACB; PKA C-beta; Protein Kinase A Catalytic Subunit &beta. Cat No: NATE-0572.
Protein Kinase A Catalytic Subunit from bovine heart
?9 units/?g protein (cyclic-AMP is not required for this activity), lyophilized (white powder to sticky mass to hard pellet). Group: Fluorescence/luminescence spectroscopy.
Protein Kinase A Catalytic Subunit from Bovine, Recombinant
Protein Kinase A (PKA) catalyzes the transfer of the terminal phosphate of ATP to threonine or serine residues in a variety of protein substrates. The enzyme is composed of two subunit types: a catalytic subunit and a regulatory subunit. In the absence of cAMP, the two subunits are bound to each other and no catalysis can take place. In the presence of cAMP, the regulatory subunit binds cAMP, thus releasing the catalytic subunit. In the presence of cAMP, the catalytic subunit exists as a monomer of 40,862 Da (amino acid sequence), but on SDS-PAGE the apparent molecular mass is 43,000 Da. Group: Enzymes. Synonyms: PKA; cAMP-dependent protein kinase; ATP:protein phosphotransferase (cAMP-dependent); Protein K. Enzyme Commission Number: EC 2.7.11.11. Activity: >9 units/μg protein. Storage: Store at -20°C. Form: Lyophilized from a solution containing approximately: 80% sucrose, 19% potassium phosphate buffer, pH 6.7, 0.0625% 2-mercaptoethanol(2-ME), 0.002% EDTA, 0.016% dithiothreitol (DTT), and ≤1% protein. The lyophilized product may contain traces of DTT or 2-ME. Source: Bovine Heart. Species: Bovine. PKA; cAMP-dependent protein kinase; ATP:protein phosphotransferase (cAMP-dependent); Protein Kinase A catalytic subunit; Protein kinase A; PKAC; cAMP-dependent protein kinase catalytic subunit; PRKAC. Cat No: NATE-1889.
Protein Kinase A catalytic subunit human
>90% (SDS-PAGE), recombinant, expressed in E. coli, buffered aqueous glycerol solution. Group: Fluorescence/luminescence spectroscopy.
Protein Kinase A catalytic subunit human, Recombinant
Ubiquitous serine-threonine kinase that phosphorylates a broad spectrum of substrates, and regulates many cellular processes. The catalytic subunit is released following binding of cyclic AMP to the regulatory subunits of the PKA holoenzyme. The free catalytic subunit has intrinsic activity and does not require added cyclic AMP. >90% (sds-page), recombinant, expressed in e. coli, buffered aqueous glycerol solution. Group: Enzymes. Synonyms: Protein Kinase A catalytic subunit; Protein kinase A; PKA; PKAC; cAMP-dependent protein kinase catalytic subunit; PRKAC. Purity: >90% (SDS-PAGE). PKAC. Mole weight: mol wt 43.5 kDa. Activity: >1000 units/mg protein. Stability: -70°C. Form: buffered aqueous glycerol solution. Source: E. coli. Species: Human. Protein Kinase A catalytic subunit; Protein kinase A; PKA; PKAC; cAMP-dependent protein kinase catalytic subunit; PRKAC. Cat No: NATE-0571.
Protein Kinase Activator SC-10 (N- (n-heptyl) -5-chloro-1-naphthalene sulfonamide)
An activator of protein kinase C in a Ca2+-dependent manner, via a mechanism similar to that of phosphatidylserine. Group: Biochemicals. Alternative Names: N- (n-heptyl) -5-chloro-1-naphthalene sulfonamide. Grades: Molecular Biology Grade. CAS No. 102649-79-6. Pack Sizes: 25mg. US Biological Life Sciences.
Worldwide
Protein Kinase Activator SC-9 (N- (6-phenylhexyl) -5-chloro-1-naphthalene sulfonamide)
Activates protein kinase C in a Ca2+-dependent manner, via a mechanism similar to that of phosphatidylserine. Group: Biochemicals. Alternative Names: N- (6-phenylhexyl) -5-chloro-1-naphthalene sulfonamide. Grades: Molecular Biology Grade. CAS No. 102649-78-5. Pack Sizes: 10mg, 25mg, 50mg. US Biological Life Sciences.
Worldwide
Protein Kinase A inhibitor fragment 14-22, myristoylated trifluoroacetate salt
A family of serine- and threonine-specific protein kinases that depend on lipids for activity. They can be activated by calcium but have a requirement for the second messenger diacylglycerol. Members of this group of enzymes phosphorylate a wide variety of protein targets and are known to be involved in diverse cell-signalling pathways. Members of the protein kinase C family also serve as major receptors for phorbol esters, a class of tumour promoters. Group: Enzymes. Synonyms: calcium-dependent protein kinase C; calcium-independent protein kinase C; calcium/phospholipid dependent protein kinase; cPKCα; cPKCβ; cPKCγ; nPKCΔ; nPKCε; nPKC; nPKC; PKC; PKCα; PKCβ; PKCγ; PKCΔ; PKCε; PKCζ; Pkc1p; protein kinase Cε; STK24. Enzyme Commission Number: EC 2.7.11.13. Storage: Store it at +4 ?C for short term. For long term storage, store it at -20 ?C?-80 ?C. Form: Liquid or lyophilized powder. EXWM-3132; protein kinase C; EC 2.7.11.13; calcium-dependent protein kinase C; calcium-independent protein kinase C; calcium/phospholipid dependent protein kinase; cPKCα; cPKCβ; cPKCγ; nPKCΔ; nPKCε; nPKC; nPKC; PKC; PKCα; PKCβ; PKCγ; PKCΔ; PKCε; PKCζ; Pkc1p; protein kinase Cε; STK24. Cat No: EXWM-3132.
Protein Kinase C 19-31
Protein Kinase C (19-31) is a peptide inhibitor of protein kinase C (PKC) originating in the pseudo-substrate regulatory domain of PKCA (residues 19-31). Synonyms: PKC (19-31); Arg-Phe-Ala-Arg-Lys-Gly-Ala-Leu-Arg-Gln-Lys-Asn-Val; Pseudosubstrate; L-arginyl-L-phenylalanyl-L-alanyl-L-arginyl-L-lysyl-glycyl-L-alanyl-L-leucyl-L-arginyl-L-glutaminyl-L-lysyl-L-asparagyl-L-valine. Grade: 95%. CAS No. 121545-65-1. Molecular formula: C67H118N26O16. Mole weight: 1543.82.
Protein Kinase C 19-31 acetate
Protein Kinase C 19-31 acetate is a peptide inhibitor of protein kinase C (PKC) originating in the pseudo-substrate regulatory domain of PKCA (residues 19-31). It is used as a protein kinase C substrate peptide for testing the protein kinase C activity. Synonyms: PKC (19-31) acetate; H-Arg-Phe-Ala-Arg-Lys-Gly-Ala-Leu-Arg-Gln-Lys-Asn-Val-OH.CH3CO2H; L-arginyl-L-phenylalanyl-L-alanyl-L-arginyl-L-lysyl-glycyl-L-alanyl-L-leucyl-L-arginyl-L-glutaminyl-L-lysyl-L-asparagyl-L-valine acetic acid. Grade: ≥95%. Molecular formula: C69H122N26O18. Mole weight: 1603.90.
Protein kinase c(530-558)
Protein kinase c(530-558). Uses: Designed for use in research and industrial production. Additional or Alternative Names: PKC (530-558);PKC FRAGMENT (530-558);PROTEIN KINASE C (530-558);PROTEIN KINASE C FRAGMENT 530-558;LLYEMLAGQAPFEGEDEDELFQSIMEHNV;LLYEMLAGQAPFEGEDEDELFQSIMEHNV-NH2;H-LEU-LEU-TYR-GLU-MET-LEU-ALA-GLY-GLN-ALA-PRO-PHE-GLU-GLY-GLU-ASP-GLU-ASP-GLU-LEU-PHE-GLN-SE. Product Category: Heterocyclic Organic Compound. CAS No. 122613-29-0. Molecular formula: C148H221N35O50S2. Mole weight: 3354.67. Product ID: ACM122613290. Alfa Chemistry ISO 9001:2015 Certified.
Protein kinase Cα isozyme human, Recombinant
Protein Kinase C (PKC) is a serine/threonine kinase that is activated intracellularly by signal transduction pathways that produce DAG from phosphatidylinositol diphosphate (PIP2) and phosphatidylcholine (PC) through the action of various activated phospholipases. Phorbol esters also stimulate PKC. At least 11 PKC isozymes have been identified that differ in primary structure, tissue distribution, subcellular localization, response to extracellular signals, and substrate specificity. The isozymes can be grouped into three subfamilies. Members of the first family require Ca2+ and phospholipid and include PKCα, βI, βII, and &gamma. Members of the second.third family are not activated by either DAG or phorbol esters and include PKCξ, μ, and &Iota. > 70% (sds-page), recombinant, expressed in baculovirus infected insect cells, buffered aqueous glycerol solution. Group: Enzymes. Synonyms: PRKCA; protein kinase C, alpha; PKCA; protein kinase C alpha type; PKC-A; PKCα; AAG6; PKC-alpha; PRKACA. Purity: > 70% (SDS-PAGE). PKC. Mole weight: mol wt 80-81 kDa by SDS-PAGE. Stability: -70°C. Form: buffered aqueous glycerol solution. Source: baculovirus infected insect cells. Species: Human. PRKCA; protein kinase C, alpha; PKCA; protein kinase C alpha type; PKC-A; PKCα; AAG6; PKC-alpha; PRKACA. Cat No: NATE-0574.
Protein Kinase C, alpha, primers, amplimer 324bp (AAG6, MGC129900, MGC129901, PKCA, PKC-A, PKC-alpha, PRKACA, Protein kinase C alpha type), Primer A, Upstream Primer
Protein Kinase C, alpha, primers, amplimer 324bp (AAG6, MGC129900, MGC129901, PKCA, PKC-A, PKC-alpha, PRKACA, Protein kinase C alpha type), Primer A, Upstream Primer. Group: Molecular Biology. Pack Sizes: 1x50ul. US Biological Life Sciences.
Worldwide
Protein Kinase C, alpha, primers, amplimer 324bp (AAG6, MGC129900, MGC129901, PKCA, PKC-A, PKC-alpha, PRKACA, Protein kinase C alpha type), Primer B, Downstream Primer
Protein Kinase C, alpha, primers, amplimer 324bp (AAG6, MGC129900, MGC129901, PKCA, PKC-A, PKC-alpha, PRKACA, Protein kinase C alpha type), Primer B, Downstream Primer. Group: Molecular Biology. Pack Sizes: 1x50ul. US Biological Life Sciences.
Worldwide
Protein Kinase CβII isozyme from human, Recombinant
Protein Kinase C (PKC) is a serine/threonine kinase that is activated intracellularly by signal transduction pathways that produce DAG from phosphatidylinositol diphosphate (PIP2) and phosphatidylcholine (PC) through the action of various activated phospholipases. Phorbol esters also stimulate PKC. At least 11 PKC isozymes have been identified that differ in primary structure, tissue distribution, subcellular localization, response to extracellular signals, and substrate specificity. The isozymes can be grouped into three subfamilies. Members of the first family require Ca2+ and phospholipid and include PKCα, βI, βII, and &gamma. Members of the sec. esters and include PKCξ, μ, and &Iota. Group: Enzymes. Synonyms: PRKCB; PKCB; PRKCB1; PRKCB2; protein kinase C, beta 1; protein kinase C beta type; PKC-beta; EC 2.7.1.37. Enzyme Commission Number: EC 2.7.1.37. Purity: >95% (SDS-PAGE). PKC. Mole weight: calculated mol wt 76.9 kDa; mol wt 80 kDa by SDS-PAGE. Storage: -70°C. Form: buffered aqueous glycerol solution; Solution in 20 mM HEPES, pH 7.4; 2 mM EDTA, 2 mM EGTA, 5 mM DTT, 100 mM NaCl, 0.05% Triton X-100, and 50% glycerol. Source: Baculovirus infected insect cells. Species: Human. PRKCB; PKCB; PRKCB1; PRKCB2; protein kinase C, beta 1; protein kinase C beta type; PKC-beta; EC 2.7.1.37. Cat No: NATE-0622.
Protein Kinase CβI isozyme from human, Recombinant
Protein Kinase C (PKC) is a serine/threonine kinase that is activated intracellularly by signal transduction pathways that produce DAG from phosphatidylinositol diphosphate (PIP2) and phosphatidylcholine (PC) through the action of various activated phospholipases. Phorbol esters also stimulate PKC. At least 11 PKC isozymes have been identified that differ in primary structure, tissue distribution, subcellular localization, response to extracellular signals, and substrate specificity. The isozymes can be grouped into three subfamilies. Members of the first family require Ca2+ and phospholipid and include PKCα, βI, βII, and &gamma. Members of the sec.ted by either DAG or phorbol esters and include PKCξ, μ, and &Iota. Group: Enzymes. Synonyms: PRKCB; PKCB; PRKCB1; PRKCB2; protein kinase C, beta 1; protein kinase C beta type; PKC-beta; EC 2.7.1.37. Enzyme Commission Number: EC 2.7.1.37. Purity: > 95% (SDS-PAGE). PKC. Mole weight: apparent mol wt 79-80 kDa. Storage: -70°C. Form: buffered aqueous glycerol solution; Solution in 20 mM HEPES, pH 7.4; 2 mM EDTA, 2 mM EGTA, 5 mM DTT, 100 mM NaCl, 0.05% Triton X-100, and 50% glycerol. Source: Baculovirus infected insect cells. Species: Human. PRKCB; PKCB; PRKCB1; PRKCB2; protein kinase C, beta 1; protein kinase C beta type; PKC-beta; EC 2.7.1.37. Cat No: NATE-0621.
Protein Kinase Cδ isozyme from human, Recombinant
Protein Kinase C (PKC) is a serine/threonine kinase that is activated intracellularly by signal transduction pathways that produce DAG from phosphatidylinositol diphosphate (PIP2) and phosphatidylcholine (PC) through the action of various activated phospholipases. Phorbol esters also stimulate PKC. At least 11 PKC isozymes have been identified that differ in primary structure, tissue distribution, subcellular localization, response to extracellular signals, and substrate specificity. The isozymes can be grouped into three subfamilies. Members of the first family require Ca2+ and phospholipid and include PKCα, βI, βII, and &gamma. Members of the sec.DAG or phorbol esters and include PKCξ, μ, and &Iota. Group: Enzymes. Synonyms: PRKCD; protein kinase C, delta; protein kinase C delta type; ALPS3; CVID9; MAY1; PKCD; nPKC-delta; EC 2.7.1.37. Enzyme Commission Number: EC 2.7.1.37. Purity: >95% (SDS-PAGE). PKC. Mole weight: mol wt 74-79 kDa by SDS-PAGE. Storage: -70°C. Form: buffered aqueous glycerol solution; Solution in 20 mM HEPES, pH 7.4; 2 mM EDTA, 2 mM EGTA, 5 mM DTT, 100 mM NaCl, 0.05% Triton X-100, and 50% glycerol. Source: Baculovirus infected insect cells. Species: Human. PRKCD; protein kinase C, delta; protein kinase C delta type; ALPS3; CVID9; MAY1; PKCD; nPKC-delta; EC 2.7.1.37. Cat No: NATE-0623.
Protein Kinase Cε isozyme human, Recombinant
Protein Kinase C (PKC) is a serine/threonine kinase that is activated intracellularly by signal transduction pathways that produce DAG from phosphatidylinositol diphosphate (PIP2) and phosphatidylcholine (PC) through the action of various activated phospholipases. Phorbol esters also stimulate PKC. At least 11 PKC isozymes have been identified that differ in primary structure, tissue distribution, subcellular localization, response to extracellular signals, and substrate specificity. The isozymes can be grouped into three subfamilies. Members of the first family require Ca2+ and phospholipid and include PKCα, βI, βII, and &gamma. Members of the secon.tein kinase C, epsilon; protein kinase C epsilon type; PKCE; nPKC-epsilon; Ca2+-activated phospholipid-dependent serine-threonine kinase, ε isozyme human; PKCε human; PKCε; EC 2.7.1.37. Enzyme Commission Number: EC 2.7.1.37. Purity: >95% (SDS-PAGE). PKC. Mole weight: apparent mol wt 89-96 kDa. Storage: -70°C. Form: buffered aqueous glycerol solution. Source: baculovirus infected insect cells. Species: Human. PRKCE; protein kinase C, epsilon; protein kinase C epsilon type; PKCE; nPKC-epsilon; Ca2+-activated phospholipid-dependent serine-threonine kinase, ε isozyme human; PKCε human; PKCε; EC 2.7.1.37. Cat No: NATE-0575.
Protein Kinase Cη isozyme human, Recombinant
Protein Kinase C (PKC) is a serine/threonine kinase that is activated intracellularly by signal transduction pathways that produce DAG from phosphatidylinositol diphosphate (PIP2) and phosphatidylcholine (PC) through the action of various activated phospholipases. Phorbol esters also stimulate PKC. At least 11 PKC isozymes have been identified that differ in primary structure, tissue distribution, subcellular localization, response to extracellular signals, and substrate specificity. The isozymes can be grouped into three subfamilies. Members of the first family require Ca2+ and phospholipid and include PKCα, βI, βII, and &gamma. Members of the second.nd include PKCξ, μ, and &Iota. > 90% (sds-page), recombinant, expressed in baculovirus infected insect cells, buffered aqueous glycerol solution. Group: Enzymes. Synonyms: PRKCH; Ca2+-activated phospholipid-dependent serine-threonine kinase η isozyme human; PKCη human; PKCH; EC 2.7.1.37. Enzyme Commission Number: EC 2.7.1.37. Purity: > 90% (SDS-PAGE). PKC. Mole weight: mol wt 82-84 kDa by SDS-PAGE. Storage: -70°C. Form: buffered aqueous glycerol solution. Source: baculovirus infected insect cells. Species: Human. PRKCH; Ca2+-activated phospholipid-dependent serine-threonine kinase η isozyme human; PKCη human; PKCH; EC 2.7.1.37. Cat No: NATE-0576.
Protein kinase Cγ isozyme from human, Recombinant
Protein Kinase C (PKC) is a serine/threonine kinase that is activated intracellularly by signal transduction pathways that produce DAG from phosphatidylinositol diphosphate (PIP2) and phosphatidylcholine (PC) through the action of various activated phospholipases. Phorbol esters also stimulate PKC. At least 11 PKC isozymes have been identified that differ in primary structure, tissue distribution, subcellular localization, response to extracellular signals, and substrate specificity. The isozymes can be grouped into three subfamilies. Members of the first family require Ca2+ and phospholipid and include PKCα, βI, βII, and &gamma. Members of the sec.vated by either DAG or phorbol esters and include PKCξ, μ, and &Iota. Group: Enzymes. Synonyms: PRKCG; protein kinase C, gamma; protein kinase C gamma type; PKC-gamma; PKCC; PKCG; SCA14; EC 2.7.1.37. Enzyme Commission Number: EC 2.7.1.37. Purity: >95% (SDS-PAGE). PKC. Mole weight: mol wt 77-84 kDa by SDS-PAGE. Storage: -70°C. Form: buffered aqueous glycerol solution; Solution in 20 mM HEPES, pH 7.4; 2 mM EDTA, 2 mM EGTA, 5 mM DTT, 250 mM NaCl, 0.05% Triton X-100, and 50% glycerol. Source: Baculovirus infected insect cells. Species: Human. PRKCG; protein kinase C, gamma; protein kinase C gamma type; PKC-gamma; PKCC; PKCG; SCA14; EC 2.7.1.37. Cat No: NATE-0624.
Protein Kinase C (PKC) is a serine/threonine kinase that is activated intracellularly by signal transduction pathways that produce DAG from phosphatidylinositol diphosphate (PIP2) and phosphatidylcholine (PC) through the action of various activated phospholipases. Phorbol esters also stimulate PKC. At least 11 PKC isozymes have been identified that differ in primary structure, tissue distribution, subcellular localization, response to extracellular signals, and substrate specificity. The isozymes can be grouped into three subfamilies. Members of the first family require Ca2+ and phospholipid and include PKCα, βI, βII, and &gamma. Members of the second.activated by either DAG or phorbol esters and include PKCξ, μ, and &Iota. Recombinant, expressed in e. coli, > 85% (sds-page), buffered aqueous glycerol solution. Applications: Kinase activity is measured as the molar amount of phosphate incorporated into the crebtide substrate peptide per minute per mg protein at 30°c using a final concentration of 50 μm [32p] atp. Group: Enzymes. Synonyms: PKCL; Protein Kinase C Lambda/Iota; PKC&Iota. Purity: > 85% (SDS-PAGE). PKC. Mole weight: apparent mol wt ~98 kDa. Stability: -70°C. Form: buffered aqueous glycerol solution. Source: E. coli. Species: Human. PKCL; Protein Kinase C Lambda/Iota; PKC&Iota. Cat No: NATE-0577.