A directory of where to buy chemicals in the USA, including: distributors, industrial manufacturers, bulk supplies and wholesalers of raw ingredients & finished goods.
Search for products or services, then visit the suppliers website for prices or more information.
| Product | Description | |
|---|---|---|
| Protocatechualdehyde | Protocatechualdehyde. Group: Biochemicals. Alternative Names: 3,4-Dihydroxybenzaldehyde; Protocatechuic aldehyde; Rancinamycin IV. Grades: Plant Grade. CAS No. 139-85-5. Pack Sizes: 100mg. Molecular Formula: C7H6O3, Molecular Weight: 138.121. US Biological Life Sciences. |  Worldwide |
| Protocatechualdehyde | Protocatechualdehyde (Catechaldehyde), a natural polyphenol compound isolated from the roots of radix Salviae Miltiorrhizae , is associated with a wide variety of biological activities and has been widely used in medicine as an antioxidant, anti-aging, an antibacterial and anti-inflammatory agent [1]. Uses: Scientific research. Group: Natural products. Alternative Names: Catechaldehyde; Protocatechuic aldehyde; Rancinamycin IV. CAS No. 139-85-5. Pack Sizes: 10 mM * 1 mL; 100 mg. Product ID: HY-N0295. |  |
| Protocatechualdehyde | Protocatechualdehyde (Catechaldehyde), a natural polyphenol compound isolated from the roots of radix Salviae Miltiorrhizae, is associated with a wide variety of biological activities and has been widely used in medicine as an antioxidant, anti-aging, an antibacterial and anti-inflammatory agent. Group: Inhibitors. Alternative Names: 1,2-Dihydroxy-4-formylbenzene. CAS No. 139-85-5. Molecular formula: C7H6O3. Mole weight: 138.12. Appearance: Slightly brown crystalline powder. Purity: 0.98. IUPACName: 3,4-Dihydroxybenzaldehyde. Canonical SMILES: C1=CC(=C(C=C1C=O)O)O. Density: 1.2667 g/cm³. Catalog: ACM139855. |  |
| protocatechuate 3,4-dioxygenase | Requires Fe3+. The enzyme, which participates in the degradation of aromatic compounds, catalyses the intradiol addition of both oxygen atoms from molecular oxygen, resulting in ortho-cleavage of the aromatic ring. The type of cleavage leads to mineralization via the intermediate 3-oxoadipate. Group: Enzymes. Synonyms: protocatechuate oxygenase; protocatechuic acid oxidase; protocatechuic 3,4-dioxygenase; protocatechuic 3,4-oxygenase; protocatechuate:oxygen 3,4-oxidoreductase (decyclizing). Enzyme Commission Number: EC 1.13.11.3. CAS No. 9029-47-4. Protocatechuate 3, 4-dioxygenase. Storage: Store it at +4 ?C for short term. For long term storage, store it at -20 ?C?-80 ?C. Form: Liquid or lyophilized powder. EXWM-0549; protocatechuate 3,4-dioxygenase; EC 1.13.11.3; 9029-47-4; protocatechuate oxygenase; protocatechuic acid oxidase; protocatechuic 3,4-dioxygenase; protocatechuic 3,4-oxygenase; protocatechuate:oxygen 3,4-oxidoreductase (decyclizing). Cat No: EXWM-0549. |  |
| Protocatechuate 3,4-dioxygenase | Protocatechuate 3,4-dioxygenase is a biochemical reagent that can be used as a biological material or organic compound for life science related research. Uses: Scientific research. Group: Signaling pathways. CAS No. 9029-47-4. Pack Sizes: 25 U. Product ID: HY-P2915. | |
| Protocatechuate 3,4-Dioxygenase from Bacteria, Recombinant | In enzymology, a protocatechuate 3,4-dioxygenase (EC 1.13.11.3) is an enzyme that catalyzes the chemical reaction:3,4-dihydroxybenzoate + O2<-> 3-carboxy-cis,cis-muconate. Thus, the two substrates of this enzyme are 3,4-dihydroxybenzoate (protocatechuic acid) and O2, whereas its product is 3-carboxy-cis,cis-muconate. This enzyme belongs to the family of oxidoreductases, specifically those acting on single donors with O2 as oxidant and incorporation of two atoms of oxygen into the substrate (oxygenases). This enzyme participates in benzoate degradation via hydroxylation and 2,4-dichlorobenzoate degradation. It employs one cofactor, iron. Applications: Useful for removal of protocatechuate derived from choline esterase determination. Group: Enzymes. Synonyms: protocatechuate 3,4-dioxygenase; protocatechuate oxygenase; protocatechuic acid oxidase; protocatech. Enzyme Commission Number: EC 1.13.11.3. CAS No. 9029-47-4. Protocatechuate 3, 4-dioxygenase. Mole weight: 28 kD α subuit, 24 kD β subunit?SDS-PAGE?. Activity: > 3 Units / mg. Storage: 1 - 10°C (do not freeze). Form: Solution. Source: E. coli. Species: Bacteria. protocatechuate 3,4-dioxygenase; protocatechuate oxygenase; protocatechuic acid oxidase; protocatechuic 3,4-dioxygenase; protocatechuic 3,4-oxygenase; 9029-47-4; EC 1.13.11.3; PCD. Cat No: NATE-1028. | |
| protocatechuate 4,5-dioxygenase | Requires Fe2+. Group: Enzymes. Synonyms: protocatechuate 4,5-oxygenase; protocatechuic 4,5-dioxygenase; protocatechuic 4,5-oxygenase; protocatechuate:oxygen 4,5-oxidoreductase (decyclizing). Enzyme Commission Number: EC 1.13.11.8. CAS No. 9029-56-5. Storage: Store it at +4 ?C for short term. For long term storage, store it at -20 ?C?-80 ?C. Form: Liquid or lyophilized powder. EXWM-0600; protocatechuate 4,5-dioxygenase; EC 1.13.11.8; 9029-56-5; protocatechuate 4,5-oxygenase; protocatechuic 4,5-dioxygenase; protocatechuic 4,5-oxygenase; protocatechuate:oxygen 4,5-oxidoreductase (decyclizing). Cat No: EXWM-0600. | |
| protocatechuate decarboxylase | This enzyme belongs to the family of lyases, specifically the carboxy-lyases, which cleave carbon-carbon bonds. This enzyme participates in benzoate degradation via hydroxylation. Group: Enzymes. Synonyms: 3,4-dihydrobenzoate decarboxylase; protocatechuate carboxy-lyase. Enzyme Commission Number: EC 4.1.1.63. CAS No. 37290-55-4. Storage: Store it at +4 ?C for short term. For long term storage, store it at -20 ?C?-80 ?C. Form: Liquid or lyophilized powder. EXWM-4810; protocatechuate decarboxylase; EC 4.1.1.63; 37290-55-4; 3,4-dihydrobenzoate decarboxylase; protocatechuate carboxy-lyase. Cat No: EXWM-4810. | |
| Protocatechuic acid | Protocatechuic acid is a phenolic compound which exhibits neuroprotective effect. Uses: Scientific research. Group: Natural products. Alternative Names: 3,4-Dihydroxybenzoic acid. CAS No. 99-50-3. Pack Sizes: 10 mM * 1 mL; 200 mg; 1 g. Product ID: HY-N0294. | |
| Protocatechuic Acid | Protocatechuic Acid. Group: Biochemicals. Alternative Names: Carbohydroquinonic acid; Catechol-4-carboxylic acid; Hypogallic acid. Grades: Plant Grade. CAS No. 99-50-3. Pack Sizes: 20mg. Molecular Formula: C7H6O4, Molecular Weight: 154.12. US Biological Life Sciences. | Worldwide |
| Protocatechuic Acid | Protocatechuic Acid - Product ID: NST-10-36. Category: Benzoic acid derivatives. Alternative Names: 3,4-Dihydroxybenzoic acid. Purity: 98%. Test method: HPLC. CAS No. 99-50-3. Pack Sizes: 50g, 100g, 250g, 500g. Appearance: White to off-white powder. Molecular formula: C7H6O4. Mole weight: 154.12. Storage: +2 +8 °C. |  |
| Protocatechuic acid (Standard) | Protocatechuic acid (Standard) is the analytical standard of Protocatechuic acid. This product is intended for research and analytical applications. Protocatechuic acid is a phenolic compound which exhibits neuroprotective effect. Uses: Scientific research. Group: Natural products. CAS No. 99-50-3. Pack Sizes: 10 mg; 25 mg; 50 mg; 100 mg. Product ID: HY-N0294R. | |
| Protocetraric acid | Protocetraric acid has strong antioxidant, antibacterial and anticancer effects. Synonyms: 11H-Dibenzo(b,e)(1,4)dioxepin-7-carboxylic acid, 4-formyl-3,8-dihydroxy-9-(hydroxymethyl)-1,6-dimethyl-11-oxo-; 10-formyl-3,9-dihydroxy-4-(hydroxymethyl)-1,7-dimethyl-6-oxobenzo[b][1,4]benzodioxepine-2-carboxylic acid; Protocetrarsaeure. Grades: ≥98%. CAS No. 489-51-0. Molecular formula: C18H14O9. Mole weight: 374.30. |  |
| protochlorophyllide reductase | The enzyme catalyses a light-dependent trans-reduction of the D-ring of protochlorophyllide; the product has the (7S,8S)-configuration. Group: Enzymes. Synonyms: NADPH2-protochlorophyllide oxidoreductase; NADPH-protochlorophyllide oxidoreductase; NADPH-protochlorophyllide reductase; protochlorophyllide oxidoreductase (ambiguous); protochlorophyllide photooxidoreductase; light-dependent protochlorophyllide reductase. Enzyme Commission Number: EC 1.3.1.33. CAS No. 68518-04-7. Storage: Store it at +4 ?C for short term. For long term storage, store it at -20 ?C?-80 ?C. Form: Liquid or lyophilized powder. EXWM-1306; protochlorophyllide reductase; EC 1.3.1.33; 68518-04-7; NADPH2-protochlorophyllide oxidoreductase; NADPH-protochlorophyllide oxidoreductase; NADPH-protochlorophyllide reductase; protochlorophyllide oxidoreductase (ambiguous); protochlorophyllide photooxidoreductase; light-dependent protochlorophyllide reductase. Cat No: EXWM-1306. | |
| Protodeltonin | Protodeltonin. Group: Biochemicals. Grades: Plant Grade. CAS No. 94992-08-2. Pack Sizes: 10mg. Molecular Formula: C51H84O23, Molecular Weight: 1065.21. US Biological Life Sciences. | Worldwide |
| protodeoxyviolaceinate monooxygenase | The enzyme, characterized from the bacterium Chromobacterium violaceum, participates in the biosynthesis of the violet pigment violacein. The product, protoviolaceinate, can be acted upon by EC 1.14.13.224, violacein synthase, leading to violacein production. However, it is very labile, and in the presence of oxygen can undergo non-enzymic autooxidation to the shunt product proviolacein. Group: Enzymes. Synonyms: vioD (gene name); protoviolaceinate synthase. Enzyme Commission Number: EC 1.14.13.217. Storage: Store it at +4 ?C for short term. For long term storage, store it at -20 ?C?-80 ?C. Form: Liquid or lyophilized powder. EXWM-0819; protodeoxyviolaceinate monooxygenase; EC 1.14.13.217; vioD (gene name); protoviolaceinate synthase. Cat No: EXWM-0819. | |
| Protodioscin | Protodioscin has been demonstrated to trigger release of nitric oxide in corpus cavernosum tissue, and also to produce statistically significant increases in the levels of the hormones testosterone, dihydrotestosterone and dehydroepiandrosterone in animal studies. Uses: Antihyperlipidemic. Synonyms: (3b, 25R)-26-(b-D-glucopyranosyloxy)-22-hydroxyfurost-5-en-3-yl O-6-deoxy-a-L-mannopyranosyl-(1-2)-O-[6-deoxy-a-L-mannopyranosyl-(1-4)]-b-D-glucopyranoside. Grades: >98%. CAS No. 55056-80-9. Molecular formula: C51H84O22. Mole weight: 1049.22. | |
| Protodioscin | Protodioscin - Product ID: NST-10-58. Category: Sterols. Purity: 98%. Test method: HPLC. CAS No. 55056-80-9. Pack Sizes: 0,05g, 0,1g, 0,25g, 0,5g. Appearance: White to beige colored powder. Molecular formula: C51H84O22. Mole weight: 1049.2. Storage: +2 +8 °C. | |
| Protodioscin | Protodioscin. Group: Biochemicals. Alternative Names: Saponin C. Grades: Plant Grade. CAS No. 55056-80-9. Pack Sizes: 20mg. Molecular Formula: C51H84O22, Molecular Weight: 1049.2. US Biological Life Sciences. | Worldwide |
| Protodioscin | Protodioscin, a major steroidal saponin in Trigonella foenum-graecum Linn., has been shown to exhibit multiple biological actions, such as anti-hyperlipidemia, anti-cancer, sexual effects and cardiovascular properties. Uses: Scientific research. Group: Natural products. CAS No. 55056-80-9. Pack Sizes: 10 mM * 1 mL; 5 mg; 10 mg; 25 mg; 50 mg; 100 mg. Product ID: HY-N0799. | |
| protodioscin 26-O-β-D-glucosidase | The enzyme has been characterized from the plants Cheilocostus speciosus and Solanum torvum. It also hydrolyses the 26-β-D-glucose group from related steroid glucosides such as protogracillin, torvoside A and torvoside H. Group: Enzymes. Synonyms: F26G; torvosidase; CSF26G1; furostanol glycoside 26-O-β-D-glucosidase; furostanol 26-O-β-D-glucoside glucohydrolase. Enzyme Commission Number: EC 3.2.1.186. Storage: Store it at +4 ?C for short term. For long term storage, store it at -20 ?C?-80 ?C. Form: Liquid or lyophilized powder. EXWM-3870; protodioscin 26-O-β-D-glucosidase; EC 3.2.1.186; F26G; torvosidase; CSF26G1; furostanol glycoside 26-O-β-D-glucosidase; furostanol 26-O-β-D-glucoside glucohydrolase. Cat No: EXWM-3870. | |
| Protogracillin | Protogracillin. Group: Biochemicals. Grades: Plant Grade. CAS No. 54848-30-5. Pack Sizes: 10mg. Molecular Formula: C51H84O23, Molecular Weight: 1065.21. US Biological Life Sciences. | Worldwide |
| Protoneogracillin | Protoneogracillin, a furostanol glycoside, shows anti-fungal activity against the plant pathogenic fungus P.oryzae (MMDC=94.0 μM) and cytotoxic activity on K562 cancer cells (IC50=6.6 μM). Group: Inhibitors. CAS No. 191334-50-6. Molecular formula: C51H84O23. Mole weight: 1065.2. Appearance: Solid. Canonical SMILES: C[C@@]12[C@] (C[C@@]3 ([H])[C@]2 ([H])[C@@H] ([C@] (O) (O3)CC[C@H] (C)CO[C@@H]4O[C@@H] ([C@H] ([C@@H] ([C@H]4O)O)O)CO)C) ([H])[C@@]5 ([H])[C@] ([C@@]6 (C (C[C@H] (CC6)O[C@H]7[C@@H] ([C@H] ([C@@H] ([C@H] (O7)CO)O)O[C@@H]8O[C@@H] ([C@H] ([C@@H] ([C@H]8O)O)O)CO)O[C@H]9[C@@H] ([C@@H] ([C@H] ([C@@H] (O9)C)O)O)O)=CC5)C) ([H])CC1. Catalog: ACM191334506. | |
| proton-translocating NAD(P)+ transhydrogenase | The enzyme is a membrane bound proton-translocating pyridine nucleotide transhydrogenase that couples the reversible reduction of NADP by NADH to an inward proton translocation across the membrane. In the bacterium Escherichia coli the enzyme provides a major source of cytosolic NADPH. Detoxification of reactive oxygen species in mitochondria by glutathione peroxidases depends on NADPH produced by this enzyme. Group: Enzymes. Synonyms: pntA (gene name); pntB (gene name); NNT (gene name). Enzyme Commission Number: EC 7.1.1.1 (Formerly EC 1.6.1.5). Storage: Store it at +4 ?C for short term. For long term storage, store it at -20 ?C?-80 ?C. Form: Liquid or lyophilized powder. EXWM-1578; proton-translocating NAD(P)+ transhydrogenase; EC 1.6.1.5; pntA (gene name); pntB (gene name); NNT (gene name). Cat No: EXWM-1578. | |
| Proto-oncogene PIM1 (191-199) | Proto-oncogene PIM1 (191-199) is a 9-aa peptide. Pim-1's role in oncogenic signalling has led to it becoming a widely studied target in cancer research, with numerous drug candidates under investigation which target it. | |
| Protopanaxadiol, 20S- | Protopanaxadiol, 20S-. Group: Biochemicals. CAS No. 30636-90-9. Pack Sizes: 5mg. US Biological Life Sciences. | Worldwide |
| protopanaxadiol 6-hydroxylase | A heme-thiolate protein (P-450). Involved in the biosynthetic pathway of ginsenosides. Isolated from the rhizomes of ginseng (Panax ginseng). Group: Enzymes. Synonyms: protopanaxatriol synthase; P6H; CYP716A53v2; protopanaxadiol,NADPH:O2 oxidoreductase (6α-hydroxylating). Enzyme Commission Number: EC 1.14.13.184. Storage: Store it at +4 ?C for short term. For long term storage, store it at -20 ?C?-80 ?C. Form: Liquid or lyophilized powder. EXWM-0783; protopanaxadiol 6-hydroxylase; EC 1.14.13.184; protopanaxatriol synthase; P6H; CYP716A53v2; protopanaxadiol,NADPH:O2 oxidoreductase (6α-hydroxylating). Cat No: EXWM-0783. | |
| Protopanaxatriol | Botanical Source: Group: Biochemicals. Alternative Names: (20R)-Protopanaxatriol. Grades: Plant Grade. CAS No. 1453-93-6. Pack Sizes: 10mg. US Biological Life Sciences. | Worldwide |
| Protopanaxatriol, 20S- | Protopanaxatriol, 20S-. Group: Biochemicals. CAS No. 34080-08-5. Pack Sizes: 5mg. US Biological Life Sciences. | Worldwide |
| Protopine | Protopine (Corydinine), an isoquinoline alkaloid, is a specific reversible and competitive inhibitor of acetylcholinesterase. Protopine exhibits anti-inflammation, anti-microbial, anti-angiogenic and anti-tumour activity [1] [2]. Uses: Scientific research. Group: Natural products. Alternative Names: Corydinine. CAS No. 130-86-9. Pack Sizes: 10 mM * 1 mL; 5 mg; 10 mg; 25 mg; 50 mg; 100 mg. Product ID: HY-N0793. | |
| Protopine | Protopine is a Ca2+ channel blocker and antiplatelet agent. Immunomodulator. Group: Biochemicals. Alternative Names: 4,6,7,14-Tetrahydro-5-methyl-. Grades: Highly Purified. CAS No. 130-86-9. Pack Sizes: 10mg. US Biological Life Sciences. | Worldwide |
| protopine 6-monooxygenase | A heme-thiolate protein (P-450) involved in benzophenanthridine alkaloid synthesis in higher plants. Group: Enzymes. Synonyms: protopine 6-hydroxylase. Enzyme Commission Number: EC 1.14.13.55. CAS No. 128561-60-4. Storage: Store it at +4 ?C for short term. For long term storage, store it at -20 ?C?-80 ?C. Form: Liquid or lyophilized powder. EXWM-0862; protopine 6-monooxygenase; EC 1.14.13.55; 128561-60-4; protopine 6-hydroxylase. Cat No: EXWM-0862. | |
| Protopine N-Oxide | Protopine N-Oxide. Uses: For analytical and research use. Group: Impurity standards. CAS No. 87264-51-5. Molecular Formula: C20H19NO6. Mole Weight: 369.37. Catalog: APS87264515. SMILES: C[N+]1 ([O-])CCc2cc3OCOc3cc2C (=O)Cc4ccc5OCOc5c4C1. Format: Neat. Shipping: Room Temperature. |  |
| Protoporphyrinato zinc | Protoporphyrinato zinc. Group: other materials. Alternative Names: PROTOPORPHYRINATO ZINC; dihydrogen [3, 8, 13, 17-tetramethyl-7, 12-divinyl-21H, 23H-porphine-2, 18-dipropionato(4-)-N21, N22, N23, N24]zincate(4-); Zinc protoporphyrin trihydrate; Zinc protoporphyrin trihydrate, 95+%. CAS No. 15442-64-5. Product ID: zinc; 3-[18-(2-carboxyethyl)-8,13-bis(ethenyl)-3,7,12,17-tetramethylporphyrin-21,23-diid-2-yl]propanoic acid. Molecular formula: 626g/mol. Mole weight: C34H32N4O4Zn. CC1=C (C2=CC3=NC (=CC4=C (C (=C ([N-]4)C=C5C (=C (C (=N5)C=C1[N-]2)C)C=C)C)C=C)C (=C3CCC (=O)O)C)CCC (=O)O. [Zn+2]. InChI=1S/C34H34N4O4. Zn/c1-7-21-17 (3)25-13-26-19 (5)23 (9-11-33 (39)40)31 (37-26)16-32-24 (10-12-34 (41)42)20 (6)28 (38-32)15-30-22 (8-2)18 (4)27 (36-30)14-29 (21)35-25; /h7-8, 13-16H, 1-2, 9-12H2, 3-6H3, (H4, 35, 36, 37, 38, 39, 40, 41, 42); /q; +2/p-2. FUTVBRXUIKZACV-UHFFFAOYSA-L. |  |
| protoporphyrin ferrochelatase | The enzyme catalyses the terminal step in the heme biosynthesis pathways of eukaryotes and Gram-negative bacteria. Group: Enzymes. Synonyms: ferro-protoporphyrin chelatase; iron chelatase (ambiguous); heme synthetase (ambiguous); heme synthase (ambiguous); protoheme ferro-lyase; ferrochelatase (ambiguous). Enzyme Commission Number: EC 4.99.1.1. CAS No. 9012-93-5. Storage: Store it at +4 ?C for short term. For long term storage, store it at -20 ?C?-80 ?C. Form: Liquid or lyophilized powder. EXWM-5358; protoporphyrin ferrochelatase; EC 4.99.1.1; 9012-93-5; ferro-protoporphyrin chelatase; iron chelatase (ambiguous); heme synthetase (ambiguous); heme synthase (ambiguous); protoheme ferro-lyase; ferrochelatase (ambiguous). Cat No: EXWM-5358. | |
| Protoporphyrin IX | Created by the enzyme protoporphyrinogen oxidase, protoporphyrin IX is an important precursor to biologically essential prosthetic groups. Uses: Metabolism of porphyrin. Synonyms: Protoporphyrin; 3-[18-(2-carboxyethyl)-8,13-bis(ethenyl)-3,7,12,17-tetramethyl-22,23-dihydroporphyrin-2-yl]propanoic acid. Grades: ≥95%. CAS No. 553-12-8. Molecular formula: C34H34N4O4. Mole weight: 562.66. | |
| Protoporphyrin IX | Protoporphyrin IX is an important precursor to biologically essential prosthetic groups such as heme, cytochrome c, and chlorophylls. As a result, a number of organisms are able to synthesize this tetrapyrrole from basic precursors such as glycine and succinyl CoA, or glutamate. Despite the wide range of organisms that synthesize protoporphyrin IX the process is largely conserved from bacteria to mammals with a few distinct exceptions in higher plants.[1][2][3]. Group: Biochemicals. Alternative Names: 3,18-Divinyl-2,7,13,17-tetramethylporphine-8, 12-dipropionic acid. Grades: Reagent Grade. CAS No. 553-12-8. Pack Sizes: 100mg, 250mg, 1g, 5g. US Biological Life Sciences. | Worldwide |
| Protoporphyrin IX | Protoporphyrin IX is a final intermediate in the heme biosynthetic pathway, which acts as a radiation sensitizer enhancing ROS generation even in a hypoxic state and inducing DNA damage. Protoporphyrin IX also acts as a photo sensitizer undergoing photobleaching that occurs through direct degradation by light irradiation. Protoporphyrin IX is formed and accumulated following 5-aminolevulinic acid (5-ALA) (HY-W000450) administration in the tumor cells of rats. Protoporphyrin IX causes selective improvement of basal cell carcinoma when activated red fluorescence of a peak wavelength at 405 nm. Protoporphyrin IX is promising for research of sonodynamic and photodynamic agents for a wide range of cancers, such as bladder cancer and nodular basal cell carcinoma [1] [2] [3] [4] [5]. Uses: Scientific research. Group: Natural products. CAS No. 553-12-8. Pack Sizes: 100 mg; 250 mg. Product ID: HY-B1247. | |
| Protoporphyrin IX cobalt chloride | Heterocyclic Organic Compound. Alternative Names: Protoporphyrin IX cobalt chloride;102601-60-5;Co(iII) protoporphyrin ix chloride. CAS No. 102601-60-5. Molecular formula: C34H32ClCoN4O4. Mole weight: 655.037g/mol. IUPACName: 3-[18-(2-carboxyethyl)-7,12-bis(ethenyl)-3,8,13,17-tetramethylporphyrin-21,23-diid-2-yl]propanoic acid;chlorocobalt(2+). Canonical SMILES: CC1=C (C2=CC3=NC (=CC4=C (C (=C ([N-]4)C=C5C (=C (C (=N5)C=C1[N-]2)C)CCC (=O)O)CCC (=O)O)C)C (=C3C)C=C)C=C. Cl[Co+2]. Catalog: ACM102601605. | |
| Protoporphyrin IX-d6 | Protoporphyrin IX-d6 is the labeled version of Protoporphyrin IX (CAS: 553-12-8). Protoporphyrin IX (PPIX) is ubiquitously present in all living cells in small amounts as a precursor of heme and PPIX-based strategies have been used for cancer diagnosis and treatment. It can be used in biological study for role of protoporphyrin IX in skin photosensitivity, biliary stones, hepatobiliary damage, liver failure and cancer diagnosis and treatment in human. Group: Biochemicals. Alternative Names: Protoporphyrin IX di-Me Ester-d6; 3,7,12,17-Tetramethyl-8,13-divinyldimethyl Ester 2,18-Porphinedipropionic Acid-d6. Grades: Highly Purified. CAS No. 553-12-8 Unlabeled. Pack Sizes: 500ug, 2.5mg. Molecular Formula: C??H??D?N?O?, Molecular Weight: 596.75. US Biological Life Sciences. | Worldwide |
| protoporphyrinogen IX dehydrogenase (menaquinone) | This enzyme enables Escherichia coli to synthesize heme in both aerobic and anaerobic environments. Group: Enzymes. Synonyms: HemG. Enzyme Commission Number: EC 1.3.5.3. Storage: Store it at +4 ?C for short term. For long term storage, store it at -20 ?C?-80 ?C. Form: Liquid or lyophilized powder. EXWM-1387; protoporphyrinogen IX dehydrogenase (menaquinone); EC 1.3.5.3; HemG. Cat No: EXWM-1387. | |
| protoporphyrinogen oxidase | This is the last common enzyme in the biosynthesis of chlorophylls and heme. Two isoenzymes exist in plants: one in plastids and the other in mitochondria. This is the target enzyme of phthalimide-type and diphenylether-type herbicides. The enzyme from oxygen-dependent species contains FAD. Also slowly oxidizes mesoporphyrinogen IX. Group: Enzymes. Synonyms: protoporphyrinogen IX oxidase; protoporphyrinogenase; PPO; Protox; HemG; HemY. Enzyme Commission Number: EC 1.3.3.4. CAS No. 53986-32-6. Storage: Store it at +4 ?C for short term. For long term storage, store it at -20 ?C?-80 ?C. Form: Liquid or lyophilized powder. EXWM-1378; protoporphyrinogen oxidase; EC 1.3.3.4; 53986-32-6; protoporphyrinogen IX oxidase; protoporphyrinogenase; PPO; Protox; HemG; HemY. Cat No: EXWM-1378. | |
| PROTO_PROSY Protonectin | PROTO_PROSY Protonectin is an antimicrobial peptide found in Protonectarina sylveirae (Brazilian wasp), and has antibacterial activity against both gram-positive and gram-negative bacteria. It shows potent histamine releasing activities on rat peritoneal mast cells. Synonyms: Ile-Leu-Gly-Thr-Ile-Leu-Gly-Leu-Leu-Lys-Gly-Leu; Protonectin. Grades: ≥96%. Molecular formula: C58H107N13O14. Mole weight: 1210.57. | |
| Protopseudohypericin | Protopseudohypericin. Group: Biochemicals. Grades: Plant Grade. CAS No. 54328-09-5. Pack Sizes: 10mg. Molecular Formula: C30H18O9, Molecular Weight: 522.46. US Biological Life Sciences. | Worldwide |
| Protosappanin A | Phenols. CAS No. 102036-28-2. Molecular formula: C15H12O5. Mole weight: 272.25. Appearance: Powder. Purity: 0.98. Canonical SMILES: C1C (=O)COC2=C (C=CC (=C2)O)C3=CC (=C (C=C31)O)O. Catalog: ACM102036282. | |
| Protosappanin B | Protosappanin B. Group: Biochemicals. Grades: Plant Grade. CAS No. 102036-29-3. Pack Sizes: 20mg. Molecular Formula: C16H16O6, Molecular Weight: 304.3. US Biological Life Sciences. | Worldwide |
| protostadienol synthase | (17Z)-Protosta-17(20),24-dien-3β-ol is a precursor of the steroidal antibiotic helvolic acid. Group: Enzymes. Synonyms: PdsA; (S)-2,3-epoxysqualene mutase [cyclizing, (17Z)-protosta-17(20),24-dien-3β-ol-forming]. Enzyme Commission Number: EC 5.4.99.32. Storage: Store it at +4 ?C for short term. For long term storage, store it at -20 ?C?-80 ?C. Form: Liquid or lyophilized powder. EXWM-5573; protostadienol synthase; EC 5.4.99.32; PdsA; (S)-2,3-epoxysqualene mutase [cyclizing, (17Z)-protosta-17(20),24-dien-3β-ol-forming]. Cat No: EXWM-5573. | |
| Protostemonine | Botanical Source: Group: Biochemicals. Grades: Plant Grade. CAS No. 27495-40-5. Pack Sizes: 10mg, 20mg. US Biological Life Sciences. | Worldwide |
| Protostemotinine | Formula: Group: Biochemicals. Grades: Plant Grade. CAS No. 169534-85-4. Pack Sizes: 5mg, 10mg. US Biological Life Sciences. | Worldwide |
| Protoveratrine | Protoveratrine is an alkaloid that is found in the seeds of the red kidney bean. It has been shown to have a wide range of biological properties and can be used as an experimental model for congestive heart failure. Protoveratrine has also been shown to inhibit sodium citrate-induced hypernatremia and lc-ms/ms method, which is an analytical method for the quantification of human serum proteins. This compound also inhibits the expression of protein genes involved in energy metabolism, such as ATP synthase and pyruvate dehydrogenase kinase 4. Protoveratrine has been shown to be effective against autoimmune diseases, such as lupus erythematosus, which are caused by autoantibodies that attack the body's own cells. Group: Other alkaloids. Alternative Names: Protoveratrine A. CAS No. 143-57-7. Molecular formula: C41H63NO14. Mole weight: 793.94 g/mol. Canonical SMILES: CC[C@@H] (C)C (=O)O[C@H]1[C@@H] ([C@H]2[C@@H] (CN3C[C@H] (CC[C@H]3[C@@]2 (C)O)C)[C@H]4[C@@]1 ([C@@H]5[C@@H] ([C@@H] ([C@H]6[C@]7 ([C@]5 (C4)O[C@@]6 ([C@H] (CC7)OC (=O)[C@] (C) (CC)O)O)C)OC (=O)C)OC (=O)C)O)O. Catalog: ACM143577. | |
| Protoveratrine b | Heterocyclic Organic Compound. Alternative Names: PROTOVERATRINE B; NEOPROTOVERATRINE; 4-beta, 6-alpha, 7-alpha, 14, 15-alpha-16-beta, 20-octol, 4, 9-epoxy-cevane-3-bet; 6, 7-diacetate3-(threo-(+)-2, 3-dihydroxy-2-methylbutyrate)15-((-)-2-methylbut; neoprotoveratrin; veratetrin; yrate); [3beta(2R, 3R), 4alpha, 6alpha, 7alp. CAS No. 124-97-0. Molecular formula: C41H63NO15. Mole weight: 809.94. Catalog: ACM124970. | |
| Protoverine | Protoverine is a nitrogen-containing steroidal alkaloid that acts on the central nervous system. It has been shown to have electrophysiological effects, such as inhibition of acetylcholine release, and antihypertensive activity. Protoverine has also been shown to inhibit the growth of brain tumor cells in culture. Protoverine is reduced by borohydride and converted to tiglic acid, which inhibits Na channels in rat ventricular myocytes. The reduction of protoverine is temperature dependent and can be measured using titration calorimetry. Group: Other alkaloids. CAS No. 76-45-9. Molecular formula: C27H43NO9. Mole weight: 525.63 g/mol. Canonical SMILES: C[C@H]1CC[C@H]2[C@@] ([C@@H]3[C@@H] (CN2C1)[C@@H]4C[C@@]56[C@H] ([C@@]4 ([C@H] ([C@@H]3O)O)O)[C@@H] ([C@@H] ([C@H]7[C@@]5 (CC[C@@H] ([C@]7 (O6)O)O)C)O)O) (C)O. Catalog: ACM76459. | |
| Protriptyline-10,11-Epoxide | A metabolite of Protriptyline. Protriptyline is a tricyclic antidepressant for the treatment of depression and ADHD. Grades: > 95%. Molecular formula: C19H21NO. Mole weight: 279.39. | |
| Protriptyline-d3 Hydrochloride | Protriptyline-d3 Hydrochloride. Group: Biochemicals. Alternative Names: N-Methyl-5H-dibenzo[a, d]cycloheptene-5-propanamine-d3 Hydrochloride; N-Methyl-5H-dibenzo[a, d]cycloheptene-5-propanamine-d3 Hydrochloride; N-Methyl-5H-Dibenzo[a, d]cycloheptene-5-propylamine-d3 Hydrochloride; Concordin-d3; MK-240-d3; Maximed-d3; Maximet-d3; N-Methyl-5H-dibenzo[a, d]cycloheptene-5-propylamine-d3 Hydrochloride; Normethyl EX4442-d3; Protriptyline-d3 Hydrochloride; Protryptyline-d3 Hydrochloride; Triptil-d3 Hydrochloride; Vivactil-d3 Hydrochloride. Grades: Highly Purified. CAS No. 1435934-21-6. Pack Sizes: 1mg. Molecular Formula: C19H19D3ClN, Molecular Weight: 302.86. US Biological Life Sciences. | Worldwide |
| Protriptyline hydrochloride | Protriptyline hydrochloride is a tricyclic antidepressant (TCA), specifically a secondary amine, for the treatment of depression and ADHD. Uses: Scientific research. Group: Signaling pathways. CAS No. 1225-55-4. Pack Sizes: 10 mM * 1 mL; 5 mg; 10 mg; 25 mg; 50 mg. Product ID: HY-B0949. | |
| Protriptyline Hydrochloride | Protriptyline Hydrochloride. Group: Biochemicals. Alternative Names: N-Methyl-5H-dibenzo[a, d]cycloheptene-5-propanamine Hydrochloride; N-Methyl-5H-dibenzo[a, d]cycloheptene-5-propanamine Hydrochloride; N-Methyl-5H-Dibenzo[a, d]cycloheptene-5-propylamine Hydrochloride; Concordin; MK-240; Maximed; Maximet; N-Methyl-5H-dibenzo[a, d]cycloheptene-5-propylamine Hydrochloride; Normethyl EX4442; Protriptyline hydrochloride; Protryptyline Hydrochloride; Triptil Hydrochloride; Vivactil Hydrochloride. Grades: Highly Purified. CAS No. 1225-55-4. Pack Sizes: 50mg. Molecular Formula: C19H22ClN, Molecular Weight: 299.839999999999. US Biological Life Sciences. | Worldwide |
| Protriptyline Hydrochloride | The hydrochloride salt of Protriptyline which is a norepinephrine uptake blocker that could be effective as an antidepressant. Uses: The hydrochloride salt of protriptyline which is a norepinephrine uptake blocker that could be effective as an antidepressant. Synonyms: PROTRIPTYLINE HCL;PROTRIPTYLINE HYDROCHLORIDE; 5-(3-methylaminopropyl)-5h-dibenzo(a, d)cycloheptenehydrochloride; concordin; d)cyclohepten-5-propylamine, n-methyl-5h-dibenzo(hydrochloride; maximed; mk-240; n-methyl-5h-dibenzo(a, d)cycloheptene-5-propylaminehydroc. Grades: 95%. CAS No. 1225-55-4. Molecular formula: C19H21N.HCl. Mole weight: 299.84. | |
| Protriptyline-N-Oxide | A metabolite of Protriptyline. Protriptyline is a tricyclic antidepressant for the treatment of depression and ADHD. Grades: > 95%. Molecular formula: C19H21NO. Mole weight: 279.39. | |
| Pro-Trp-OH | Pro-Trp-OH. Group: Biochemicals. Grades: Reagent Grade. Pack Sizes: 100mg, 250mg. US Biological Life Sciences. | Worldwide |
| Pro-Trp-OH | Synonyms: L-Prolyl-L-tryptophan; Pro Trp OH. Grades: ≥ 99% (TLC). CAS No. 35310-39-5. Molecular formula: C16H19N3O3. Mole weight: 301.35. | |
| ProTx I | ProTx I, a toxin that was originally isolated from the venom of Thrixopelma pruriens (Peruvian green velvet tarantula), blocks native mouse CaV3.1 channel and recombinant human CaV3.1 channel currents similarly, and blocks to a lesser extent CaV3.2 and CaV3.3 channel currents. Synonyms: ProTxI; ProTx-I; H-Glu-Cys(1)-Arg-Tyr-Trp-Leu-Gly-Gly-Cys(2)-Ser-Ala-Gly-Gln-Thr-Cys(3)-Cys(1)-Lys-His-Leu-Val-Cys(2)-Ser-Arg-Arg-His-Gly-Trp-Cys(3)-Val-Trp-Asp-Gly-Thr-Phe-Ser-OH; L-alpha-glutamyl-L-cysteinyl-L-arginyl-L-tyrosyl-L-tryptophyl-L-leucyl-glycyl-glycyl-L-cysteinyl-L-seryl-L-alanyl-glycyl-L-glutaminyl-L-threonyl-L-cysteinyl-L-cysteinyl-L-lysyl-L-histidyl-L-leucyl-L-valyl-L-cysteinyl-L-seryl-L-arginyl-L-arginyl-L-histidyl-glycyl-L-tryptophyl-L-cysteinyl-L-valyl-L-tryptophyl-L-alpha-aspartyl-glycyl-L-threonyl-L-phenylalanyl-L-serine (2->16),(9->21),(15->28)-tris(disulfide). Grades: >98%. CAS No. 484598-35-8. Molecular formula: C171H245N53O47S6. Mole weight: 3987.51. | |
| ProTx I | ProTx I. Group: Biochemicals. Grades: Purified. CAS No. 484598-35-8. Pack Sizes: 100ug. US Biological Life Sciences. | Worldwide |
| ProTx II | ProTx II is a selective NaV1.7 channel blocker with 100-fold selectivity over other sodium channel subtypes. Synonyms: YCQKWMWTCDSERKCCEGMVCRLWCKKKLW. Grades: >98%. CAS No. 484598-36-9. Molecular formula: C168H250N46O41S8. Mole weight: 3826.59. | |
| ProTx II | ProTx II. Group: Biochemicals. Grades: Purified. CAS No. 484598-36-9. Pack Sizes: 100ug. US Biological Life Sciences. | Worldwide |
| ProTx III | ProTx III, isolated from the venom of the Peruvian green-velvet tarantula Thrixopelma pruriens, is a potent Nav1.7 blocker (IC50 = 2.5 nM) and also inhibits Nav1.1, Nav1.2, Nav1.3 and Nav1.6 in the nanomolar range. Synonyms: DCLKFGWKCNPRNDKCCSGLKCGSNHNWCKLHI. Grades: >98%. Molecular formula: C162H246N52O43S6. Mole weight: 3802.41. | |
| Pro-Tyr-OH | Synonyms: L-Prolyl-L-tyrosine; Pro Tyr OH. Grades: ≥ 99% (Assay). CAS No. 19786-36-8. Molecular formula: C14H18N2O4. Mole weight: 278.31. | |
| Pro-Tyr-OH | Pro-Tyr-OH. Group: Biochemicals. Alternative Names: L-Prolyl-L-tyrosine. Grades: Highly Purified. CAS No. 19786-36-8. Pack Sizes: 100mg. US Biological Life Sciences. | Worldwide |
| Pro-Tyr-OH ≥97%. | Pro-Tyr-OH ≥97%. Group: Biochemicals. Grades: Reagent Grade. Pack Sizes: 100mg. US Biological Life Sciences. | Worldwide |
| Pro-Urokinase from Human, recombinant | Urokinase or Urokinase-type plasminogen activator (uPA) is a serine protease (EC 3.4.21.73). It is secreted as a single-chain zymogen, pro-Urokinase, possessing little or no intrinsic enzymatic activity. The single chain zymogen is converted into the active two chain enzyme (tcuPA) by cleavage of the bond between Lys157 and Ile158. After activation, Urokinase specifically cleaves the proenzyme plasminogen to form the active enzyme plasmin. The active plasmin then catalyzes the breakdown of fibrin polymers of blood clots. Urokinase is involved in a number of biological functions including fibrinolysis, embryogenesis, cell migration, tissue remodeling, ovulation, and wound healing. Additionally, it is a potent marker of invasion and metastasis in a variety of human cancers associated with breast, stomach, colon, bladder, ovary, brain and endometrium. Group: Enzymes. Synonyms: Single chain Urokinase-type plasminogen activator; s. Purity: > 90% by SDS-PAGE. Pro-Urokinase. Mole weight: 49.3 kDa. Activity: >1200 mU/mg. Storage: Stable at -80°C for at least 1 year as supplied. Store reconstituted aliquots at -80°C. Avoid repeated freeze and thaw cycles. Form: Lyophilized powder. Source: E. coli. Species: Human. Single chain Urokinase-type plasminogen activator; scuPA; Urokinase-type Plasminogen Activator uPA; PLAU; Pro-Urokinase. Cat No: NATE-1689. | |
| Provean impurity 1 | Provean impurity 1. Uses: For analytical and research use. Group: Impurity standards. CAS No. 1932478-97-1. Molecular Formula: C9H15NO2. Mole Weight: 169.22. Catalog: APB1932478971. | |
Our database is helping our users find suppliers everyday.
