Find where to buy products from suppliers in the USA, including: distributors, industrial manufacturers in America, bulk supplies and wholesalers of raw ingredients & finished goods.
Search for products or services, then visit the American suppliers website for prices, SDS or more information. You can also view suppliers in Australia, NZ or the UK.
| Product | Description | |
|---|---|---|
| Glucagon-like peptide 1 (1-37), human | Glucagon-like peptide 1 (1-37) is a pancreatic hormone synthesized by post-translational processing of proglucagon. It decreases plasma glucose level in high-fat-fed mice when administered at 25 nmol/kg. Glucagon-like peptide 1 (1-37) exhibits no effect on food intake in rats and does not enhance pancreatic insulin secretion. However it induces insulin expression in intestinal epithelial cells, which can restore glucose homeostasis when implanted into diabetic mice. Synonyms: HuGLP-1; GLP-1 (1-37) (human, bovine, guinea pig, mouse, rat); Preproglucagon (92-128) (human, bovine, guinea pig, mouse, rat); H-His-Asp-Glu-Phe-Glu-Arg-His-Ala-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Val-Ser-Ser-Tyr-Leu-Glu-Gly-Gln-Ala-Ala-Lys-Glu-Phe-Ile-Ala-Trp-Leu-Val-Lys-Gly-Arg-Gly-OH; L-histidyl-L-alpha-aspartyl-L-alpha-glutamyl-L-phenylalanyl-L-alpha-glutamyl-L-arginyl-L-histidyl-L-alanyl-L-alpha-glutamyl-glycyl-L-threonyl-L-phenylalanyl-L-threonyl-L-seryl-L-alpha-aspartyl-L-valyl-L-seryl-L-seryl-L-tyrosyl-L-leucyl-L-alpha-glutamyl-glycyl-L-glutaminyl-L-alanyl-L-alanyl-L-lysyl-L-alpha-glutamyl-L-phenylalanyl-L-isoleucyl-L-alanyl-L-tryptophyl-L-leucyl-L-valyl-L-lysyl-glycyl-L-arginyl-glycine. Grades: ≥95%. CAS No. 87805-34-3. Molecular formula: C186H275N51O59. Mole weight: 4169.48. |  |
| Glucagon-Like Peptide 1 Receptor Agonist | A nonpeptidic quinoxaline compound that acts as a GLP-1R agonist and an allosteric modulator of GLP-1 binding. Shown to induce GLP-1R-mediated cAMP production in BHK plasma membrane preparations (EC50=101nM) and potentiate glucose-dependent insulin release in pancreatic islets derived from wild-type, but not GLP-1R -/-, mice. Unlike GLP-1, its biological activity is not inhibited by orthosteric antagonists such as Exendin. Group: Biochemicals. Alternative Names: 6,7-dichloro-N-(1,1-dimethylethyl)-3-(methylsulfonyl)-, 6,7-dichloro-2-methylsulfonyl-3-N-tert-butylaminoquinoxaline (DMB); Compound 2; GLP-1R Agonist. Grades: Highly Purified. CAS No. 281209-71-0. Pack Sizes: 5mg. Molecular Formula: C??H??Cl?N?O?S, Molecular Weight: 348.3. US Biological Life Sciences. |  Worldwide |
| Glucagon-Like Peptide 1 Receptor Agonist - CAS 281209-71-0 | The Glucagon-Like Peptide 1 Receptor Agonist, also referenced under CAS 281209-71-0, controls the biological activity of Glucagon-Like Peptide 1 Receptor. This small molecule/inhibitor is primarily used for Cell Signaling applications. Group: Fluorescence/luminescence spectroscopy. |  |
| Glucagon-Like Peptide 1 Receptor Agonist II (4- (3- (benzyloxy) phenyl) -2- (ethylsulfinyl) -6- (trifluoromethyl) pyrimidine, Glucagon-Like Peptide 1 Receptor Agonist II, Compound B) | A pyrimidine small molecule that acts as a GLP-1 allosteric agonist that induces cAMP signaling in HEK293 cells expressing the GLP-1 receptor with EC50 = 0.66uM and 99% efficacy (similar data with rat GLP-1 receptor), does not compete with radiolabelled GLP-1 in receptor binding assays, and is not active in cells expressing the GLP-2, GIP, PTH, or glucagon receptors. In rodent islets, insulin secretion increases in a dose-dependent and glucose-dependent manner, either alone or in an additive fashion when combined with the endogenous GLP-1 peptide. In vivo, this molecule exhibits insulinotropic effects when dosed at 10mg/kg in SD rats undergoing an IVGTT and a hyperglycemic clamp. It is also shown to increase insulin secretion in perifusion assays involving normal and diabetic human islets ex vivo, at concentrations between 1 and 10uM. Group: Biochemicals. Grades: Highly Purified. Pack Sizes: 10mg. US Biological Life Sciences. | Worldwide |
| 8-Glycine-36-L-argininamide-7-36-Glucagon-like peptide 1 (Octodon degus) | 8-Glycine-36-L-argininamide-7-36-Glucagon-like peptide 1 (Octodon degus) is a long acting GLP-1 receptor agonist for the treatment of type 2 diabetes mellitus (T2DM). Synonyms: H-His-Gly-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Val-Ser-Ser-Tyr-Leu-Glu-Gly-Gln-Ala-Ala-Lys-Glu-Phe-Ile-Ala-Trp-Leu-Val-Lys-Gly-Arg-NH2; L-Histidylglycyl-L-α-glutamylglycyl-L-threonyl-L-phenylalanyl-L-threonyl-L-seryl-L-α-aspartyl-L-valyl-L-seryl-L-seryl-L-tyrosyl-L-leucyl-L-α-glutamylglycyl-L-glutaminyl-L-alanyl-L-alanyl-L-lysyl-L-α-glutamyl-L-phenylalanyl-L-isoleucyl-L-alanyl-L-tryptophyl-L-leucyl-L-valyl-L-lysylglycyl-L-argininamide; 7-36-Glucagon-like peptide 1 (Octodon degus), 8-glycine-36-L-argininamide-; Albiglutide; [Gly8,Arg36]-GLP 1 (7-36) amide (Octodon degus). Grades: ≥95%. CAS No. 224638-84-0. Molecular formula: C148H224N40O45. Mole weight: 3283.61. | |
| 8-Glycine-36-L-argininamide-7-36-Glucagon-like peptide 1 (Octodon degus) TFA | 8-Glycine-36-L-argininamide-7-36-Glucagon-like peptide 1 (Octodon degus) TFA is a long acting GLP-1 receptor agonist for the treatment of type 2 diabetes mellitus (T2DM). Synonyms: H-His-Gly-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Val-Ser-Ser-Tyr-Leu-Glu-Gly-Gln-Ala-Ala-Lys-Glu-Phe-Ile-Ala-Trp-Leu-Val-Lys-Gly-Arg-NH2.TFA; L-Histidylglycyl-L-α-glutamylglycyl-L-threonyl-L-phenylalanyl-L-threonyl-L-seryl-L-α-aspartyl-L-valyl-L-seryl-L-seryl-L-tyrosyl-L-leucyl-L-α-glutamylglycyl-L-glutaminyl-L-alanyl-L-alanyl-L-lysyl-L-α-glutamyl-L-phenylalanyl-L-isoleucyl-L-alanyl-L-tryptophyl-L-leucyl-L-valyl-L-lysylglycyl-L-argininamide trifluoroacetic acid; 7-36-Glucagon-like peptide 1 (Octodon degus), 8-glycine-36-L-argininamide-, trifluoroacetate; Albiglutide TFA; [Gly8,Arg36]-GLP 1 (7-36) amide (Octodon degus) TFA. Grades: ≥95%. Molecular formula: C150H225F3N40O47. Mole weight: 3397.63. | |
| AR 231453 | AR231453 is a potent and selective small molecule agonist of GPR119 that enhances glucose-dependent insulin secretion and glucagon-like peptide 1 (GLP-1) release. It is Antidiabetic agent. Synonyms: AR231453; AR-231453; AR 231453; AR-231,453; AR231,453; AR231,453. Grades: >98%. CAS No. 733750-99-7. Molecular formula: C21H24FN7O5S. Mole weight: 505.52. | |
| Arachidonyl serotonin | Arachidonyl serotonin is a dual target agent of transient receptor potential vanilloid-type I (TRPV1) antagonist and fatty acid amide hydrolase (FAAH) inhibitor, which is responsible for inactivation of anandamide and other endogenous cannabinoids. Its IC50 values are 37-40 nM and 5.6 μM for TRPV1 and FAAH respectively. It inhibits the FAAH activity isolated from mouse neuroblastoma cells with an IC50 value of 12 μM. It is a very tight binding, competitive inhibitor of FAAH. It does not inhibit cPLA2 and is essentially devoid of cannabimimetic activity. It was shown to be present in the ileum and jejunum of the gastrointestinal tract and modulate glucagon-like peptide-1 (GLP-1) secretion. It displays strong analgesic activity against both acute and chronic peripheral pain in rodents. Synonyms: AA-5HT; AA5HT; AA 5HT; N-arachidonoyl-serotonin; Arachidonoyl serotonin; N-[2-(5-hydroxy-1H-indol-3-yl)ethyl]-5Z,8Z,11Z,14Z-eicosatetraenamide; AA-5HT; AA5HT; N-arachidonoyl-serotonin; N-[2-(5-Hydroxy-1H-indol-3-yl)ethyl]-5,8,11,14-eicosatetraenamide; (5Z,8Z,11Z,14Z)-N-(2-(5-hydroxy-1H-indol-3-yl)ethyl)icosa-5,8,11,14-tetraenamide. CAS No. 187947-37-1. Molecular formula: C30H42N2O2. Mole weight: 462.67. | |
| BETP | BETP is a positive allosteric modulator and partial agonist of the glucagon-like peptide 1 (GLP-1) receptor, displaying no effect on GLP-2, GIP, PTH or glucagon receptors. BETP promotes oxyntomodulin binding to GLP-1 receptor. It potentiates oxyntomodulin-mediated GLP-1 receptor signaling in vitro and insulin secretion in vivo. Synonyms: 2-(Ethylsulfinyl)-4-[3-(phenylmethoxy)phenyl]-6-(trifluoromethyl)pyrimidine. Grades: ≥98% by HPLC. CAS No. 1371569-69-5. Molecular formula: C20H17F3N2O2S. Mole weight: 406.42. | |
| Boc5 | Boc5, a non-peptide glucagon-like peptide-1 (GLP-1R) receptor agonist. Synonyms: 1,3-Bis[[4-(Tert-Butoxy-Carbonylamino)Benzoyl]Amino]-2,4-Bis[3-Methoxy-4-(Thiophene-2-Carbonyloxy)-Phenyl]Cyclobutane-1,3-Dicarboxylic Acid. Grades: ≥98% by HPLC. CAS No. 917569-14-3. Molecular formula: C54H52N4O16S2. Mole weight: 1077.1. | |
| Bofanglutide | Bofanglutide (GZR18) is an analog of glucagon-like peptide-1 (GLP-1), which exhibits agonistic activity for GLP-1 receptor , with an EC 50 of 0.677 nM. GZR18 ameliorates type 2 diabetes [1]. Uses: Scientific research. Group: Peptides. Alternative Names: GZR18. CAS No. 2668298-70-0. Pack Sizes: 1 mg. Product ID: HY-P10269. |  |
| BPI-3016 | BPI-3016 is an analogue of human glucagon-like peptide 1 (hGLP-1) that has a long effect on type 2 diabetes mellitus. In vitro, BPI-3016 exhibited an affinity to GLP receptors and promotes cAMP production. In vivo, the half-life of BPI-3016 was 95h after single dosing in pharmacokinetic studies in diabetic cynomolgus monkey models. Uses: The treatment of type 2 diabetes. Synonyms: BPI-3016; BPI 3016; BPI3016. | |
| Cotadutide | Cotadutide (MEDI0382) is a potent dual agonist of glucagon-like peptide-1 (GLP-1) and GCGR with EC 50 values of 6.9 pM and 10.2 pM, respectively. Cotadutide exhibits ability to facilitate both weight loss and glycaemic control, and alleviate fibrosis. Cotadutide can be used in the research of obesity and type 2 diabetes (T2D) [1] [2] [3]. Uses: Scientific research. Group: Peptides. Alternative Names: MEDI0382. CAS No. 1686108-82-6. Pack Sizes: 5 mg; 10 mg. Product ID: HY-P2231. | |
| Danuglipron | Danuglipron (PF-06882961) is an orally active glucagon-like peptide-1 receptor (GLP-1R) agonist. Danuglipron has the potential for type 2 diabetes research [1] [2]. Uses: Scientific research. Group: Signaling pathways. Alternative Names: PF-06882961. CAS No. 2230198-02-2. Pack Sizes: 10 mM * 1 mL; 5 mg; 10 mg; 25 mg; 50 mg; 100 mg. Product ID: HY-125824. | |
| Danuglipron free base | Danuglipron, also known as PF-06882961 is a potent, orally bioavailable agonist of the glucagon-like peptide-1 receptor agonist (GLP-1R). WO 2019148044 (2019). Uses: Designed for use in research and industrial production. Additional or Alternative Names: Danuglipron; PF-06882961; PF 06882961; PF06882961; Danuglipron free base. Product Category: Agonists. Appearance: Solid powder. CAS No. 2230198-02-2. Molecular formula: C31H30FN5O4. Mole weight: 555.61. Purity: >98%. IUPACName: (S)-2-((4-(6-((4-cyano-2-fluorobenzyl)oxy)pyridin-2-yl)piperidin-1-yl)methyl)-1-(oxetan-2-ylmethyl)-1H-benzo[d]imidazole-6-carboxylic acid. Canonical SMILES: OC(C1=CC=C(N=C(CN2CCC(C3=NC(OCC4=CC=C(C#N)C=C4F)=CC=C3)CC2)N5C[C@H]6OCC6)C5=C1)=O. Product ID: ACM2230198022. Alfa Chemistry ISO 9001:2015 Certified. |  |
| Dapiglutide | Dapiglutide (ZP7570) is a long-acting glucagon-like peptide-1 receptor 1R (GLP-1R)/Glucagon-like peptide-2 receptor (GLP-2R) dual agonist. Dapiglutide alleviates intestinal dysfunction in a mouse short bowel model and has anti-obesity effects [1] [2] [3]. Uses: Scientific research. Group: Peptides. Alternative Names: ZP7570. CAS No. 2296814-85-0. Pack Sizes: 1 mg; 5 mg; 10 mg. Product ID: HY-P3291. | |
| Des-Glu(3)-Semaglutide | Des-Glu(3)-Semaglutide is an impurity of Semaglutide, which is a glucagon-like peptide-1 (GLP-1) receptor agonist used to treat type 2 diabetes. Synonyms: L-Histidyl-2-methylalanylglycyl-L-threonyl-L-phenylalanyl-L-threonyl-L-seryl-L-α-aspartyl-L-valyl-L-seryl-L-seryl-L-tyrosyl-L-leucyl-L-α-glutamylglycyl-L-glutaminyl-L-alanyl-L-alanyl-N6-[N-(17-carboxy-1-oxoheptadecyl)-L-γ-glutamyl-2-[2-(2-aminoethoxy)ethoxy]acetyl-2-[2-(2-aminoethoxy)ethoxy]acetyl]-L-lysyl-L-α-glutamyl-L-phenylalanyl-L-isoleucyl-L-alanyl-L-tryptophyl-L-leucyl-L-valyl-L-arginylglycyl-L-arginylglycine; H-His-Aib-Gly-Thr-Phe-Thr-Ser-Asp-Val-Ser-Ser-Tyr-Leu-Glu-Gly-Gln-Ala-Ala-Lys(AEEAc-AEEAc-γ-Glu-17-carboxyheptadecanoyl)-Glu-Phe-Ile-Ala-Trp-Leu-Val-Arg-Gly-Arg-Gly-OH; Des-Glu(9)-Semaglutide. Molecular formula: C182H284N44O56. Mole weight: 3984.53. | |
| Dimethyl DL-glutamate hydrochloride | Dimethyl DL-glutamate is a cell-permeant glutamic acid derivative that enhances insulin release in response to glucose in isolated islets and in animal models of diabetes. It also potentiates the insulinotropic potential of glyburide and glucagon-like peptide Dimethyl DL-glutamate is used as a cell-permeable form of glutamate in studies of glutamate action in β-cells. Synonyms: Glutamic acid dimethyl ester; Dimethyl 2-aminopentanedioate; Dimethyl 2-aminopentanedioate hydrochloride; H-DL-Glu(OMe)-OMe.HCl; H-DL-Glu(Ome)-Ome. Grades: ≥ 98% (HPLC). CAS No. 13515-99-6. Molecular formula: C7H13NO4·HCl. Mole weight: 211.6. | |
| Dipeptidyl peptidase IV | Dipeptidyl peptidase IV (DPP-IV) is a protease that inactivates insulin stimulating hormones such as glucagon-like peptide 1 (GLP-1) and glucose-dependent insulin-like polypeptide (GIP). Dipeptidyl peptidase IV can be used as a binding protein and ligand for various extracellular molecules. Dipeptidyl peptidase IV can be used in diabetes research [1] [2]. Uses: Scientific research. Group: Signaling pathways. Alternative Names: DPP-IV. CAS No. 54249-88-6. Pack Sizes: 10 mU. Product ID: HY-E70397. | |
| Dulaglutide | Dulaglutide (LY2189265) is a glucagon-like peptide-1 (GLP-1) receptor agonist. Dulaglutide can be uesd for the research of type 2 diabetes (T2D) [1] [2]. Uses: Scientific research. Group: Peptides. Alternative Names: LY2189265. CAS No. 923950-08-7. Pack Sizes: 1 mg; 5 mg. Product ID: HY-P0120. | |
| Ebenatide | Ebenatide is a long-acting glucagon-like peptide-1 recceptor agonist (GLP-1RA). Ebenatide is undergoing the clinical trial for the treatment of type 2 diabetes mellitus (T2DM). | |
| Ecnoglutide | Ecnoglutide (XW003) is a long-acting, cAMP-biased glucagon-like peptide 1 (GLP-1) receptor agonist. Ecnoglutide can be used for research of T2DM and obesity [1] [2]. Uses: Scientific research. Group: Peptides. Alternative Names: XW003. CAS No. 2459531-73-6. Pack Sizes: 5 mg; 10 mg. Product ID: HY-P3366. | |
| Efpeglenatide | Efpeglenatide is a long-acting glucagon-like peptide-1 receptor agonist (GLP-1RA). Efpeglenatide has been developed as an injection for type 2 diabetes mellitus (T2DM). Synonyms: efpeg. CAS No. 1296200-77-5. | |
| Exenatide | Exenatide, naturally occured in the saliva of the Gila monster, an incretin mimetic that has glucoregulatory effect. As a glucagon-like peptide-1 (GLP-1) receptor agonist, it stimulates proliferation of HCAECs through PKA-PI3K/Akt-eNOS activation pathways. Uses: Hypoglycemic agents. Synonyms: L-Serinamide, L-histidylglycyl-L-α-glutamylglycyl-L-threonyl-L-phenylalanyl-L-threonyl-L-seryl-L-α-aspartyl-L-leucyl-L-seryl-L-lysyl-L-glutaminyl-L-methionyl-L-α-glutamyl-L-α-glutamyl-L-α-glutamyl-L-alanyl-L-valyl-L-arginyl-L-leucyl-L-phenylalanyl-L-isoleucyl-L-α-glutamyl-L-tryptophyl-L-leucyl-L-lysyl-L-asparaginylglycylglycyl-L-prolyl-L-seryl-L-serylglycyl-L-alanyl-L-prolyl-L-prolyl-L-prolyl-; L-Histidylglycyl-L-α-glutamylglycyl-L-threonyl-L-phenylalanyl-L-threonyl-L-seryl-L-α-aspartyl-L-leucyl-L-seryl-L-lysyl-L-glutaminyl-L-methionyl-L-α-glutamyl-L-α-glutamyl-L-α-glutamyl-L-alanyl-L-valyl-L-arginyl-L-leucyl-L-phenylalanyl-L-isoleucyl-L-α-glutamyl-L-tryptophyl-L-leucyl-L-lysyl-L-asparaginylglycylglycyl-L-prolyl-L-seryl-L-serylglycyl-L-alanyl-L-prolyl-L-prolyl-L-prolyl-L-serinamide; Exendin 3 (Heloderma horridum), 2-glycine-3-L-glutamic acid-; Exendin 4 (Heloderma suspectum); AC 2993; AC 2993A; AC 2993LAR; Bydureon; Byetta; DA 3091; EQW; Exatenide; Exenatide LAR; Exendin 4; Exendin-4; ITCA 650; LAEx4; H-His-Gly-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Leu-Ser-Lys-Gln-Met-Glu-Glu-Glu-Ala-Val-Arg-Leu-Phe-Ile-Glu-Trp-Leu-Lys-Asn-Gly-Gly-Pro-Ser-Ser-Gly-Ala-Pro-Pro-Pro-Ser-NH2. CAS No. 141758-74-9. Molecular formula: C184H282N50O60S. Mole weight: 4186.56. | |
| Exenatide acetate | Exenatide acetate is a potent peptide agonist of the glucagon-like peptide 1 (GLP-1) receptor with Ki value of 136 pM. It is a 39 amino acid peptide, which increases intracellular cAMP in pancreatic acinar cells and has no effect on VIP receptors. It was first isolated from the venom of H. horridum and consequently synthesized. It stimulates proliferation of HCAECs through PKA-PI3K/Akt-eNOS activation pathways via a GLP-1 receptor-dependent mechanism. It also stimulates glucose-induced insulin secretion in isolated rat islets and proinsulin expression in mouse insulinoma βTC-1 cells. It protects hippocampal neurons against glutamate-induced apoptosis, suggesting utility in neurodegenerative diseases. It also has anxiolytic and anti-depressant effects and induces satiety. It is an incretin mimetic approved for type 2 diabetes mellitus treatment. It also has neurotrophic/protective activity in cellular and animal models of stroke, Alzheimer's and Parkinson's diseases. Synonyms: L-Serinamide, L-histidylglycyl-L-α-glutamylglycyl-L-threonyl-L-phenylalanyl-L-threonyl-L-seryl-L-α-aspartyl-L-leucyl-L-seryl-L-lysyl-L-glutaminyl-L-methionyl-L-α-glutamyl-L-α-glutamyl-L-α-glutamyl-L-alanyl-L-valyl-L-arginyl-L-leucyl-L-phenylalanyl-L-isoleucyl-L-α-glutamyl-L-tryptophyl-L-leucyl-L-lysyl-L-asparaginylglycylglycyl-L-prolyl-L-seryl-L-serylglycyl-L-alanyl-L-prolyl-L-prolyl-L-prolyl-, acetate (1:x); Exendin 4 (Heloderma suspectum), acetate; Exendin-4 acetate; H-His-Gly-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Leu-Ser-Lys-Gln-Met-Glu-Glu-Glu-Ala-Val-Arg-Leu-Phe-Ile-Glu-Trp-Leu-Lys-Asn-Gly-Gly-Pro-Ser-Ser-Gly-Ala-Pro-Pro-Pro-Ser-NH2.CH3CO2H. Grades: >98%. CAS No. 914454-01-6. Molecular formula: C184H282N50O60S.C2H4O2. Mole weight: 4246.61. | |
| Exendin 3 (9-39) | Exendin (9-39) is a specific and competitive glucagon-like peptide-1receptor antagonist (Kd = 1.7 nM at cloned human GLP-1 receptors). Exendin (9-39) inhibits insulin release and cAMP production caused by GLP-1 (7-36), exendin-3, and exendin-4. Synonyms: Exendin 9-39; Exendin 9 39; H-DL-Asp-DL-Leu-DL-Ser-DL-Lys-DL-Gln-DL-Met-DL-Glu-DL-Glu-DL-Glu-DL-Ala-DL-Val-DL-Arg-DL-Leu-DL-Phe-DL-xiIle-DL-Glu-DL-Trp-DL-Leu-DL-Lys-DL-Asn-Gly-Gly-DL-Pro-DL-Ser-DL-Ser-Gly-DL-Ala-DL-Pro-DL-Pro-DL-Pro-DL-Ser-NH2; DL-alpha-aspartyl-DL-leucyl-DL-seryl-DL-lysyl-DL-glutaminyl-DL-methionyl-DL-alpha-glutamyl-DL-alpha-glutamyl-DL-alpha-glutamyl-DL-alanyl-DL-valyl-DL-arginyl-DL-leucyl-DL-phenylalanyl-DL-isoleucyl-DL-alpha-glutamyl-DL-tryptophyl-DL-leucyl-DL-lysyl-DL-asparagyl-glycyl-glycyl-DL-prolyl-DL-seryl-DL-seryl-glycyl-DL-alanyl-DL-prolyl-DL-prolyl-DL-prolyl-DL-serinamide. Grades: ≥95%. CAS No. 133514-43-9. Molecular formula: C149H234N40O47S. Mole weight: 3369.76. | |
| Exendin-4 | Exendin-4 (Exenatide), a 39 amino acid peptide, is a long-acting glucagon-like peptide-1 receptor agonist with an IC 50 of 3.22 nM. Uses: Scientific research. Group: Peptides. Alternative Names: Exenatide. CAS No. 141758-74-9. Pack Sizes: 1 mg; 5 mg; 10 mg; 25 mg. Product ID: HY-13443. | |
| Exendin-4 acetate | Exendin-4 acetate (Exenatide acetate), a 39 amino acid peptide, is a long-acting glucagon-like peptide-1 receptor agonist with an IC 50 of 3.22 nM. Uses: Scientific research. Group: Peptides. Alternative Names: Exenatide acetate. CAS No. 914454-01-6. Pack Sizes: 1 mg; 5 mg; 10 mg; 25 mg. Product ID: HY-13443A. | |
| Exendin(9-39) amide | Exendin(9-39) amide (Avexitide) is a glucagon-like peptide-1 ( GLP-1 ) antagonist that competes with endogenous GLP-1 for binding to GLP-1 receptors, thereby antagonizing the effects of excess GLP-1 secretion. Exendin(9-39) amide can be used to study postoperative hypoglycemia (PBH) [1]. Uses: Scientific research. Group: Peptides. Alternative Names: Avexitide. CAS No. 133514-43-9. Pack Sizes: 500 μg; 1 mg; 5 mg. Product ID: HY-P0264. | |
| Fmoc-His-Aib-OH TFA | An intermediate in the synthesis of Semaglutide, an agonist of glucagon-like peptide-1 (GLP-1) receptor that is developed to treat type 2 diabetes. Grades: ≥98%. CAS No. 1446013-08-6. Molecular formula: C25H26N4O5.C2HF3O2. Mole weight: 576.53. | |
| Glp-1(1-36)amide(human,bovine,guinea pig,mouse,rat) | Glp-1(1-36)amide(human,bovine,guinea pig,mouse,rat). Uses: Designed for use in research and industrial production. Additional or Alternative Names: GLP-1 (1-36) amide (human, bovine, guinea pig, mouse, rat);Glucagon-like peptide 1 amide. Product Category: Heterocyclic Organic Compound. CAS No. 99658-04-5. Molecular formula: C184H273N51O57. Mole weight: 4111.44. Purity: 0.96. Product ID: ACM99658045. Alfa Chemistry ISO 9001:2015 Certified. | |
| GLP-1 (1-36) amide (human, bovine, guinea pig, mouse, rat) | GLP-1 (1-36) amide is a promising peptide hormone unlocking avenues for type 2 diabetes mellitus research. Its extraordinary resemblance to the native GLP-1 facilitates heightened glucose-dependent insulin secretion. Synonyms: Preproglucagon (92-127) amide (human, bovine, guinea pig, mouse, rat); Glucagon-like peptide 1 (1-36) amide (human, bovine, guinea pig, mouse, rat); H-His-Asp-Glu-Phe-Glu-Arg-His-Ala-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Val-Ser-Ser-Tyr-Leu-Glu-Gly-Gln-Ala-Ala-Lys-Glu-Phe-Ile-Ala-Trp-Leu-Val-Lys-Gly-Arg-NH2; L-histidyl-L-alpha-aspartyl-L-alpha-glutamyl-L-phenylalanyl-L-alpha-glutamyl-L-arginyl-L-histidyl-L-alanyl-L-alpha-glutamyl-glycyl-L-threonyl-L-phenylalanyl-L-threonyl-L-seryl-L-alpha-aspartyl-L-valyl-L-seryl-L-seryl-L-tyrosyl-L-leucyl-L-alpha-glutamyl-glycyl-L-glutaminyl-L-alanyl-L-alanyl-L-lysyl-L-alpha-glutamyl-L-phenylalanyl-L-isoleucyl-L-alanyl-L-tryptophyl-L-leucyl-L-valyl-L-lysyl-glycyl-L-argininamide. Grades: ≥95%. CAS No. 99658-04-5. Molecular formula: C184H273N51O57. Mole weight: 4111.44. | |
| GLP-1(7-36), amide | GLP-1(7-36), amide is a physiological incretin hormone that stimulates insulin secretion. Uses: Scientific research. Group: Peptides. Alternative Names: Glucagon-like peptide-1 (GLP-1)(7-36), amide; Human GLP-1 (7-36), amide. CAS No. 107444-51-9. Pack Sizes: 1 mg. Product ID: HY-P0054A. | |
| GLP-1(7-36), amide acetate | GLP-1(7-36), amide acetate is a major intestinal hormone that stimulates glucose-induced insulin secretion from β cells. Uses: Scientific research. Group: Peptides. Alternative Names: Glucagon-like peptide-1 (GLP-1)(7-36), amide acetate; Human GLP-1 (7-36), amide acetate. CAS No. 1119517-19-9. Pack Sizes: 500 μg; 1 mg; 5 mg; 10 mg. Product ID: HY-P0054. | |
| GLP-1 (7-36) amide (chicken, common turkey) | Synonyms: Preproglucagon (118-147) amide (chicken, common turkey); H-His-Ala-Glu-Gly-Thr-Tyr-Thr-Ser-Asp-Ile-Thr-Ser-Tyr-Leu-Glu-Gly-Gln-Ala-Ala-Lys-Glu-Phe-Ile-Ala-Trp-Leu-Val-Asn-Gly-Arg-NH2; L-histidyl-L-alanyl-L-alpha-glutamyl-glycyl-L-threonyl-L-tyrosyl-L-threonyl-L-seryl-L-alpha-aspartyl-L-isoleucyl-L-threonyl-L-seryl-L-tyrosyl-L-leucyl-L-alpha-glutamyl-glycyl-L-glutaminyl-L-alanyl-L-alanyl-L-lysyl-L-alpha-glutamyl-L-phenylalanyl-L-isoleucyl-L-alanyl-L-tryptophyl-L-leucyl-L-valyl-L-asparagyl-glycyl-L-argininamide; Glucagon-Like Peptide 1 (7-36) amide (chicken, common turkey). Grades: ≥95% by HPLC. CAS No. 1802078-26-7. Molecular formula: C149H224N40O47. Mole weight: 3327.66. | |
| GLP-1 (7-36) amide trifluoroacetate salt | GLP-1 (7-36) amide is an important peptide hormone that displays a strong insulinotropic effect. It binds the GLP-1 receptor (pIC50 = 8.5) in the pancreas and shows various antidiabetic effects. Synonyms: Glucagon-like Peptide 1 (7-36) amide. Mole weight: 3297.6. | |
| GLP-1 (7-36)-Lys(6-FAM) amide (human, bovine, guinea pig, mouse, rat) | Synonyms: Preproglucagon (98-127)-Lys(6-FAM)amide (human, bovine, guinea pig, mouse, rat); H-His-Ala-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Val-Ser-Ser-Tyr-Leu-Glu-Gly-Gln-Ala-Ala-Lys-Glu-Phe-Ile-Ala-Trp-Leu-Val-Lys-Gly-Arg-Lys(fluorescein-6-carbonyl)-NH2; Proglucagon (78-107)-Lys(6-FAM)amide (human, bovine, guinea pig, mouse, rat); Glucagon-Like Peptide 1 (7-36)-Lys(6-FAM)amide (human, bovine, guinea pig, mouse, rat). Grades: ≥95%. CAS No. 1802089-53-7. Molecular formula: C176H248N42O52. Mole weight: 3784.16. | |
| GLP-1 (7-36)-Lys(biotinyl) amide (human, bovine, guinea pig, mouse, rat) | Synonyms: Preproglucagon (98-127)-Lys(biotinyl) amide (human, bovine, guinea pig, mouse, rat); H-His-Ala-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Val-Ser-Ser-Tyr-Leu-Glu-Gly-Gln-Ala-Ala-Lys-Glu-Phe-Ile-Ala-Trp-Leu-Val-Lys-Gly-Arg-Lys(biotinyl)-NH2; Proglucagon (78-107)-Lys(biotinyl)amide (human, bovine, guinea pig, mouse, rat); Glucagon-Like Peptide 1 (7-36)-Lys(biotinyl)amide (human, bovine, guinea pig, mouse, rat). Grades: ≥95%. CAS No. 1802086-70-9. Molecular formula: C165H252N44O48S. Mole weight: 3652.15. | |
| GLP-1(7-37) | GLP-1 (7-37) is an insulinotropic peptide generated from the precursor peptide GLP-1 (1-37). It is a potent stimulator of insulin secretion at concentrations as low as 5 X 10(-11) M and has no effect on insulin secretion even at concentrations as high as 5 X 10(-7) M. It participates in the physiological regulation of insulin secretion. Uses: Glp-1 (7-37) acetate participates in the physiological regulation of insulin secretion. Synonyms: Proglucagon (78-108) (human, bovine, guinea pig, mouse, rat); Insulinotropin (human, bovine, guinea pig, mouse, rat); Glucagon-Like Peptide 1 (7-37) (human, bovine, guinea pig, mouse, rat); Preproglucagon (98-128) (human, bovine, guinea pig, mouse, rat); GLP-1 (7-37) human; Glucagon-like Peptide-1 (7-37); H-His-Ala-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Val-Ser-Ser-Tyr-Leu-Glu-Gly-Gln-Ala-Ala-Lys-Glu-Phe-Ile-Ala-Trp-Leu-Val-Lys-Gly-Arg-Gly-OH; L-histidyl-L-alanyl-L-alpha-glutamyl-glycyl-L-threonyl-L-phenylalanyl-L-threonyl-L-seryl-L-alpha-aspartyl-L-valyl-L-seryl-L-seryl-L-tyrosyl-L-leucyl-L-alpha-glutamyl-glycyl-L-glutaminyl-L-alanyl-L-alanyl-L-lysyl-L-alpha-glutamyl-L-phenylalanyl-L-isoleucyl-L-alanyl-L-tryptophyl-L-leucyl-L-valyl-L-lysyl-glycyl-L-arginyl-glycine. Grades: 98%. CAS No. 106612-94-6. Molecular formula: C151H228N40O47. Mole weight: 3355.67. | |
| Glp-1(7-37)acetate | Glp-1(7-37)acetate. Uses: Designed for use in research and industrial production. Additional or Alternative Names: GLP-1 (7-37) acetate;GLP-1 (7-36) amide Acetate (GMP);GLP-1 (7-37) human;GLP-1 (7-37) (human, bovine, guinea pig, mouse, rat);Glucagon-like peptide 1 (7-37) (human). Product Category: Heterocyclic Organic Compound. CAS No. 106612-94-6. Molecular formula: C151H228N40O47. Mole weight: 3355.67. Purity: >95%. Product ID: ACM106612946. Alfa Chemistry ISO 9001:2015 Certified. Categories: GLP-1(7-37) Acetate. | |
| GLP-1 (9-36) amide | GLP-1 (9-36) amide is an N-terminal truncated metabolite of glucagon-like peptide GLP-1-(7-36) formed by dipeptidyl peptidase-IV cleavage. GLP-1 (9-36) amide functions as a human GLP-1 receptor antagonist. Synonyms: Glucagon-like peptide-1 (9-36) amide; Glucagon-like peptide-1 (9 36) amide. CAS No. 161748-29-4. Molecular formula: C140H214N36O43. Mole weight: 3089.44. | |
| GLP-1(9-36)amide | GLP-1(9-36)amide is a major metabolite of glucagon-like peptide-1-(7-36) amide formed by the enzyme dipeptidyl peptidase-4 (DPP-4). GLP-1(9-36)amide acts as an antagonist to the human pancreatic GLP-1 receptor [1] [2]. Uses: Scientific research. Group: Peptides. CAS No. 161748-29-4. Pack Sizes: 1 mg; 5 mg. Product ID: HY-P1141. | |
| GLP-1 antagonist | A glucagon-like peptide-1 (GLP-1) receptor antagonist. Synonyms: GLP-1 antagonist; GLP 1 antagonist; N-[[4,5-dimethyl-1-[(2-methylphenyl)methyl]imidazol-2-yl]methyl]-2,4-dimethoxy-N-(3-methylbutyl)benzamide. Grades: 99%. CAS No. 475466-57-0. Molecular formula: C28H37N3O3. Mole weight: 463.61. | |
| GLP-1R agonist 4 | GLP-1R agonist 4 is a potent agonist of GLP-1R. Glucagon-like peptide-1 (GLP-1) is an intestinal hypoglycemic hormone secreted by L-cells in the lower gastrointestinal tract. GLP-1R agonist 4 has the potential for the research of diabetes (extracted from patent WO2019239319A1, compound 96) [1]. Uses: Scientific research. Group: Signaling pathways. CAS No. 2401894-26-4. Pack Sizes: 1 mg; 5 mg; 10 mg; 25 mg; 50 mg. Product ID: HY-144035. | |
| GLP-1R agonist DMB | GLP-1R agonist DMB is a glucagon-like peptide-1 (GLP-1) receptor agonist used potentially for the treatment of type 2 diabetes. Uses: Potential treatment of type 2 diabetes. Synonyms: N-(tert-Butyl)-6,7-dichloro-3-(methylsulfonyl)quinoxalin-2-amine. Grades: 99%. CAS No. 281209-71-0. Molecular formula: C13H15Cl2N3O2S. Mole weight: 348.25. | |
| GLP-1 receptor agonist 2 | GLP-1 receptor agonist 2 is a glucagon-like peptide-1 receptor (GLP-1R) agonist. Uses: Scientific research. Group: Signaling pathways. CAS No. 2230197-64-3. Pack Sizes: 10 mM * 1 mL; 5 mg; 10 mg. Product ID: HY-112679. | |
| GLP-1 receptor agonist 7 | GLP-1 receptor agonist 7 is a potent agonist of glucagon-like peptide-1 ( GLP-1 ). GLP-1 receptor agonist 7 has the potential for the research of GLP-1-associated diseases, disorders, and conditions including diabetes mellitus (extracted from patent WO2021219019A1, compound 130b) [1]. Uses: Scientific research. Group: Signaling pathways. CAS No. 2736447-04-2. Pack Sizes: 5 mg; 10 mg. Product ID: HY-145412. | |
| GLP-2 (1-33) (human) | GLP-2 (human) is an endogenous peptide that acts as an intestinal epithelium-specific growth factor. It stimulates cell proliferation and inhibits apoptosis, and also modulates intestinal glucose transport, food intake, and gastric acid secretion. Synonyms: Glucagon-like peptide 2 (human); GLP-2 (human); GLP 2 (human). Grades: >98%. CAS No. 223460-79-5. Molecular formula: C165H254N44O55S. Mole weight: 3766.1. | |
| GLP-2 (1-34) (human) | GLP-2 (1-34) (human) is a human-derived mimic of glucagon-like peptide 2 employed in studying gastrointestinal disorders such as short bowel syndrome (SBS). Synonyms: Preproglucagon (146-179) (human); H-His-Ala-Asp-Gly-Ser-Phe-Ser-Asp-Glu-Met-Asn-Thr-Ile-Leu-Asp-Asn-Leu-Ala-Ala-Arg-Asp-Phe-Ile-Asn-Trp-Leu-Ile-Gln-Thr-Lys-Ile-Thr-Asp-Arg-OH; L-histidyl-L-alanyl-L-alpha-aspartyl-glycyl-L-seryl-L-phenylalanyl-L-seryl-L-alpha-aspartyl-L-alpha-glutamyl-L-methionyl-L-asparagyl-L-threonyl-L-isoleucyl-L-leucyl-L-alpha-aspartyl-L-asparagyl-L-leucyl-L-alanyl-L-alanyl-L-arginyl-L-alpha-aspartyl-L-phenylalanyl-L-isoleucyl-L-asparagyl-L-tryptophyl-L-leucyl-L-isoleucyl-L-glutaminyl-L-threonyl-L-lysyl-L-isoleucyl-L-threonyl-L-alpha-aspartyl-L-arginine. Grades: 95%. CAS No. 99120-49-7. Molecular formula: C171H266N48O56S1. Mole weight: 3922.29. | |
| Glp-2(rat) | GLP-2(rat) is an intestinal growth factor. GLP-2(rat) stimulates cell proliferation and inhibits apoptosis. GLP-2(rat) enhances mucosal mass and function in residual small intestine after massive small bowel resection (MSBR). Uses: Designed for use in research and industrial production. Additional or Alternative Names: GLUCAGON-LIKE PEPTIDE 2 (RAT);GLUCAGON-LIKE PEPTIDE II RAT;GLP-2 (RAT);H-HIS-ALA-ASP-GLY-SER-PHE-SER-ASP-GLU-MET-ASN-THR-ILE-LEU-ASP-ASN-LEU-ALA-THR-ARG-ASP-PHE-ILE-ASN-TRP-LEU-ILE-GLN-THR-LYS-ILE-THR-ASP-OH;HADGSFSDEMNTILDNLATRDFINWLIQTKITD;PREPROGLUCAG. Product Category: Inhibitors. Appearance: Solid. CAS No. 195262-56-7. Molecular formula: C166H256N44O56S. Mole weight: 3796.14. Purity: 0.9804. Product ID: ACM195262567. Alfa Chemistry ISO 9001:2015 Certified. | |
| GLP-2 (rat) | GLP-2 (rat) is an endogenous peptide that acts as an intestinal epithelium-specific growth factor. It stimulates cell proliferation and inhibits apoptosis, and also modulates intestinal glucose transport, food intake, and gastric acid secretion. Synonyms: Preproglucagon (146-178) (rat); H-His-Ala-Asp-Gly-Ser-Phe-Ser-Asp-Glu-Met-Asn-Thr-Ile-Leu-Asp-Asn-Leu-Ala-Thr-Arg-Asp-Phe-Ile-Asn-Trp-Leu-Ile-Gln-Thr-Lys-Ile-Thr-Asp-OH; Glucagon-like Peptide 2 (rat); L-histidyl-L-alanyl-L-alpha-aspartyl-glycyl-L-seryl-L-phenylalanyl-L-seryl-L-alpha-aspartyl-L-alpha-glutamyl-L-methionyl-L-asparagyl-L-threonyl-L-isoleucyl-L-leucyl-L-alpha-aspartyl-L-asparagyl-L-leucyl-L-alanyl-L-threonyl-L-arginyl-L-alpha-aspartyl-L-phenylalanyl-L-isoleucyl-L-asparagyl-L-tryptophyl-L-leucyl-L-isoleucyl-L-glutaminyl-L-threonyl-L-lysyl-L-isoleucyl-L-threonyl-L-aspartic acid. Grades: ≥95%. CAS No. 195262-56-7. Molecular formula: C166H256N44O56S. Mole weight: 3796.17. | |
| GLP-2 (rat) trifluoroacetate salt | GLP-2 is a gut peptide hormone that is primarily produced by enteroendocrine L cells of the small and large intestine. GLP-2 is an antagonist of the GLP-2 receptor (GLP-2R; Ki = 60 pM). Synonyms: Glucagon-like Peptide 2. Grades: ≥95%. Molecular formula: C166H256N44O56S·xCF3COOH. Mole weight: 3796.14. | |
| Glucagon-Like Peptide (GLP) II, human | Glucagon-Like Peptide (GLP) II, human, a 33-amino acid Peptide derived from proglucagon C-terminal, is mainly produced by intestinal L cells. GLP II stimulates intestinal mucosal growth and reduces intestinal epithelial cell apoptosis. Synonyms: Glucagon-like peptide 2; H-His-Ala-Asp-Gly-Ser-Phe-Ser-Asp-Glu-Met-Asn-Thr-Ile-Leu-Asp-Asn-Leu-Ala-Ala-Arg-Asp-Phe-Ile-Asn-Trp-Leu-Ile-Gln-Thr-Lys-Ile-Thr-Asp-OH; L-histidyl-L-alanyl-L-alpha-aspartyl-glycyl-L-seryl-L-phenylalanyl-L-seryl-L-alpha-aspartyl-L-alpha-glutamyl-L-methionyl-L-asparagyl-L-threonyl-L-isoleucyl-L-leucyl-L-alpha-aspartyl-L-asparagyl-L-leucyl-L-alanyl-L-alanyl-L-arginyl-L-alpha-aspartyl-L-phenylalanyl-L-isoleucyl-L-asparagyl-L-tryptophyl-L-leucyl-L-isoleucyl-L-glutaminyl-L-threonyl-L-lysyl-L-isoleucyl-L-threonyl-L-aspartic acid; [Ala19]Glucagon-Like Peptide II, rat; GLP-2 (1-33) (human); Glucagon-Like Peptide-2 (1-33). Grades: 95%. CAS No. 89750-15-2. Molecular formula: C165H254N44O55S. Mole weight: 3766.11. | |
| Glucagon (swine) | Glucagon, a peptide compound, is effective in increasing the glucose concentration in bloodstream and could be released by pancreatic α cells. Synonyms: Glucagonum; Glucagone; HG-Factor; His-ser-glu(nh2)-gly-thr-phe-thr-ser-asp-tyr-ser-lys-tyr-leu-asp-ser-arg-arg-ala-glu(NH2)-asp-phe-val-glu(NH2)-trp-leu-met-asp(NH2)-thr; Glucagon-like-immunoreactivity; Glucaton. Grades: 98%. CAS No. 16941-32-5. Molecular formula: C153H225N43O49S. Mole weight: 3482.75. | |
| Glutaminyl-Methionyl-Glutamyl-Glutamyl-Glutamyl-Alanyl-Valyl-Arginine Trifluoroacetate | Glutaminyl-Methionyl-Glutamyl-Glutamyl-Glutamyl-Alanyl-Valyl-Arginine Trifluoroacetate is a metabolite from Exenatide trypsin (Exenatide Acetate, E957300) digestion. Exenatide acts as agonist of the glucagon-like peptide-1 (GLP-1) receptor. Group: Biochemicals. Grades: Highly Purified. CAS No. 868249-03-0. Pack Sizes: 5mg, 25mg. Molecular Formula: C41H66F3N12O17S, Molecular Weight: 1088.08999999999. US Biological Life Sciences. | Worldwide |
| HAEGTFT acetate | HAEGTFT acetate is the 1-7 residues of the first N-terminal of glucagon-like peptide-1 (GLP-1). Synonyms: H-His-Ala-Glu-Gly-Thr-Phe-Thr-OH.CH3CO2H; L-histidyl-L-alanyl-L-alpha-glutamyl-glycyl-L-threonyl-L-phenylalanyl-L-threonine acetic acid. Grades: ≥95%. Molecular formula: C35H51N9O14. Mole weight: 821.84. | |
| HAEGT TFA | HAEGT TFA is the 1-5 residues of the first N-terminal of glucagon-like peptide-1 (GLP-1). Synonyms: H-His-Ala-Glu-Gly-Thr-OH.TFA; L-histidyl-L-alanyl-L-alpha-glutamyl-glycyl-L-threonine trifluoroacetic acid. Grades: ≥95%. Molecular formula: C22H32F3N7O11. Mole weight: 627.53. | |
| HTL26119 | HTL26119 is a glucagon-like peptide-1 receptor (GLP-1R) antagonist. Synonyms: HTL-26119; HTL 26119. Grades: ≥98% by HPLC. Molecular formula: C28H23Cl3N2O5. Mole weight: 573.85. | |
| Liraglutide | Liraglutide is a glucagon-like peptide-1 ( GLP-1 ) receptor agonist used clinically to treat type 2 diabetes mellitus. Uses: Scientific research. Group: Peptides. CAS No. 204656-20-2. Pack Sizes: 1 mg; 5 mg; 10 mg. Product ID: HY-P0014. | |
| Liraglutide | Liraglutide is the long-acting analogue of glucagon-like peptide-1 (GLP-1) receptor which could protect b-cells from apoptosis under conditions associated with the development of type 1 and type 2 diabetes. Synonyms: L-Histidyl-L-alanyl-L-α-glutamylglycyl-L-threonyl-L-phenylalanyl-L-threonyl-L-seryl-L-α-aspartyl-L-valyl-L-seryl-L-seryl-L-tyrosyl-L-leucyl-L-α-glutamylglycyl-L-glutaminyl-L-alanyl-L-alanyl-N6-[N-(1-oxohexadecyl)-L-γ-glutamyl]-L-lysyl-L-α-glutamyl-L-pheny. Grades: > 95%. CAS No. 204656-20-2. Molecular formula: C172H265N43O51. Mole weight: 3751.20. | |
| Lixisenatide | Lixisenatide is a glucagon-like peptide-1 (GLP-1) receptor agonist that can be used in the treatment of type 2 diabetes mellitus (T2DM). Synonyms: ZP-10(Des-Pro38)-Exendin-4-(Lys)6, amide; ZP10A peptide; His-Gly-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Leu-Ser-Lys-Gln-Met-Glu-Glu-Glu-Ala-Val-Arg-Leu-Phe-Ile-Glu-Trp-Leu-Lys-Asn-Gly-Gly-Pro-Ser-Ser-Gly-Ala-Pro-Pro-Ser-Lys-Lys-Lys-Lys-Lys-Lys-NH2; L-histidyl-glycyl-L-alpha-glutamyl-glycyl-L-threonyl-L-phenylalanyl-L-threonyl-L-seryl-L-alpha-aspartyl-L-leucyl-L-seryl-L-lysyl-L-glutaminyl-L-methionyl-L-alpha-glutamyl-L-alpha-glutamyl-L-alpha-glutamyl-L-alanyl-L-valyl-L-arginyl-L-leucyl-L-phenylalanyl-L-isoleucyl-L-alpha-glutamyl-L-tryptophyl-L-leucyl-L-lysyl-L-asparagyl-glycyl-glycyl-L-prolyl-L-seryl-L-seryl-glycyl-L-alanyl-L-prolyl-L-prolyl-L-seryl-L-lysyl-L-lysyl-L-lysyl-L-lysyl-L-lysyl-L-lysinamide; AQVE-10010; Des-38-proline-exendine-4 (Heloderma suspectum)-(1-39)-peptidylpenta-L-lysyl-L-lysinamide. Grades: ≥95%. CAS No. 320367-13-3. Molecular formula: C215H347N61O65S. Mole weight: 4858.48. | |
| Lixisenatide acetate | Lixisenatide acetate is a glucagon-like peptide-1 (GLP-1) receptor agonist that can be used in the treatment of type 2 diabetes mellitus (T2DM). Uses: Scientific research. Group: Peptides. CAS No. 1997361-87-1. Pack Sizes: 1 mg; 5 mg; 10 mg. Product ID: HY-P0119A. | |
| Mazdutide | Mazdutide (IBI-362; LY-3305677) is a long-acting synthetic oxyntomodulin analog. Mazdutide is also a co-agonist of glucagon-like peptide ( GLP-1R ) and glucagon receptor ( GCGR ). Mazdutide binds human and mouse GCGR ( K i : 17.7 nM and 15.9 nM, respectively) and GLP-1R ( K i : 28.6 nM and 25.1 nM, respectively) and stimulates insulin secretion from mouse islets ( EC 50 : 5.2 nM). Mazdutide is used in studies of obesity and type 2 diabetes (T2D) [1] [2] [3]. Uses: Scientific research. Group: Peptides. Alternative Names: IBI-362; LY-3305677; OXM-3. CAS No. 2259884-03-0. Pack Sizes: 1 mg; 5 mg; 10 mg; 25 mg; 50 mg; 100 mg. Product ID: HY-P3375. | |
| Nε-Palmitoyl-L-glutamic Acid γ-Succinimidyl-α-tert-butyl Ester | Used in the preparation of lipophilic human glucagon-like peptide-1 derivatives with protracted action profiles. Group: Biochemicals. Alternative Names: Nε-Palmitoyl-Glu-γ-succinimidyl-α-tert-butyl Ester; (2S)-. Grades: Highly Purified. CAS No. 204521-63-1. Pack Sizes: 100mg. US Biological Life Sciences. | Worldwide |
| Nε-Palmitoyl-L-glutamic Acid γ-Succinimidyl-α-tert-butyl Ester | Used in the preparation of lipophilic human glucagon-like peptide-1 derivatives with protracted action profiles. Synonyms: Palm-glu(nhs)-otbu; L-Glutamic acid, N-(1-oxohexadecyl)-, 1-(1,1-dimethylethyl) 5-(2,5-dioxo-1-pyrrolidinyl) ester; (S)-1-tert-butyl 5-(2,5-dioxopyrrolidin-1-yl) 2-palmitamidopentanedioate; Pal-L-Glu(OSu)-OtBu; N-Palmitoyl-L-glutamic Acid 1-tert-Butyl 5-(N-Succinimidyl) Ester; 1-tert-Butyl 5-(2,5-dioxopyrrolidin-1-yl) N-hexadecanoyl-L-glutamate. CAS No. 204521-63-1. Molecular formula: C29H50N2O7. Mole weight: 538.70. | |
| NNC0640 | NNC0640 is a potent human G protein-coupled glucagon receptor (GCGR) negative allosteric modulator (NAM) with an IC50 of 69.2 nM. It is also a negative allosteric modulator of the glucagon-like peptide-1 receptor (GLP-1R). Synonyms: 4-[1-(4-Cyclohexylphenyl)-3-(3-Methanesulfonylphenyl)Ureidomethyl]-N-(2H-Tetrazol-5-Yl)Benzamide; NNC-0640. Grades: ≥98% by HPLC. CAS No. 307986-98-7. Molecular formula: C29H31N7O4S. Mole weight: 573.7. | |
| Octa(OtBu)-Glu-OtBu | An intermediate in the synthesis of Semaglutide, an agonist of glucagon-like peptide-1 (GLP-1) receptor that is developed to treat type 2 diabetes. Synonyms: L-Glutamic acid, N-[18-(1,1-dimethylethoxy)-1,18-dioxooctadecyl]-, 1-(1,1-dimethylethyl) ester. CAS No. 1188328-39-3. Molecular formula: C31H57NO7. Mole weight: 555.79. | |
| OG2023SC | OG2023SC is an oral glucagon-like peptide-1 recceptor agonist (GLP-1RA). OG2023SC has been used in type 2 diabetes mellitus (T2DM) research. Synonyms: NN9023; NNC0113-2023. | |
| Orforglipron | Orforglipron (LY3502970) (Compound 67) is an orally active agonist for Glucagon-like peptide-1 receptor ( GLP-1R ), which exhibits potency in ameliorates the type 2 diabete [1]. Uses: Scientific research. Group: Signaling pathways. Alternative Names: LY3502970; GLP-1 receptor agonist 1. CAS No. 2212020-52-3. Pack Sizes: 10 mM * 1 mL; 5 mg; 10 mg; 25 mg. Product ID: HY-112185. | |
| ORMD-0901 | ORMD-0901 is an oral glucagon-like peptide-1 recceptor agonist (GLP-1RA). ORMD-0901 has been used in type 2 diabetes mellitus (T2DM) research. Synonyms: ORMD 0901; ORMD0901. | |
Our database is helping our users find suppliers everyday.
