L Lysine Acetate Suppliers USA
Find where to buy products from suppliers in the USA, including: distributors, industrial manufacturers in America, bulk supplies and wholesalers of raw ingredients & finished goods.
Search for products or services, then visit the American suppliers website for prices, SDS or more information. You can also view suppliers in Australia, NZ or the UK.
Product | Description | |
---|---|---|
L-Lysine acetate Quick inquiry Where to buy Suppliers range | L-Lysine acetate. Group: Biochemicals. Grades: Highly Purified. CAS No. 57282-49-2. Pack Sizes: 250g, 500g, 1kg, 2kg, 5kg. Molecular Formula: C8H18N2O4. US Biological Life Sciences. | Worldwide |
L-Lysine Acetate Quick inquiry Where to buy Suppliers range | L-Lysine Acetate. Group: Biobased Products. Alternative Names: (S)-2,6-diaminohexanoic acid acetate salt. Grades: 98.5%. CAS No. 57282-49-2. Product ID: BBC57282492. Molecular formula: C8H18N2O4. Mole weight: 206.24. IUPAC Name: Acetic acid;(2S)-2,6-diaminohexanoic acid. Appearance: White powder. SMILES: CC(=O)O.C(CCN)C[C@@H](C(=O)O)N. | |
L-Lysine acetate salt Quick inquiry Where to buy Suppliers range | Synonyms: acetic acid;(2S)-2,6-diaminohexanoic acid; Lysine acetate; L-Lysine monoacetate; L-LYSINE ACETATE SALT; Lysine, monoacetate; (S)-2,6-diaminohexanoic acid compound with acetic acid. Grades: 98.0-102.0% (Assay, dried basis). CAS No. 57282-49-2. Molecular formula: C6H14N2O2·C2H4O2. Mole weight: 206.24. | |
L-Lysine 7-amido-4-methylcoumarin acetate salt Quick inquiry Where to buy Suppliers range | L-Lysine 7-amido-4-methylcoumarin, acetate salt is a substrate for aminopeptidase b. Upon cleavage of aminopeptidase b a blue fluorescent solution results. It can also be used as analyte in analytical study for enhanced extraction of amino compounds using dicyclohexyl-18-crown-6 as a ligand in an aqueous two-phase system. Synonyms: L-Lysine-AMC acetate. CAS No. 201853-23-8. Molecular formula: C18H25N3O5. Mole weight: 363.41. | |
1,5-Diaminopentane (Cadaverine) Quick inquiry Where to buy Suppliers range | Cadaverine is a polyamine produced by the decarboxylation of L-lysine, and is also produced by E. coli cells when grown in acidic pH. Cadaverine is known to inhibit porin-mediated outer membrane permeability in E. coli.Cadaverine is a diamine that can be used in hetarylation with halopyridines (2-bromo, 2-iodo, and 3-iodo-pyridines) to synthesize N,N?-dipyridinyl diamine derivatives in the presence of CuI-2-isobutyryl cyclohexanone as a catalyst. It can also be used to synthesize a poly-imidazolium polymer with high thermal stability by reacting with acetic acid, pyruvaldehyde and formaldehyde by modified Debus-Radziszewski reaction. Group: Biochemicals. Alternative Names: 1,5-Pentanediamine; Cadavarine. Grades: Highly Purified. CAS No. 462-94-2. Pack Sizes: 5g, 25g. Molecular Formula: C5H14N2, Molecular Weight: 102.18. US Biological Life Sciences. | Worldwide |
6-(7-Nitro-benzo[2,1,3]oxadiazol-4-ylamino)-hexanoyl-Arg-Pro-Lys-Pro-Leu-Ala-Nva-Trp-Lys((7-dimethylaminocoumarin-4-yl)-acetyl)-NH2 Quick inquiry Where to buy Suppliers range | It is an excellent fluorogenic substrate for matrix metalloproteinase stromelysin (MMP-3) hydrolysis. The FRET substrate shows high sensitivity and improves accuracy at a lower substrate turnover. It has a kcat/Km value of 2.14·104 M-1s-1 and can be easily detected at 350 nm (excitation) and 465 nm (emission). Therefore, it is a suitable tool for high-throughput inhibitor screening. Synonyms: NBD-ε-aminocaproyl-Arg-Pro-Lys-Pro-Leu-Ala-Nva-Trp-Lys(DMACA)-NH2; L-Lysinamide, N2-[6-[(7-nitro-2,1,3-benzoxadiazol-4-yl)amino]-1-oxohexyl]-L-arginyl-L-prolyl-L-lysyl-L-prolyl-L-leucyl-L-alanyl-L-norvalyl-L-tryptophyl-N6-[2-[7-(dimethylamino)-2-oxo-2H-1-benzopyran-4-yl]acetyl]-; NBD-Arg-Pro-Lys-Pro-Leu-Ala-Nva-Trp-Lys(DMC)-NH2; N2-{6-[(7-Nitro-2,1,3-benzoxadiazol-4-yl)amino]hexanoyl}-L-arginyl-L-prolyl-L-lysyl-L-prolyl-L-leucyl-L-alanyl-L-norvalyl-L-tryptophyl-N6-{[7-(dimethylamino)-2-oxo-2H-chromen-4-yl]acetyl}-L-lysinamide. Grades: ≥95%. CAS No. 945414-97-1. Molecular formula: C78H111N21O16. Mole weight: 1598.87. | |
Ac2-26 TFA Quick inquiry Where to buy Suppliers range | Ac2-26 TFA is an annexin/lipocortin 1-mimetic peptide that inhibits leukocyte extravasation. It promotes detachment of neutrophils from activated mesenteric endothelium and accelerates epithelial wound repair after induced colonic injury in mice in vivo. It reduces neutrophil adhesion and emigration. It has anti-inflammatory effect. Synonyms: Ala-Met-Val-Ser-Glu-Phe-Leu-Lys-Gln-Ala-Trp-Phe-Ile-Glu-Asn-Glu-Glu-Gln-Glu-Tyr-Val-Gln-Thr-Val-Lys.TFA; Annexin A1 (1-25) (dephosphorylated) (human).TFA; L-Lysine, N-acetyl-L-alanyl-L-methionyl-L-valyl-L-seryl-L-α-glutamyl-L-phenylalanyl-L-leucyl-L-lysyl-L-glutaminyl-L-alanyl-L-tryptophyl-L-phenylalanyl-L-isoleucyl-L-α-glutamyl-L-asparaginyl-L-α-glutamyl-L-α-glutamyl-L-glutaminyl-L-α-glutamyl-L-tyrosyl-L-valyl-L-glutaminyl-L-threonyl-L-valyl-, trifluoroacetic acid. Grades: ≥95%. Molecular formula: C143H211F3N32O46S. Mole weight: 3203.45. | |
Ac9-25 Quick inquiry Where to buy Suppliers range | Ac9-25 is a N-terminal peptide of Annexin I (AI/Lipocortin I) that inhibits leukocyte extravasation. It stimulates neutrophil NADPH oxidase activation by acting as a formyl peptide receptor 1 (FPR1) ligand. Synonyms: L-Lysine, N2-acetyl-L-glutaminyl-L-alanyl-L-tryptophyl-L-phenylalanyl-L-isoleucyl-L-α-glutamyl-L-asparaginyl-L-α-glutamyl-L-α-glutamyl-L-glutaminyl-L-α-glutamyl-L-tyrosyl-L-valyl-L-glutaminyl-L-threonyl-L-valyl-; N2-Acetyl-L-glutaminyl-L-alanyl-L-tryptophyl-L-phenylalanyl-L-isoleucyl-L-α-glutamyl-L-asparaginyl-L-α-glutamyl-L-α-glutamyl-L-glutaminyl-L-α-glutamyl-L-tyrosyl-L-valyl-L-glutaminyl-L-threonyl-L-valyl-L-lysine; Ac-Gln-Ala-Trp-Phe-Ile-Glu-Asn-Glu-Glu-Gln-Glu-Tyr-Val-Gln-Thr-Val-Lys-OH. Grades: ≥95%. CAS No. 284040-76-2. Molecular formula: C99H143N23O33. Mole weight: 2183.35. | |
Ac9-25 acetate Quick inquiry Where to buy Suppliers range | Ac9-25 acetate is an N-terminal peptide of Annexin I (AI/Lipocortin I) that inhibits leukocyte extravasation. It stimulates neutrophil NADPH oxidase activation by acting as a formyl peptide receptor 1 (FPR1) ligand. Synonyms: L-Lysine, N2-acetyl-L-glutaminyl-L-alanyl-L-tryptophyl-L-phenylalanyl-L-isoleucyl-L-α-glutamyl-L-asparaginyl-L-α-glutamyl-L-α-glutamyl-L-glutaminyl-L-α-glutamyl-L-tyrosyl-L-valyl-L-glutaminyl-L-threonyl-L-valyl-, acetate; N2-Acetyl-L-glutaminyl-L-alanyl-L-tryptophyl-L-phenylalanyl-L-isoleucyl-L-α-glutamyl-L-asparaginyl-L-α-glutamyl-L-α-glutamyl-L-glutaminyl-L-α-glutamyl-L-tyrosyl-L-valyl-L-glutaminyl-L-threonyl-L-valyl-L-lysine acetate; Ac-Gln-Ala-Trp-Phe-Ile-Glu-Asn-Glu-Glu-Gln-Glu-Tyr-Val-Gln-Thr-Val-Lys-OH acetate. Grades: ≥95%. Molecular formula: C101H147N23O35. Mole weight: 2243.38. | |
Ac-Arg-Gly-Lys-AMC Quick inquiry Where to buy Suppliers range | Ac-Arg-Gly-Lys-AMC is a control for the two step histone deacetylase assay with Ac-Arg-Gly-Lys(Ac)-AMC. It corresponds to the product of the deacetylase reaction, which is subsequently cleaved by trypsin. Synonyms: Ac-RGK-AMC; N2-Acetyl-L-arginylglycyl-N-(4-methyl-2-oxo-2H-1-benzopyran-7-yl)-L-Lysinamide; N2-Acetyl-L-arginylglycyl-N-(4-methyl-2-oxo-2H-chromen-7-yl)-L-lysinamide; (S)-2-(2-((S)-2-acetamido-5-guanidinopentanamido)acetamido)-6-amino-N-(4-methyl-2-oxo-2H-chromen-7-yl)hexanamide. Grades: ≥95%. CAS No. 660846-99-1. Molecular formula: C26H38N8O6. Mole weight: 558.64. | |
Acetyl-PHF6 amide Quick inquiry Where to buy Suppliers range | The sequence VQIVYK in the third tau repeat is crucial for fibrillization. Synonyms: Ac-VQIVYK-NH2; N-Acetyl-L-valyl-L-glutaminyl-L-isoleucyl-L-valyl-L-tyrosyl-L-lysinamide; L-Lysinamide, N-acetyl-L-valyl-L-glutaminyl-L-isoleucyl-L-valyl-L-tyrosyl-; acetyl-phf6 amide. Grades: ≥95%. CAS No. 878663-43-5. Molecular formula: C38H63N9O9. Mole weight: 789.96. | |
Ac-Gly-Ala-Lys-AMC Quick inquiry Where to buy Suppliers range | Ac-Gly-Ala-Lys-AMC is the control peptide for protease-coupled histone deacetylase (HDAC) assay with Ac-Gly-Ala-Lys(Ac)-AMC. Synonyms: Ac-GAK-AMC; N-Acetylglycyl-L-alanyl-N-(4-methyl-2-oxo-2H-chromen-7-yl)-L-lysinamide; L-lysinamide, N-acetylglycyl-L-alanyl-N-(4-methyl-2-oxo-2H-1-benzopyran-7-yl)-. Grades: ≥95%. CAS No. 1926163-46-3. Molecular formula: C23H31N5O6. Mole weight: 473.52. | |
Ac-Lys-AMC Quick inquiry Where to buy Suppliers range | Ac-Lys-AMC, also known as MAL, is a fluorescent substrate for histone deacetylases (HDACs). Synonyms: (S)-2-Acetamido-6-amino-N-(4-methyl-2-oxo-2H-chromen-7-yl)hexanamide; N2-Acetyl-N-(4-methyl-2-oxo-2H-chromen-7-yl)-L-lysinamide; Hexanamide, 2-(acetylamino)-6-amino-N-(4-methyl-2-oxo-2H-1-benzopyran-7-yl)-, (2S)-. Grades: ≥98%. CAS No. 156661-42-6. Molecular formula: C18H23N3O4. Mole weight: 345.40. | |
Ac-RYYRWK-NH2 TFA Quick inquiry Where to buy Suppliers range | Ac-RYYRWK-NH2 is a potent and selective partial agonist for the nociceptin receptor (NOP). Synonyms: Ac-Arg-Tyr-Tyr-Arg-Trp-Lys-NH2.TFA; N-acetyl-L-arginyl-L-tyrosyl-L-tyrosyl-L-arginyl-L-tryptophyl-L-lysinamide trifluoroacetic acid; L-Lysinamide, N2-acetyl-L-arginyl-L-tyrosyl-L-tyrosyl-L-arginyl-L-tryptophyl-, mono(trifluoroacetate) (salt). Grades: ≥95%. CAS No. 408305-09-9. Molecular formula: C51H70F3N15O11. Mole weight: 1126.19. | |
α-Conotoxin MI Quick inquiry Where to buy Suppliers range | α-Conotoxin MI has been isolated from the venom of the sea snail Conus imperialis. The conotoxin is a ligand for nicotinic acetylcholine receptors. Synonyms: Alpha-Conotoxin MI; Conotoxin G I, 1-(N2-glycyl-L-arginine)-4-L-histidine-9-L-lysine-10-L-asparagine-. CAS No. 88217-10-1. Molecular formula: C58H88N22O17S4. Mole weight: 1493.72. | |
Beta-Ala-Lys-AMCA Quick inquiry Where to buy Suppliers range | Fluorescent dipeptide derivative, which could be used as an excellent reporter molecule for studying the oligopeptide transport system in brain cell cultures. Group: Biochemicals. Alternative Names: b-Ala-(L)-Lys-N-7-amino-4-methylcoumarin-3-acetic acid; b-Ala-Lys-Nε-AMCA; ß-Ala-Lys-Nε-AMCA; β-Alanyl-Nε-(7-Amino-4-Methyl-2-Oxo-2H-1-Benzopyran-3-Acetyl)-L-Lysine. Grades: Highly Purified. Pack Sizes: 1mg, 5mg. Molecular Formula: C21H28N4O6, Molecular Weight: 432.47. US Biological Life Sciences. | Worldwide |
BIO-11006 Quick inquiry Where to buy Suppliers range | BIO-11006 is a myristoylated alanine-rich C kinase substrate (MARCKS) inhibitor, similar to MANS peptides. Synonyms: BIO-11006 peptide; L-Lysine, N-acetylglycyl-L-alanyl-L-glutaminyl-L-phenylalanyl-L-seryl-L-lysyl-L-threonyl-L-alanyl-L-alanyl-; N-Acetylglycyl-L-alanyl-L-glutaminyl-L-phenylalanyl-L-seryl-L-lysyl-L-threonyl-L-alanyl-L-alanyl-L-lysine; BIO 11006; BIO11006; Ac-Gly-Ala-Gln-Phe-Ser-Lys-Thr-Ala-Ala-Lys-OH. Grades: ≥95%. CAS No. 901117-03-1. Molecular formula: C46H75N13O15. Mole weight: 1050.17. | |
Boc-Lys-AMC AcOH Quick inquiry Where to buy Suppliers range | Synonyms: N-α-(t-Butoxycarbonyl)-L-lysine 7-amido-4-methylcoumarin acetate. Molecular formula: C23H33N3O7. Mole weight: 463.53. | |
Bofelisimer Quick inquiry Where to buy Suppliers range | Bofelisimer is an immunomodulator. Synonyms: Nα -{[ (2-ambo-2, 3-dihydroxypropyl) sulfanyl]acetyl}-Nω - (2, 5, 8, 11-tetraoxatridecan-13-yl) poly[N6-{[ (2-ambo-2, 3-dihydroxypropyl) sulfanyl]acetyl}-L-lysine-co-N6-{[ (4-oxo-4-{[2- (4-{[3-O- (3-O-sulfo-β -D-glucopyranuronosyl) -β -D-galactopyranosyl]oxy}phenyl) ethyl]amino}butyl) sulfanyl]acetyl}-L-lysine (~0.65:0.35)]-ω-amide. CAS No. 2485035-32-1. Molecular formula: [ (C11H20N2O4S)x (C32H47N3O18S2)y]n (C14H29NO7S). | |
Caprooyl Tetrapeptide-3 acetate Quick inquiry Where to buy Suppliers range | Caprooyl tetrapeptide-3 is a synthetic or plant-derived peptide that stimulates the production of collagen, elastin, and hyaluronic acid. Caprooyl tetrapeptide-3 is used for skin repair. Synonyms: L-Lysyl-N-hexanoylglycyl-L-histidyl-L-lysinamide acetate; N-hexanoyl-L-lysyl-glycyl-L-histidyl-L-lysinamide acetic acid; L-Lysinamide, N2-(1-oxohexyl)-L-lysylglycyl-L-histidyl-, acetate (1:1); KGHK-Caproic Acid; Lys-Gly-His-Lys-Caproic Acid. Grades: ≥95%. CAS No. 1012317-71-3. Molecular formula: C28H51N9O7. Mole weight: 625.76. | |
Cjc1295 Quick inquiry Where to buy Suppliers range | Cjc1295. Group: Heterocyclic Organic Compound. Alternative Names: CJC1295;Y(d -A)DAIFTQSYRKVLAQLSARKLLQDILSR-NH2;L-Tyrosyl-D-alanyl-L-alpha-aspartyl-L-alanyl-L-isoleucyl-L-phenylalanyl-L-threonyl-L-glutaminyl-L-seryl-L-tyrosyl-L-arginyl-L-lysyl-L-valyl-L-leucyl-L-alanyl-L-glutaminyl-L-seryl-L-alanyl-L-arginyl-L-lysyl-L-leucyl-L-leucyl-L-glutaminyl-L-alpha-aspartyl-L-isoleucyl-L-leucyl-L-seryl-L-arginyl-N6-[3-(2,5-dihydro-2,5-dioxo-1H-pyrrol-1-yl)-1-oxopropyl]-L-lysinamide;CJC-1295 Acetate;CJC1295 with out DAC. CAS No. 863288-34-0. Product ID: ACM863288340. Molecular formula: C159H258N46O45. Mole weight: 0. Density: 1.45. | |
EAK16-II Quick inquiry Where to buy Suppliers range | EAK16-II is a self-assembled peptide that can form a stable β-sheet structure and can be used as a carrier or matrix for cell culture. Synonyms: Ac-Ala-Glu-Ala-Glu-Ala-Lys-Ala-Lys-Ala-Glu-Ala-Glu-Ala-Lys-Ala-Lys-NH2; L-Lysinamide, N-acetyl-L-alanyl-L-α-glutamyl-L-alanyl-L-α-glutamyl-L-alanyl-L-lysyl-L-alanyl-L-lysyl-L-alanyl-L-α-glutamyl-L-alanyl-L-α-glutamyl-L-alanyl-L-lysyl-L-alanyl-. Grades: ≥95%. CAS No. 157675-61-1. Molecular formula: C70H121N21O25. Mole weight: 1656.84. | |
Felypressin Acetate Quick inquiry Where to buy Suppliers range | Felypressin is a non-catecholamine vasoconstrictor that is chemically related to vasopressin, the posterior pituitary hormone. Synonyms: Vasopressin, 2-L-phenylalanine-8-L-lysine-, acetate (salt); 2-L-Phenylalanine-8-L-lysinevasopressin Acetate (Salt); 2,3-Bis(phenylalanine)-8-lysineoxytocin Acetate; 2-(Phenylalanine)-8-lysinevasopressin Acetate; 2-Phenylalanine-8-lysine-vasopressin Acetate; L-cysteinyl-L-phenylalanyl-L-phenylalanyl-L-glutaminyl-L-asparagyl-L-cysteinyl-L-prolyl-L-lysyl-glycinamide (1->6)-disulfide acetic acid; H-Cys(1)-Phe-Phe-Gln-Asn-Cys(1)-Pro-Lys-Gly-NH2.CH3CO2H. Grades: ≥95%. CAS No. 914453-97-7. Molecular formula: C46H65N13O11S2.xC2H4O2. Mole weight: 1100.3. | |
Fmoc-L-Lys(Boc-AEEA)-OH Quick inquiry Where to buy Suppliers range | Used as a linker in solid-phase peptide synthesis and in Semaglutide preparation. Synonyms: Nα -Fmoc-Nε - (2- (2- (2- (tert-butyloxycarbonyl) aminoethoxy) ethoxy) acetyl) -L-lysine; Nα-Fmoc-Nε-(AEEA-Boc)-L-Lysine. Grades: ≥ 99% (Assay by titration, HPLC). CAS No. 1662688-16-5. Molecular formula: C32H43N3O9. Mole weight: 613.70. | |
Glatiramer acetate Quick inquiry Where to buy Suppliers range | Glatiramer acetate consists of the acetate salts of synthetic polypeptides, containing four naturally occurring amino acids: L-glutamic acid, L-alanine, L-tyrosine, and L-lysine with an average molar fraction of 0.141, 0.427, 0.095, and 0.338, respectively. The average molecular weight of glatiramer acetate is 5,000-9,000 daltons. It is an immunomodulator, licensed in much of the world for reduced frequency of relapses in relapsing-remitting multiple sclerosis. Uses: API. CAS No. 147245-92-9. Product ID: 10-101-164. | |
Glatiramer acetate Quick inquiry Where to buy Suppliers range | Glatiramer acetate is an immunomodulator drug currently used to treat multiple sclerosis. It is a random polymer of four amino acids found in myelin basic protein, namely L-glutamic acid, L-lysine, L-alanine, and L-tyrosine. Synonyms: Copaxone; Copolymer 1; Copolymer-1. CAS No. 147245-92-9. Molecular formula: C25H45N5O13. Mole weight: 623.657. | |
Glatiramer Acetate Quick inquiry Where to buy Suppliers range | Glatiramer Acetate. Uses: For analytical and research use. Group: Building Blocks. Alternative Names: L-Lysine, polymer with L-alanine, L-glutamic acid and L-tyrosine, acetate (salt) (9CI), TV 5010, Copaxone, Cop 1, Glatiramer acetate, Cop 1 (polyamide), Probioglat, L-Tyrosine, polymer with L-alanine, L-glutamic acid and L-lysine, acetate (salt) (9CI), L-Alanine, polymer with L-glutamic acid, L-lysine and L-tyrosine, acetate (salt) (9CI), Copolymer 1, Escadra, Hangzhou, Protiramer, L-Glutamic acid peptide with L-alanine, L-lysine and L-tyrosine, acetate (salt), Natco,L-Glutamic acid, polymer with L-alanine, L-lysine and L-tyrosine, acetate (salt), Polimunol. CAS No. 147245-92-9. Molecular formula: ( (C9H11NO3)mon (C3H7NO2)mon (C6H14N2O2)mon (C5H9NO4)mon)ran. C2H4O2. Mole weight: 623.65. Catalog: APS147245929. Format: Neat. | |
Glatiramer Acetate Quick inquiry Where to buy Suppliers range | Glatiramer acetate is a random basic synthetic copolymer of L-alanine, L-lysine, l-glutamic acid and L-tyrosine in a molar ratio of 6:1.9:4.7:1. Glatiramer acetate is an immunomodulator used in treatment of multiple sclerosis. A representative lot had an average molecular weight of 4600 amu. Group: Biochemicals. Alternative Names: L-Alanine polymer with L-Glutamic Acid L-Lysine L-Tyrosine Acetate ; L-Tyrosine polymer with L-Alanine L-Glutamic Acid L-Lysine Acetate; 511: PN: WO2010103292 PAGE: 64 claimed sequence; Cop 1; Copaxone; Copolymer 1; L-Glutamic Acid peptide with L-Alanine L-Lysine L-Tyrosine Acetate Salt; Protiramer; TV 5010. Grades: Highly Purified. CAS No. 147245-92-9. Pack Sizes: 5mg, 10mg, 25mg. Molecular Formula: C?H??NO?; C? H??N?O?; C?H?NO?; C?H?NO?. US Biological Life Sciences. | Worldwide |
Glycyl-lysine Quick inquiry Where to buy Suppliers range | Glycyl-lysine is a dipeptide composed of glycine and lysine. It is an incomplete breakdown product of protein digestion or protein catabolism. Synonyms: glycyllysine; Gly-Lys; L-Lysine, glycyl-; L-Lysine, N2-glycyl-; Glycyl-L-lysine; N2-Glycyllysine; Nalpha-Glycyl-L-lysine; H-GK-OH; (S)-6-Amino-2-(2-amino-acetylamino)-hexanoic acid. Grades: ≥95%. CAS No. 997-62-6. Molecular formula: C8H17N3O3. Mole weight: 203.24. | |
Gly-His-Lys-OH AcOH Quick inquiry Where to buy Suppliers range | Tripeptide-1 Acetate is a tripeptide that can form a complex with copper ions. It is used for hair growth and skin care in cosmetics. It is a liver cell growth factor and stimulates hepatic erythropoietic factor production. Synonyms: Tripeptide-1 Acetate; L-Lysine, glycyl-L-histidyl-, monoacetate; L-Lysine, N2-(N-glycyl-L-histidyl)-, monoacetate; Glycyl-L-histidyl-L-lysine acetate; Gly-His-Lys-OH acetate salt. Grades: ≥95%. CAS No. 72957-37-0. Molecular formula: C14H24N6O4.C2H4O2. Mole weight: 400.43. | |
L-Lysine,glycyl-L-arginylglycyl-L-a-aspartyl-L-seryl-l-prolyl- Quick inquiry Where to buy Suppliers range | WHITE POWDER. Group: Heterocyclic Organic Compound. Alternative Names: Grgdspk; Gly-arg-gly-asp-ser-pro-lys. Grades: 96%. CAS No. 111119-28-9. Molecular formula: C28H49N11O11. Mole weight: 715.76. IUPAC Name: (2S) -6-amino-2-[[ (2S) -1-[ (2S) -2-[[ (2S) -2-[[2-[[ (2S) -2-[ (2-aminoacetyl) amino]-5- (diaminomethylideneamino) pentanoyl]amino]acetyl]amino]-4-hydroxy-4-oxobutanoyl]amino]-3-hydroxypropanoyl]pyrrolidine-2-carbonyl]amino]hexanoic acid. Exact Mass: 715.36100. Density: 1.59 g/cm3. SMILES: C1CC (N (C1)C (=O)C (CO)NC (=O)C (CC (=O)O)NC (=O)CNC (=O)C (CCCN=C (N)N)NC (=O)CN)C (=O)NC (CCCCN)C (=O)O. InChIKey: ZRVZOBGMZWVJOS-VMXHOPILSA-N. H-Bond Donor: 12. H-Bond Acceptor: 16. | |
LY2510924 acetate Quick inquiry Where to buy Suppliers range | Ly2510924 acetate is a potent and selective CXCR4 antagonist that prevents the binding of SDF-1 to CXCR4 with an IC50 of 0.079 nM. It has potential antineoplastic activity. Synonyms: L-Lysinamide, L-phenylalanyl-L-tyrosyl-N6-(1-methylethyl)-L-lysyl-D-arginyl-3-(2-naphthalenyl)-L-alanylglycyl-D-α-glutamyl-N6-(1-methylethyl)-, (7?1)-lactam, acetate (1:1); LY 2510924 acetate; LY-2510924 acetate; N(1)Phe-Tyr-Lys(iPr)-D-Arg-2Nal-Gly-D-Glu(1)-Lys(iPr)-NH2 acetate. Grades: ≥95%. Molecular formula: C62H88N14O10.C2H4O2. Mole weight: 1249.53. | |
(Lys(Ac)12)-Histone H4 (1-21)-Gly-Gly-Lys(biotinyl) Quick inquiry Where to buy Suppliers range | Synonyms: H4K12(Ac)-GGK(biotin); N-Acetyl-L-serylglycyl-L-arginylglycyl-L-lysylglycylglycyl-L-lysylglycyl-L-leucylglycyl-N6-acetyl-L-lysylglycylglycyl-L-alanyl-L-lysyl-L-arginyl-L-histidyl-L-arginyl-L-lysyl-L-valylglycylglycyl-N6-{5-[(3aS,4S,6aR)-2-oxohexahydro-1H-thieno[3,4-d]imidazol-4-yl]pentanoyl}-L-lysine; Ac-Ser-Gly-Arg-Gly-Lys-Gly-Gly-Lys-Gly-Leu-Gly-Lys(Ac)-Gly-Gly-Ala-Lys-Arg-His-Arg-Lys-Val-Gly-Gly-Lys(biotinyl)-OH. Grades: ≥95%. CAS No. 2022956-66-5. Molecular formula: C111H195N43O30S. Mole weight: 2644.11. | |
(Lys(Ac)5.8.12.16)-Histone H4 (1-25)-Gly-Ser-Gly-Ser-Lys(biotinyl) Quick inquiry Where to buy Suppliers range | Synonyms: H4K5(Ac)K8(Ac)12(Ac)K16(Ac)-GSGSK(Biotin); H-Ser-Gly-Arg-Gly-Lys(Ac)-Gly-Gly-Lys(Ac)-Gly-Leu-Gly-Lys(Ac)-Gly-Gly-Ala-Lys(Ac)-Arg-His-Arg-Lys-Val-Leu-Arg-Asp-Asn-Gly-Ser-Gly-Ser-Lys(biotinyl)-OH; L-Serylglycyl-L-arginylglycyl-N6-acetyl-L-lysylglycylglycyl-N6-acetyl-L-lysylglycyl-L-leucylglycyl-N6-acetyl-L-lysylglycylglycyl-L-alanyl-N6-acetyl-L-lysyl-L-arginyl-L-histidyl-L-arginyl-L-lysyl-L-valyl-L-leucyl-L-arginyl-L-α-aspartyl-L-asparaginylglycyl-L-serylglycyl-L-seryl-N6-{5-[(3aS,4S,6aR)-2-oxohexahydro-1H-thieno[3,4-d]imidazol-4-yl]pentanoyl}-L-lysine. Grades: ≥95%. CAS No. 2022956-65-4. Molecular formula: C141H243N53O43S. Mole weight: 3400.84. | |
Lysine acetate Quick inquiry Where to buy Suppliers range | Lysine acetate. Uses: For analytical and research use. Group: European Pharmacopoeia (Ph. Eur.); Pharmacopoeial Standards. Alternative Names: L-Lysine acetate,L-Lysine, acetate (1:1), -Lysine, monoacetate (9CI), Lysine monoacetate, (2S)-2,6-Diaminohexanoic acid acetate, Lysine acetate. CAS No. 57282-49-2. IUPAC Name: acetic acid;(2S)-2,6-diaminohexanoic acid. Molecular formula: C6H14N2O2.C2H4O2. Mole weight: 206.24. Catalog: APS57282492. SMILES: CC(=O)O.NCCCC[C@H](N)C(=O)O. Format: Neat. Product Type: API. Shipping: Room Temperature. | |
Lysine hydrochloride Quick inquiry Where to buy Suppliers range | Lysine hydrochloride. Uses: For analytical and research use. Group: European Pharmacopoeia (Ph. Eur.); Pharmacopoeial Standards. Alternative Names: Saturated Aminoalcohol Hydrochloride, Lysion, Bovi-Lysine, L-Lysine hydrochloride, Lyamine, Acetamido Alcohol, NSC 9253, (S)-2,6-diaminohexanoic acid hydrochloride, L-(+)-Lysine monohydrochloride, Aminoalcohol Hydrochloride, Darvyl, Lysine hydrochloride, L-Lysine, monohydrochloride (9CI), Lysine, monohydrochloride, L- (8CI), Lysine Dihydrochloride, L-Gen,L-Lysine, hydrochloride (1:1), Lysine monohydrochloride, Relys, Trans-Amininoalcohol Hydrochloride, Lysine hydrochloride, Conjugated Amino Acid, Amino Acid, L-Lysine monohydrochloride. CAS No. 657-27-2. IUPAC Name: (2S)-2,6-diaminohexanoic acid;hydrochloride. Molecular formula: C6H14N2O2.ClH. Mole weight: 182.65. Catalog: APS657272. SMILES: Cl.NCCCC[C@H](N)C(=O)O. Format: Neat. Product Type: API. Shipping: Room Temperature. | |
Lysipressin Quick inquiry Where to buy Suppliers range | Lysipressin Acetate is a lysine vasopressin, which retains water in the body and constricts blood vessels. Synonyms: Lys(8)-Vasopressin; Lys(8)-AVP; H-Cys-Tyr-Phe-Gln-Asn-Cys-Pro-Lys-Gly-NH2 (Disulfide bridge: Cys1-Cys6); L-cysteinyl-L-tyrosyl-L-phenylalanyl-L-glutaminyl-L-asparagyl-L-cysteinyl-L-prolyl-L-lysyl-glycinamide (1->6)-disulfide; Vasopressin, 8-L-lysine-; 1,2-Dithia-5,8,11,14,17-pentaazacycloeicosane-10-propionamide, 19-amino-4-[2-[[5-amino-1-[ (carbamoylmethyl) carbamoyl]pentyl]carbamoyl]-1-pyrrolidinylcarbonyl]-13-benzyl-7- (carbamoylmethyl) -16-p-hydroxybenzyl-6, 9, 12, 15, 18-pentaoxo-; 8-L-Lysinevasopressin; 3-(Phenylalanine)-8-lysine oxytocin; 8-L-Lysine vasopressin; L-Lysine vasopressin; [8-Lysine]vasopressin; Diapid; Lysine pitressin; Lysine vasopressin; Lysine-ADH; Lysylvasopressin; Oxytocin, 3-(L-phenylalanine)-8-L-lysine-; Postacton; Syntopressin; Vasophysin; Vasopressin-8-lysine; Lysine-AVP. Grades: 98%. CAS No. 50-57-7. Molecular formula: C46H65N13O12S2. Mole weight: 1056.22. | |
Lysipressin Acetate Quick inquiry Where to buy Suppliers range | Lysipressin Acetate is a lysine vasopressin, which retains water in the body and constricts blood vessels. Synonyms: Vasopressin, 8-l-lysine-, monoacetate (salt). CAS No. 83968-49-4. Molecular formula: C48H69N13O14S2. Mole weight: 1116.3. | |
Mca-Ala-Pro-Lys(Dnp)-OH Quick inquiry Where to buy Suppliers range | Mca-Ala-Pro-Lys(Dnp)-OH, a FRET substrate for angiotensin-converting enzyme 2 (ACE2), is used to monitor enzyme activity in plasma, urine, heart and lungs. Synonyms: Mca-APK(Dnp); L-Lysine, N-[2-(7-methoxy-2-oxo-2H-1-benzopyran-4-yl)acetyl]-L-alanyl-L-prolyl-N6-(2,4-dinitrophenyl)-; N-[(7-Methoxy-2-oxo-2H-chromen-4-yl)acetyl]-L-alanyl-L-prolyl-N6-(2,4-dinitrophenyl)-L-lysine; (S)-6-((2,4-dinitrophenyl)amino)-2-((S)-1-((S)-2-(2-(7-methoxy-2-oxo-2H-chromen-4-yl)acetamido)propanoyl)pyrrolidine-2-carboxamido)hexanoic acid. Grades: ≥95%. CAS No. 305336-82-7. Molecular formula: C32H36N6O12. Mole weight: 696.67. | |
Mca-(Asn670,Leu671)-Amyloid β/A4 Protein Precursor770 (667-675)-Lys(Dnp) Quick inquiry Where to buy Suppliers range | Mca-(Asn670,Leu671)-Amyloid β/A4 Protein Precursor770 (667-675)-Lys(Dnp) is a pro-memapsin-2 fluorogenic substrate (FRET) containing the β-secretase site of the Swedish mutation of APP, SEVNLDAEF. Synonyms: Mca-(Asn670,Leu671)-APP770 (667-675)-Lys(Dnp); Mca-Ser-Glu-Val-Asn-Leu-Asp-Ala-Glu-Phe-Lys(Dnp)-OH; N-[(7-Methoxy-2-oxo-2H-chromen-4-yl)acetyl]-L-seryl-L-α-glutamyl-L-valyl-L-asparaginyl-L-leucyl-L-α-aspartyl-L-alanyl-L-α-glutamyl-L-phenylalanyl-N6-(2,4-dinitrophenyl)-L-lysine; L-Lysine, N-[2-(7-methoxy-2-oxo-2H-1-benzopyran-4-yl)acetyl]-L-seryl-L-α-glutamyl-L-valyl-L-asparaginyl-L-leucyl-L-α-aspartyl-L-alanyl-L-α-glutamyl-L-phenylalanyl-N6-(2,4-dinitrophenyl)-. Grades: ≥95%. CAS No. 1802078-31-4. Molecular formula: C68H88N14O27. Mole weight: 1533.53. | |
Mca-(Asn670,Leu671)-Amyloid β/A4 Protein Precursor770 (667-675)-Lys(Dnp) amide Quick inquiry Where to buy Suppliers range | Mca-(Asn670,Leu671)-Amyloid β/A4 Protein Precursor770 (667-675)-Lys(Dnp) amide is a fluorogenic (FRET) substrate for pro-memapsin-2 containing the β-secretase site of the Swedish mutation of APP. Its kinetic parameters at pH 4.5 are Km = 4.5 μM and kcat = 0.25 min-1. Synonyms: Mca-(Asn670,Leu671)-APP770 (667-675)-Lys(Dnp) amide; Mca-Ser-Glu-Val-Asn-Leu-Asp-Ala-Glu-Phe-Lys(Dnp)-NH2; N-[(7-Methoxy-2-oxo-2H-chromen-4-yl)acetyl]-L-seryl-L-α-glutamyl-L-valyl-L-asparaginyl-L-leucyl-L-α-aspartyl-L-alanyl-L-α-glutamyl-L-phenylalanyl-N6-(2,4-dinitrophenyl)-L-lysinamide; L-Lysinamide, N-[2-(7-methoxy-2-oxo-2H-1-benzopyran-4-yl)acetyl]-L-seryl-L-α-glutamyl-L-valyl-L-asparaginyl-L-leucyl-L-α-aspartyl-L-alanyl-L-α-glutamyl-L-phenylalanyl-N6-(2,4-dinitrophenyl)-; Mca-SEVNLDAEFK(Dnp) amide. Grades: ≥95%. CAS No. 1802078-32-5. Molecular formula: C68H89N15O26. Mole weight: 1532.54. | |
Nα-Acetyl-L-lysine Quick inquiry Where to buy Suppliers range | Nα-Acetyl-L-Lysine is an antibacterial lysine analogue that targets lysine riboswitches. Nα-Acetyl-L-Lysine is used in the metabolomic characterization of ovarian epithelial carcinomas which allows for better therapeutic management of patients. The presence of Nα-Acetyl-L-Lysine and other N-acetylated amino acids in the urine can be used to detect aminoacylase I deficiency. Synonyms: Ac-L-Lys-OH; N-Acetyl-L-lysine; AC-LYSINE; L-Lysine,N2-acetyl; Nalpha-Acetyl-L-lysine; N2-Acetyl-L-lysine. Grades: ≥ 99% (HPLC). CAS No. 1946-82-3. Molecular formula: C8H16N2O3. Mole weight: 188.20. | |
Nα-Acetyl-Nε-Boc-L-lysine Quick inquiry Where to buy Suppliers range | Synonyms: Ac-L-Lys(Boc)-OH; (2S)-2-acetamido-6-[(2-methylpropan-2-yl)oxycarbonylamino]hexanoic acid; N2-Acetyl-N6-[(1,1-Dimethylethoxy)Carbonyl]-L-Lysine; Acetyl-Nepsilon-Boc-L-lysine; Ac-Lys(Boc)-OH. Grades: ≥ 98% (HPLC). CAS No. 23500-04-1. Molecular formula: C13H24N2O5. Mole weight: 288.34. | |
Nα-Fmoc-Nε-acetyl-L-lysine Quick inquiry Where to buy Suppliers range | Synonyms: Fmoc-L-Lys(Ac)-OH; N~6~-Acetyl-N~2~-[(9H-Fluoren-9-Ylmethoxy)Carbonyl]-L-Lysine. Grades: ≥ 98.5% (HPLC). CAS No. 159766-56-0. Molecular formula: C23H26N2O5. Mole weight: 410.50. | |
N-p-Tosyl-Gly-Pro-Lys p-nitroanilide acetate salt Quick inquiry Where to buy Suppliers range | N-p-Tosyl-Gly-Pro-Lys p-nitroanilide acetate salt is a chromogenic substrate for plasmin determination, serine protease activity and fibrinogen decomposition determination. Synonyms: N-(p-Tosyl)-Gly-Pro-Lys 4-nitroanilide acetate salt; Tos-GPK-pNA; Tos-Gly-Pro-Lys-pNA acetate; N-[(4-methylphenyl)sulfonyl]glycyl-L-prolyl-N-(4-nitrophenyl)-L-lysinamide, monoacetate. Grades: ≥98% by TLC. CAS No. 88793-79-7. Molecular formula: C28H38N6O9S. Mole weight: 634.7. | |
Palmitoyl tripeptide-1 acetate Quick inquiry Where to buy Suppliers range | Palmitoyl tripeptide-1 acetate. Alternative Names: L-Lysine, N-(1-oxohexadecyl)glycyl-L-histidyl-, acetate salt. CAS No. 1628252-62-9. Product ID: ACM1628252629. Molecular formula: C32H58N6O7. Mole weight: 638.84. | |
[Phe1Ψ(CH2-NH)Gly2]Nociceptin(1-13)NH2 Quick inquiry Where to buy Suppliers range | [Phe1Ψ(CH2-NH)Gly2]Nociceptin(1-13)NH2 is the first selective antagonist to prevent the binding of the endogenous ligand orphanin FQ?/Nociceptin (OFQ?/N) at the orphan opioid-like receptor, demonstrated both in vitro and in vivo. It is selective, competitive antagonism at the nociceptin receptor has also been reported (pA2 = 7.02 and 6.75 in the guinea pig ileum and mouse vas deferens respectively). Synonyms: (2S) -6-amino-2- [ [ (2S) -2- [ [ (2S) -2- [ [ (2S) -2- [ [ (2S) -6-amino-2- [ [ (2S) -2- [ [ (2S) -2- [ [2- [ [ (2S, 3R) -2- [ [ (2S) -2- [ [2- [ [2- [ [ (2S) -2-amino-3-phenylpropyl] amino] acetyl] amino] acetyl] amino] -3-phenylpropanoyl] amino] -3-hydroxybutanoyl] amino] acetyl] amino] propanoyl] amino] -5- (diaminomethylideneamino) pentanoyl] amino] hexanoyl] amino] -3-hydroxypropanoyl] amino] propanoyl] amino] -5- (diaminomethylideneamino) pentanoyl] amino] hexanamide; N-[(2S)-2-Amino-3-phenylpropyl]glycylglycyl-L-phenylalanyl-L-threonylglycyl-L-alanyl-L-arginyl-L-lysyl-L-seryl-L-alanyl-L-arginyl-L-lysinamide; N-[(2S)-2-Amino-3-phenylpropyl]-13-L-lysinamide-2-13-orphanin FQ (swine). CAS No. 213130-17-7. Molecular formula: C61H102N22O14. Mole weight: 1367.6. | |
(Ser(GlcNAc-β-D)236)-EMSY (230-240) Quick inquiry Where to buy Suppliers range | EMSY is a binding partner of BRCA2, a breast cancer susceptibility protein involved in double-stranded DNA repair. EMSY is thought to play a role in maintaining the stability of genomics in the M-phase. Synonyms: H-Thr-Ile-Thr-Val-Pro-Val-Ser(GlcNAc-β-D)-Gly-Ser-Pro-Lys-OH; L-Lysine, L-threonyl-L-isoleucyl-L-threonyl-L-valyl-L-prolyl-L-valyl-O-[2-(acetylamino)-2-deoxy-β-D-glucopyranosyl]-L-serylglycyl-L-seryl-L-prolyl-. Grades: ≥95%. CAS No. 2243207-03-4. Molecular formula: C56H97N13O21. Mole weight: 1288.46. | |
SHU 9119 Quick inquiry Where to buy Suppliers range | SHU 9119 is a potent antagonist at human melanocortin 3 (IC50 = 0.23 nM) and 4 receptors (IC50 = 0.06 nM), and a partial agonist at the hMC5R (IC50 = 0.09 nM). Synonyms: L-Lysinamide, N-acetyl-L-norleucyl-L-α-aspartyl-L-histidyl-3-(2-naphthalenyl)-D-alanyl-L-arginyl-L-tryptophyl-, (2?7)-lactam; L-Lysinamide, N-acetyl-L-norleucyl-L-α-aspartyl-L-histidyl-3-(2-naphthalenyl)-D-alanyl-L-arginyl-L-tryptophyl-, cyclic (2?7)-peptide; MBX 36; SHU-9119; SHU9119. Grades: ≥95%. CAS No. 168482-23-3. Molecular formula: C54H71N15O9. Mole weight: 1074.24. | |
Terlipressin Acetate Quick inquiry Where to buy Suppliers range | Terlipressin is an analog of vasopressin and a partial agonist of the vasopressin V1A receptor (Ki = 0.85 μM). It has been used as a vasoactive drug in the management of low blood pressure. Synonyms: Vasopressin, N-(glycylglycylglycyl)-8-L-lysine-, acetate (1:x); Vasopressin, N-(glycylglycylglycyl)-8-L-lysine-, acetate (salt); H-Gly-Gly-Gly-L-Cys(1)-Tyr-Phe-Gln-Asn-Cys(1)-Pro-Lys-Gly-NH2.C2H4O2; glycyl-glycyl-glycyl-L-cysteinyl-L-tyrosyl-L-phenylalanyl-L-glutaminyl-L-asparagyl-L-cysteinyl-L-prolyl-L-lysyl-glycinamide (4->9)-disulfide acetate. Grades: ≥95%. CAS No. 914453-96-6. Molecular formula: C52H74N16O15S2.xC2H4O2. Mole weight: 1227.38 (free base). |