American Chemical Suppliers

A directory of where to buy chemicals in the USA, including: distributors, industrial manufacturers, bulk supplies and wholesalers of raw ingredients & finished goods.

Search for products or services, then visit the suppliers website for prices or more information.

Product
Apelin-13 trifluoroacetate salt Apelin-13 trifluoroacetate salt is the endogenous ligand of the APJ receptor, activating this G protein-coupled receptor with an EC50 value of 0.37 nM. Synonyms: Apelin-13 triTFA. Molecular formula: C75H114F9N23O22S. Mole weight: 1892.89. BOC Sciences 6
Apelin-17 (human, bovine) Apelin-17 (human, bovine). Group: Biochemicals. Grades: Purified. CAS No. 217082-57-0. Pack Sizes: 1mg. US Biological Life Sciences. USBiological 5
Worldwide
Apelin-17(human, bovine) Apelin-17(human, bovine) is an endogenous orphan G protein-coupled receptor APJ agonist. Apelin-17(human, bovine) binds to human APJ receptors expressed in HEK 293 cells (pIC50=9.02). Apelin-17(human, bovine) inhibits the entry of some HIV-1 and HIV-2 into the NP2/CD4 cells expressing APJ[1][2][3]. Uses: Scientific research. Group: Peptides. CAS No. 217082-57-0. Pack Sizes: 1 mg; 5 mg. Product ID: HY-P1066. MedChemExpress MCE
Apelin-17 (Human, Bovine) Apelin-17 (human, bovine) is an endogenous ligand of the G protein-coupled APJ receptor with EC50 value of 2.5 nM that is secreted by adipocytes. It potently inhibits forskolin-stimulated cAMP production in vitro. Synonyms: [Phe17]-Apelin 17. Grade: 98.86%. CAS No. 217082-57-0. Molecular formula: C96H156N34O20S. Mole weight: 2138.56. BOC Sciences
Apelin-17 (human, bovine) acetate Apelin-17 (human, bovine) acetate, secreted by adipocytes, is an endogenous ligand of the G protein-coupled APJ receptor with an EC50 of 2.5 nM. It is an endogenous apelin receptor agonist that potently inhibits forskolin-stimulated cAMP production in vitro. Synonyms: H-Lys-Phe-Arg-Arg-Gln-Arg-Pro-Arg-Leu-Ser-His-Lys-Gly-Pro-Met-Pro-Phe-OH.CH3CO2H; L-lysyl-L-phenylalanyl-L-arginyl-L-arginyl-L-glutaminyl-L-arginyl-L-prolyl-L-arginyl-L-leucyl-L-seryl-L-histidyl-L-lysyl-glycyl-L-prolyl-L-methionyl-L-prolyl-L-phenylalanine acetic acid. Grade: ≥95%. Molecular formula: C98H160N34O22S. Mole weight: 2198.63. BOC Sciences 6
Apelin-36 (human) Apelin-36 (human) is an endogenous ligand of the G protein-coupled APJ receptor with EC50 value of 20 nM that is secreted by adipocytes. It is the full-length mature peptide produced from the translated 77 amino acid prepropeptide. It acts primarily in the central nervous and peripheral system. It is important in regulating fluid homeostasis, cardiovascular function, insulin and hypertension sensitivity. It potently blocks HIV-1 and HIV-2 strains entry into cells expressing APJ and CD4 and limits HIV infection. It endogenously binds with high affinity to human APJ receptors expressed in HEK 293 cells. Synonyms: H-Leu-Val-Gln-Pro-Arg-Gly-Ser-Arg-Asn-Gly-Pro-Gly-Pro-Trp-Gln-Gly-Gly-Arg-Arg-Lys-Phe-Arg-Arg-Gln-Arg-Pro-Arg-Leu-Ser-His-Lys-Gly-Pro-Met-Pro-Phe-OH; L-leucyl-L-valyl-L-glutaminyl-L-prolyl-L-arginyl-glycyl-L-seryl-L-arginyl-L-asparagyl-glycyl-L-prolyl-glycyl-L-prolyl-L-tryptophyl-L-glutaminyl-glycyl-glycyl-L-arginyl-L-arginyl-L-lysyl-L-phenylalanyl-L-arginyl-L-arginyl-L-glutaminyl-L-arginyl-L-prolyl-L-arginyl-L-leucyl-L-seryl-L-histidyl-L-lysyl-glycyl-L-prolyl-L-methionyl-L-prolyl-L-phenylalanine. Grade: ≥95% by HPLC. CAS No. 252642-12-9. Molecular formula: C184H297N69O43S. Mole weight: 4195.87. BOC Sciences
Apelin-36 (human) Endogenous APJ receptor agonist (EC50 = 20 nM) that is secreted by adipocytes. Binds with high affinity to human APJ receptors expressed in HEK 293 cells (pIC50= 8.61). Involved in regulation of cardiovascular function, fluid homeostasis and feeding. Blocks entry of some HIV-1 and HIV-2 strains into NP-2/CD4 cells expressing APJ. Group: Biochemicals. Grades: Highly Purified. CAS No. 252642-12-9. Pack Sizes: 1mg. Molecular Formula: C184H297N69O43S, Mass Spectrum: Consistent with structure. US Biological Life Sciences. USBiological 5
Worldwide
Apelin-36(human) Apelin-36(human) is an endogenous orphan G protein-coupled receptor APJ agonist, with an EC 50 of 20 nM. Apelin-36(human) shows high affinity to human APJ receptors expressed in HEK 293 cells (pIC 50 =8.61). Apelin-36 has been linked to two major types of biological activities: cardiovascular and metabolic. Apelin-36(human) inhibits the entry of some HIV-1 and HIV-2 into the NP2/CD4 cells expressing APJ [1] [2] [3] [4]. Uses: Scientific research. Group: Peptides. CAS No. 252642-12-9. Pack Sizes: 1 mg; 5 mg. Product ID: HY-P1064. MedChemExpress MCE
Apelin-36(human) Apelin-36(human) is an endogenous orphan G protein-coupled receptor APJ agonist, with an EC50 of 20 nM. Apelin-36(human) shows high affinity to human APJ receptors expressed in HEK 293 cells (pIC50=8.61). Apelin-36 has been linked to two major types of biological activities: cardiovascular and metabolic. Apelin-36(human) inhibits the entry of some HIV-1 and HIV-2 into the NP2/CD4 cells expressing APJ. Uses: Designed for use in research and industrial production. Additional or Alternative Names: LVQPRGSRNGPGPWQGGRRKFRRQRPRLSHKGPMPF;H-LEU-VAL-GLN-PRO-ARG-GLY-SER-ARG-ASN-GLY-PRO-GLY-PRO-TRP-GLN-GLY-GLY-ARG-ARG-LYS-PHE-ARG-ARG-GLN-ARG-PRO-ARG-LEU-SER-HIS-LYS-GLY-PRO-MET-PRO-PHE-OH;LEU-VAL-GLN-PRO-ARG-GLY-SER-ARG-ASN-GLY-PRO-GLY-PRO-TRP-GLN-GLY-GLY-. Product Category: Inhibitors. CAS No. 252642-12-9. Molecular formula: C184H297N69O43S. Purity: 0.9811. Product ID: ACM252642129. Alfa Chemistry — ISO 9001:2015 Certified. Categories: Apelin-36 (human). Alfa Chemistry.
Apelin-36 (rat, mouse) Apelin-36 (rat, mouse). Group: Biochemicals. Grades: Purified. CAS No. 230299-95-3. Pack Sizes: 1mg. US Biological Life Sciences. USBiological 5
Worldwide
Apelin-36 (rat, mouse) Apelin-36 (rat, mouse) is an endogenous ligand of the G protein-coupled APJ receptor with EC50 value of 5.4 nM that is secreted by adipocytes. It potently inhibits cAMP production in vitro. It is important in regulating fluid homeostasis, cardiovascular function and feeding. It potently blocks HIV-1 and HIV-2 strains entry into cells expressing APJ and CD4 and limits HIV infection. Synonyms: Apelin-36 (rat, mouse); Apelin 36 (rat, mouse); Apelin36 (rat, mouse). Grade: 95%. CAS No. 230299-95-3. Molecular formula: C185H304N68O43S. Mole weight: 4200.93. BOC Sciences
a-Pentylcinnamaldehyde diethyl acetal a-Pentylcinnamaldehyde diethyl acetal. Group: Biochemicals. Grades: Highly Purified. CAS No. 60763-41-9. Pack Sizes: 100mg, 250mg, 500mg. Molecular Formula: C18H28O2. US Biological Life Sciences. USBiological 6
Worldwide
APETx2 APETx2, an ion channel 3 (ASIC3) channel blocker, has been found to exhibit analgesic properties against acid-induced and inflammatory pain. Synonyms: APETx2; 713544-47-9; AKOS024458355; H-Gly-DL-xiThr-DL-Ala-DL-Cys(1)-DL-Ser-DL-Cys(2)-Gly-DL-Asn-DL-Ser-DL-Lys-Gly-DL-xiIle-DL-Tyr-DL-Trp-DL-Phe-DL-Tyr-DL-Arg-DL-Pro-DL-Ser-DL-Cys(3)-DL-Pro-DL-xiThr-DL-Asp-DL-Arg-Gly-DL-Tyr-DL-xiThr-Gly-DL-Ser-DL-Cys(2)-DL-Arg-DL-Tyr-DL-Phe-DL-Leu-Gly-DL-xiThr-DL-Cys(1)-DL-Cys(3)-DL-xiThr-DL-Pro-DL-Ala-DL-Asp-OH. Grade: >98%. CAS No. 713544-47-9. Molecular formula: C196H280N54O61S6. Mole weight: 4561.06. BOC Sciences
APETx2 APETx2. Group: Biochemicals. Grades: Purified. CAS No. 713544-47-9. Pack Sizes: 100ug. US Biological Life Sciences. USBiological 5
Worldwide
APF APF is a fluorescence probe that can selectively, and dose dependently detect certain species among ROS and that are highly resistant to autoxidation. APF can be used in enzymatic and cellular systems [1]. Uses: Scientific research. Group: Fluorescent dye. CAS No. 359010-70-1. Pack Sizes: 500 μg (11.81 mM * 100 μL in Methyl acetate). Product ID: HY-119977. MedChemExpress MCE
APF Sialoglycopeptide ammonium salt APF Sialoglycopeptide ammonium salt is a cutting-edge biomedical compound, demonstrating remarkable capabilities in research of dental caries. Proven to possess potent antimicrobial properties against the notorious Streptococcus mutans, this compound also exhibits an extraordinary affinity for hydroxyapatite, amplifying the process of tooth remineralization. Synonyms: O-(Acetamido-3,5-dideoxy-D-glycero-a-D-galacto-2-nonulopyranosylonic acid)-(2→3)-O-b-D- galactopyranosyl-(1→3)-O-a-2-acetamido-2-deoxy-D-galactopyranosyl-(1 →O)- Thr-Val-Pro-Ala-Ala-Val-Val-Val-Ala; NeuNAc-a(2→3)-Gal-b(1→3)-GalNAc-a-Thr-Val-Pro-Ala-Ala-Val-Val-Val-Ala. Molecular formula: C63H107N11O29. Mole weight: 1482.58. BOC Sciences 6
ApG ApG is a scientifically advanced compound, specifically designed to study inflammatory skin disorders as well as combat skin infections. It comprises a potent blend of bioactive drugs exhibiting exceptional antimicrobial and anti-inflammatory attributes. Grade: ≥ 95% by HPLC. Molecular formula: C20H25N10O11P (free acid). Mole weight: 612.14 (free acid). BOC Sciences 6
APG-1387 APG-1387 is an inhibitor of IAPs. Study shows that APG-1387 could induce apoptosis of PLC/PRF/5 which was HBV positive both in vitro and in vivo. Synonyms: APG 1387; APG1387. Grade: 98% by HPLC. CAS No. 1570231-89-8. Molecular formula: C60H72N10O10S2. Mole weight: 1157.4. BOC Sciences 6
APG-2449 APG-2449 is an orally active ALK/ROS1/FAK inhibitor. APG-2449 shows antitumor activity in mouse models of non-small cell lung cancer (NSCLC) [1]. Uses: Scientific research. Group: Signaling pathways. CAS No. 2196186-84-0. Pack Sizes: 10 mM * 1 mL; 5 mg; 10 mg; 25 mg; 50 mg; 100 mg. Product ID: HY-155163. MedChemExpress MCE
APHA Compound 8 ?98% (HPLC), solid. Group: Fluorescence/luminescence spectroscopy. Alfa Chemistry Analytical Products 3
APHA Compound 8 APHA Compound 8 is a synthetic HDAC (histone deacetylase) inhibitor, which is in the same structural class as SAHA. The IC50 for mouse HDAC1 is 0.5 μM. It induces histone hyperacetylation, growth inhibition, and terminal cell differentiation. Synonyms: MC-1353; MC1353; MC 1353; APHA-8; APHA Compound 8; Aroyl pyrrole hydroxy amide #8; APHA 8; APHA8. Grade: ≥98%. CAS No. 676599-90-9. Molecular formula: C16H16N2O3. Mole weight: 284.3. BOC Sciences 6
APHE-2 APHE-2 is a pyrazoloisoquinolinone antibiotic produced by Streptoverticillium griseocarneum. It has weak anti-Gram-positive bacteria activity. Synonyms: 1H-Indole, 3-(2-propyl-5-oxazolyl)-; WS-30581A. CAS No. 93773-64-9. Molecular formula: C14H14N2O. Mole weight: 226.27. BOC Sciences 12
APHE-3 APHE-3 is a pyrazoloisoquinolinone antibiotic produced by Streptoverticillium griseocarneum. It has weak anti-Gram-positive bacteria activity. APHE-3 can also inhibit lymphocyte proliferation in the presence of Phytohemagglutinin, with IC50 of about 0.1 mmol/L. Synonyms: Pimprinine; WS 30581C. Grade: >95% by HPLC. CAS No. 13640-26-1. Molecular formula: C12H10N2O. Mole weight: 198.22. BOC Sciences
APHE-4 APHE-4 is a pyrazoloisoquinolinone antibiotic produced by Streptoverticillium griseocarneum. It has weak anti-Gram-positive bacteria activity. Synonyms: WS 30581B. CAS No. 93773-63-8. Molecular formula: C15H16N2O. Mole weight: 240.30. BOC Sciences 12
a-Phenyl-a-(2-pyridyl)acetonitrile a-Phenyl-a-(2-pyridyl)acetonitrile. Group: Biochemicals. Alternative Names: a-Phenyl-2-pyridineacetonitrile; 2-Pyridyl phenyl acetonitri le; NSC 16276. Grades: Highly Purified. CAS No. 5005-36-7. Pack Sizes: 500mg, 1g, 2g, 5g, 10g. Molecular Formula: C13H10N2. US Biological Life Sciences. USBiological 8
Worldwide
a-Phenyllactic acid 99+% a-Phenyllactic acid 99+%. Group: Biochemicals. Grades: Reagent Grade. CAS No. 515-30-0. Pack Sizes: 1g, 5g, 25g. US Biological Life Sciences. USBiological 4
Worldwide
a-Phenylpiperidine-2-acetamide ≥97% (HPLC) a-Phenylpiperidine-2-acetamide ≥97% (HPLC). Group: Biochemicals. Grades: Reagent Grade. Pack Sizes: 1g, 5g, 25g. US Biological Life Sciences. USBiological 4
Worldwide
a-Phenyl-trans-cinnamamide Crystalline. CAS No. 20432-29-5. Pack Sizes: 1g. Product ID: FR-0594. M.P. 127. Mole weight: 223.28. Frinton Laboratories Inc
Frinton Laboratories
a-Phenyl-trans-cinnamic acid White powder, 98%. Synonyms: trans-2,3-Diphenylpropionic acid. CAS No. 91-48-5. Pack Sizes: 25g, 100g. Product ID: FR-0253. M.P. 170-171. Mole weight: 224.26. Frinton Laboratories Inc
Frinton Laboratories
Aphermate Aphermate. Uses: Designed for use in research and industrial production. Additional or Alternative Names: alpha,3,3-trimethyl-cyclohexanemethanoformate;Cyclohexanemethanol. alpha.-3,3-trimethyl-,formate;APHERMATE;CYCLOHEXANE-1-METHANOL, ALPHA, 3,3-TRIMETHYL:FORMATE;alpha,3,3-trimethylcyclohexylmethyl formate;l-Cyclocitronelleneformate;alpha,3,3-Trimethylcycl. Product Category: Heterocyclic Organic Compound. CAS No. 25225-08-5. Molecular formula: C11H20O2. Mole weight: 184.28. Purity: 0.96. IUPACName: 1-(3,3-dimethylcyclohexyl)ethyl formate. Canonical SMILES: CC(C1CCCC(C1)(C)C)OC=O. Density: 0.918g/cm³. ECNumber: 246-735-2. Product ID: ACM25225085. Alfa Chemistry — ISO 9001:2015 Certified. Categories: Aphera tessellata. Alfa Chemistry. 3
aphidicolan-16β-ol synthase This is a bifunctional enzyme which also has EC 5.5.1.14 syn-copalyl diphosphate synthase activity. Aphidicolan-16β-ol is a precursor of aphidicolin, a specific inhibitor of DNA polymerase α (EC 2.7.7.7). Group: Enzymes. Synonyms: PbACS. Enzyme Commission Number: EC 4.2.3.42. Storage: Store it at +4 ?C for short term. For long term storage, store it at -20 ?C?-80 ?C. Form: Liquid or lyophilized powder. EXWM-5201; aphidicolan-16β-ol synthase; EC 4.2.3.42; PbACS. Cat No: EXWM-5201. Creative Enzymes
Aphidicolin analytical standard. Group: Application areas. Alfa Chemistry Analytical Products 4
Aphidicolin Aphidicolin is an inhibitor of DNA polymerase α and δ, prevents mitotic cell division by interfering DNA polymerase activity. Aphidicolin is an antibiotic produced by mold Cephalosporium aphidicola , inhibits cellular deoxyribonucleic acid synthesis and the growth of herpes simplex virus. Aphidicolin exhibits anti-orthopoxvirus activity and potentiates apoptosis induced by arabinosyl nucleosides in a human promyelocytic leukemia cell line [1] [2] [3]. Uses: Scientific research. Group: Natural products. CAS No. 38966-21-1. Pack Sizes: 10 mM * 1 mL; 1 mg; 5 mg; 10 mg; 25 mg; 50 mg. Product ID: HY-N6733. MedChemExpress MCE
Aphidicolin Aphidicolin is an inhibitor of DNA polymerase α and δ, prevents mitotic cell division by interfering DNA polymerase activity. Aphidicolin is an antibiotic produced by mold Cephalosporium aphidicola, inhibits cellular deoxyribonucleic acid synthesis and the growth of herpes simplex virus. Aphidicolin exhibits anti-orthopoxvirus activity and potentiates apoptosis induced by arabinosyl nucleosides in a human promyelocytic leukemia cell line. Uses: Designed for use in research and industrial production. Product Category: Inhibitors. Appearance: Solid. CAS No. 38966-21-1. Molecular formula: C20H34O4. Mole weight: 338.48. Purity: ≥99.0%. Canonical SMILES: C[C@@]12[C@]34[C@](CC[C@@]1([H])[C@@](C)([C@H](O)CC2)CO)([H])C[C@]([C@](CO)(O)CC4)([H])C3. Product ID: ACM38966211. Alfa Chemistry — ISO 9001:2015 Certified. Alfa Chemistry.
Aphidicolin Aphidicolin is an antibiotic produced by Cephalosporium aphidicola and Nigrospora sphaerica, which has the effect of inhibiting mitosis and anti-DNA virus. Aphidicolin potentiates apoptosis induced by arabinosyl nucleosides in a human promyelocytic leukemia cell line. Uses: A reversible inhibitor of eukaryotic nuclear dna replication. Synonyms: (+)-Aphidicolin; (3R,4R,4aR,6aS,8R,9R,11aS,11bS)-4,9-bis(hydroxymethyl)-4,11b-dimethyltetradecahydro-8,11a-methanocyclohepta[a]naphthalene-3,9-diol. Grade: >98%. CAS No. 38966-21-1. Molecular formula: C20H34O4. Mole weight: 338.48. BOC Sciences
Aphidicolin-17-monoacetate Aphidicolin-17-monoacetate is an antibiotic produced by Phoma betae PS-13, which inhibits DNA polymerase and interferes with root growth. Molecular formula: C22H36O5. Mole weight: 380.52. BOC Sciences 12
Aphidicolin-3,18-orthoacetate Aphidicolin-3,18-orthoacetate is an antibiotic produced by Phoma betae. It is a kind of phytotoxin, which can inhibit the growth of the roots of rice and mango. Molecular formula: C22H36O5. Mole weight: 380.52. BOC Sciences 12
Aphidicolin - CAS 38966-21-1 Aphidicolin, CAS 38966-21-1, is a cell-permeable antibiotic that acts as a cell synchronization agent. Blocks the cell cycle at early S-phase. Group: Fluorescence/luminescence spectroscopy. Alfa Chemistry Analytical Products
Aphidicolin from Nigrospora sphaerica ?98% (HPLC), powder. Group: Fluorescence/luminescence spectroscopy. Alfa Chemistry Analytical Products
APHS APHS is a specific and covalent COX-2 inhibitor with neuroprotective effects. COX-2 is a prostaglandin (PG) synthetase overexpressed in colorectal cancer (CRC) and has pleiotropic cancer-promoting effects. APHS modifies COX-2 by acetylating the active site (serine 516), thereby inhibiting prostaglandin production. The neuroprotective activity of APHS is inhibited by prostaglandin E2. APHS also co-inhibits the WNT pathway, an anti-tumor mechanism in addition to COX-2 inhibition [1] [2]. Uses: Scientific research. Group: Signaling pathways. CAS No. 209125-28-0. Pack Sizes: 1 mg (38.11 mM * 100 μL in Methyl acetate); 5 mg (38.11 mM * 500 μL in Methyl acetate); 10 mg (38.11 mM * 1 mL in Methyl acetate). Product ID: HY-129284. MedChemExpress MCE
Aphthosin Aphthosin is a tetrapeptide glycoside isolated from Peltigera aphthosa (L.) Willd. Synonyms: 2,6-Cresotic acid, 4-methoxy-, 4-ester with 6-methyl-β-resorcylic acid, 4-ester with 6-methyl-β-resorcylic acid, 4-ester with methyl 6-methyl-β-resorcylate (8CI). CAS No. 31449-13-5. Molecular formula: C34H30O13. Mole weight: 646.59. BOC Sciences 12
API-1 Akt/protein kinase B (PKB) inhibitor. Binds the pleckstrin homology domain of Akt and blocks Akt membrane translocation. Inhibits EGF-induced kinase activity of Akt1, Akt2 and Akt3. Induces cell growt h arrest and apoptosis in human cancer cells expressing constitutively active Akt. Synonyms: API 1; API1; NSC177233; NSC 177233; NSC-177233; 4-Amino-5,6,7,8-tetrahydro-5-oxo-8-(beta-D-ribofuranosyl)pyrido[2,3-d]pyrimidine-6-carboxamide. Grade: >98%. CAS No. 36707-00-3. Molecular formula: C28H30FN5O2. Mole weight: 337.29. BOC Sciences 6
API-1 API-1. Group: Biochemicals. Grades: Purified. CAS No. 36707-00-3. Pack Sizes: 10mg. US Biological Life Sciences. USBiological 5
Worldwide
API-2 API-2. Group: Biochemicals. Grades: Purified. CAS No. 35943-35-2. Pack Sizes: 10mg. US Biological Life Sciences. USBiological 5
Worldwide
Apicidin Apicidin (OSI 2040) is a fungal metabolite, acts as an orally active histone deacetylase 7/8 ( HDAC7/8 ) inhibitor, with antiparasitic activity and a broad spectrum antiproliferative activity. Apicidin can be used for cancer research [1] [2] [3] [4]. Uses: Scientific research. Group: Natural products. Alternative Names: OSI 2040. CAS No. 183506-66-3. Pack Sizes: 1 mg; 5 mg. Product ID: HY-N6735. MedChemExpress MCE
Apicidin Apicidin is a cyclic peptide antibiotic with broad-spectrum antiproliferative, antiparasitic and antiprotozoan activity. It is a histone deacetylase (HDAC) inhibitor with anti-angiogenesis and apoptosis-inducing effects. Synonyms: OSI 2040; Cyclo[(2S)-2-amino-8-oxodecanoyl-1-methoxy-L-tryptophyl-L-isoleucyl-(2R)-2-piperidinecarbonyl]; Cyclo(8-oxo-L-2-aminodecanoyl-1-methoxy-L-tryptophyl-L-isoleucyl-D-2-piperidinecarbonyl); Apicidin Ia; 2H-Pyrido[1,2-a][1,4,7,10]tetraazacyclododecine-1,4,7,10(3H,12H)-tetrone, octahydro-6-[(1-methoxy-1H-indol-3-yl)methyl]-9-[(1S)-1-methylpropyl]-3-(6-oxooctyl)-, (3S,6S,9S,15aR)-. Grade: >98%. CAS No. 183506-66-3. Molecular formula: C34H49N5O6. Mole weight: 623.78. BOC Sciences
Apicidin ?98% (HPLC), from microbial. Group: Fluorescence/luminescence spectroscopy. Alfa Chemistry Analytical Products 2
Apicidin Apicidin is a cyclic peptide antibiotic with broad spectrum antiparasitic and antiprotozoan activity. Apicidin, a histone deacetylase inhibitor, is anti-angiogenic and induces apoptosis. A potent, cell permeable inhibitor of histone deacetylase (IC50 = 700 pM for parasitic histone deacetylase). Inhibits HeLa cell proliferation (IC50 = 50 - 100 nM) and induces the transcriptional activation of p21 (WAF1) in a reversible manner. Also prevents H-ras-induced invasive phenotype of MCF-10A cells possibly by down regulating MMP-2 in a reversible manner. Apicidin has antiproliferative activity on HeLa cells accompanied by cell arrest at the G1 phase. Apicidin induces selective changes in the expression of p21 and gelsolin. Group: Biochemicals. Alternative Names: Cyclo[(2S)-2-amino-8-oxodecanoyl-1-methoxy-L-tryptophyl-L-isoleucyl-(2R)-2-piperidinecarbonyl]; Cyclo(8-oxo-L-2-aminodecanoyl-1-methoxy-L-tryptophyl-L-isoleucyl-D-2-piperidinecarbonyl); Apicidin Ia; OSI 2040. Grades: Highly Purified. CAS No. 183506-66-3. Pack Sizes: 2mg. US Biological Life Sciences. USBiological 1
Worldwide
Apicidin, Fusarium sp. A potent, cell-permeable inhibitor of histone deacetylase (IC??= 700 pM for parasitic histone deactetylase) that also exibits antiprotozoal and potential anti-malarial properties. Group: Fluorescence/luminescence spectroscopy. Alfa Chemistry Analytical Products 3
Apicidin, HDAC Inhibitor (Cyclo- N-O-methyl-L-tryptophanyl-Lisoleucinyl- Dpipecolinyl- L-2-amino-8-oxodecanoyl) Cyclopeptide inhibitor of histone deactylases (HDACs). Inhibits HeLa cell proliferation (IC50=50-. Group: Biochemicals. Alternative Names: Cyclo- N-O-methyl-L-tryptophanyl-Lisoleucinyl- Dpipecolinyl- L-2-amino-8-oxodecanoyl. Grades: Highly Purified. CAS No. 183506-66-3. Pack Sizes: 1mg, 5mg. US Biological Life Sciences. USBiological 3
Worldwide
Apicularen A Apicularen A is a macrolide antibiotic produced by Chondromyces robustus Cma 13. Apicularen A has no antibacterial activity, but for human and animal tumor cells such as KB-3-1, KB-V1, K-562, HL-60, U-937, A-498, A-549, PC-3 and SK-OV -3 grade has strong cytotoxicity. CAS No. 220757-04-0. Molecular formula: C25H31NO6. Mole weight: 441.52. BOC Sciences 12
Apicularen B Apicularen B is a macrolide antibiotic produced by Chondromyces robustus Cma 13. Apicularen B has low cytotoxicity and weak anti-Gram-positive bacteria activity. CAS No. 220757-06-2. Molecular formula: C33H44N2O11. Mole weight: 644.71. BOC Sciences 12
Apidaecin IB acetate Apidaecin IB acetate is an insect antimicrobial peptide with a minimum concentration of 8 μM against Escherichia coli (E. coli ML35, o18k1h7 and ATCC 25922). Synonyms: H-Gly-Asn-Asn-Arg-Pro-Val-Tyr-Ile-Pro-Gln-Pro-Arg-Pro-Pro-His-Pro-Arg-Leu-OH.CH3CO2H; glycyl-L-asparagyl-L-asparagyl-L-arginyl-L-prolyl-L-valyl-L-tyrosyl-L-isoleucyl-L-prolyl-L-glutaminyl-L-prolyl-L-arginyl-L-prolyl-L-prolyl-L-histidyl-L-prolyl-L-arginyl-L-leucine acetic acid; 18-L-leucine-Apidaecin Ia acetate; Apidaecin Ib acetate. Grade: ≥95%. Molecular formula: C97H154N32O25. Mole weight: 2168.46. BOC Sciences 9
Apigenin Apigenin - Product ID: NST-10-78. Category: Flavonoids. Alternative Names: Baicalein-7-O-glucuronide. Purity: 98%. Test method: HPLC. CAS No. 520-36-5. Pack Sizes: 10g, 20g, 50g, 100g. Appearance: Yellow Powder. Molecular formula: C15H10O5. Mole weight: 270.24. Storage: +2 … +8 °C. NATURE SCIENCE TECHNOLOGIES
Apigenin United States Pharmacopeia (USP) Reference Standard. Group: Pharmacopeia & metrological institutes standardsfood additives, flavours & adulterants. Alternative Names: 5,7-Dihydroxy-2-(4-hydroxyphenyl)-4H-1-benzopyran-4-one, 4',5,7-Trihydroxyflavone, Pelargidenon 1449. Alfa Chemistry Analytical Products 4
Apigenin Apigenin. CAS No. 520-36-5. Product ID: PE-0323. Category: Active Pharmaceutical Ingredient. Product Keywords: Pharmaceutical Excipients; Other Materials; Active Pharmaceutical Ingredient; /; Apigenin; PE-0323; 520-36-5; 520-36-5. Grade: Pharmaceutical Grade. CD Formulation
Apigenin Apigenin. Group: Biochemicals. Grades: Purified. CAS No. 520-36-5. Pack Sizes: 10mg, 50mg. US Biological Life Sciences. USBiological 5
Worldwide
Apigenin Apigenin is a trihydroxyflavone that is flavone substituted by hydroxy groups at positions 4', 5 and 7. It induces autophagy in leukaemia cells. It has a role as a metabolite and an antineoplastic agent. It is a conjugate acid of an apigenin-7-olate. Alternative Names: 5,7-Dihydroxy-2-(4-hydroxyphenyl)-4H-chromen-4-one. Apigenol. Versulin. CAS No. 520-36-5. Product ID: PIPE-0556. Molecular formula: C15H10O5. Mole weight: 270.24. EINECS: 208-292-3. SMILES: C1=CC(=CC=C1C2=CC(=O)C3=C(C=C(C=C3O2)O)O)O. Appearance: Yellow needles from aqueous pyridine. Category: Natural Extract. Protheragen
Apigenin Apigenin (4',5,7-Trihydroxyflavone) is a competitive CYP2C9 inhibitor with a K i of 2 μM. Uses: Scientific research. Group: Natural products. Alternative Names: 4',5,7-Trihydroxyflavone; Apigenol; C.I. Natural Yellow 1. CAS No. 520-36-5. Pack Sizes: 10 mM * 1 mL; 5 mg; 10 mg; 50 mg; 100 mg; 200 mg; 500 mg. Product ID: HY-N1201. MedChemExpress MCE
Apigenin 1g Pack Size. Group: Aroma Chemicals, Building Blocks, Organics. Formula: C15H10O5. CAS No. 520-36-5. Prepack ID 22930039-1g. Molecular Weight 270.24. See USA prepack pricing. Molekula Americas
Apigenin (4',5,7-Trihydroxyflavone) Induces the reversion of transformed phenotypes of v-H-ras-transformed NIH 3T3 cells at low concentration (12.5 uM) by inhibiting MAP kinase activity. Also inhibits the proliferation of malignan. Group: Biochemicals. Alternative Names: 4',5,7-Trihydroxyflavone. Grades: Highly Purified. Pack Sizes: 100mg. US Biological Life Sciences. USBiological 1
Worldwide
Apigenin 4'-β-D-glucuronide Triacetate Methyl Ester Apigenin 4'-β-D-glucuronide Triacetate Methyl Ester is an intermediate in synthesizing Isorhoifolin, a naturally occurring flavonoid that was shown to exhibit potential antidiabetic, antihyperlipidemic and antioxidant effects. Synonyms: Apigenin 4'-β-D-Gucopyranoside Triacetate Methyl Ester. Molecular formula: C28H28O14. Mole weight: 588.51. BOC Sciences 6
Apigenin 4'-O- β-D-Glucuronide Flavone component of the aerial parts of alfalfa (Medicago sativa L.) and pyrethrum flowers (Chrysanthemum cinerarifolium). Apigenin 4'-O- β-D-Glucuronide can be utilized for food or feed use and biological study of chemical composition of protein-xanthophyll concentrate dietary supplement made from alfalfa. Group: Biochemicals. Grades: Highly Purified. CAS No. 51771-57-4. Pack Sizes: 1mg, 5mg. Molecular Formula: C21H18O11, Molecular Weight: 446.36. US Biological Life Sciences. USBiological 2
Worldwide
apigenin 4'-O-methyltransferase Converts apigenin into acacetin. Naringenin can also act as an acceptor, but more slowly. Group: Enzymes. Synonyms: flavonoid O-methyltransferase; flavonoid methyltransferase; S-adenosyl-L-methionine:5,7,4'-trihydroxyflavone 4'-O-methyltransferase. Enzyme Commission Number: EC 2.1.1.75. CAS No. 118251-36-8. Storage: Store it at +4 ?C for short term. For long term storage, store it at -20 ?C?-80 ?C. Form: Liquid or lyophilized powder. EXWM-1976; apigenin 4'-O-methyltransferase; EC 2.1.1.75; 118251-36-8; flavonoid O-methyltransferase; flavonoid methyltransferase; S-adenosyl-L-methionine:5,7,4'-trihydroxyflavone 4'-O-methyltransferase. Cat No: EXWM-1976. Creative Enzymes
Apigenin-4'-O-sulfate Potassium Salt Apigenin-4'-O-sulfate Potassium Salt is a sulfated form of Apigenin (A726500) flavone, present in numerous plant species. Group: Biochemicals. Grades: Highly Purified. CAS No. 120537-28-2. Pack Sizes: 1mg, 5mg. Molecular Formula: C15H9KO8S, Molecular Weight: 388.39. US Biological Life Sciences. USBiological 5
Worldwide
Apigenin 6,8-di-C-glucoside Vicenin -2 might be a useful lead for the development of multiple target-oriented therapeutic modalities for the treatment of diabetes and diabetes-associated complications. Synonyms: Vicenin II; Vicenin 2; Violantin. Grade: >98%. CAS No. 23666-13-9. Molecular formula: C27H30O15. Mole weight: 594.5. BOC Sciences 8
Apigenin 6-C-α-L-arabinopyranosyl-8-C- β-D-xylopyranoside Apigenin 6-C-α-L-arabinopyranosyl-8-C- β-D-xylopyranoside. Group: Biochemicals. CAS No. 677021-30-6. Pack Sizes: 5mg. US Biological Life Sciences. USBiological 9
Worldwide
Apigenin 6-glucosyl-7-O-methyl ether Apigenin 6-glucosyl-7-O-methyl ether. Uses: Designed for use in research and industrial production. Additional or Alternative Names: SWERTISIN;APIGENIN 6-GLUCOSYL-7-O-METHYL ETHER;4',5-Dihydroxy-7-methoxy-6-β-D-glucopyranosylflavone;6-(β-D-Glucopyranosyl)-5-hydroxy-2-(4-hydroxyphenyl)-7-methoxy-4H-1-benzopyran-4-one. Product Category: Heterocyclic Organic Compound. CAS No. 6991-10-2. Molecular formula: C22H22O11. Mole weight: 462.4. Product ID: ACM6991102. Alfa Chemistry — ISO 9001:2015 Certified. Alfa Chemistry. 4
Apigenin 7-β-D-glucuronide Triacetate Methyl Ester Apigenin 7-β-D-glucuronide Triacetate Methyl Ester is an intermediate in synthesizing Isorhoifolin, a naturally occurring flavonoid that was shown to exhibit potential antidiabetic, antihyperlipidemic and antioxidant effects. Synonyms: Apigenin 7-β-D-Gucopyranoside Triacetate Methyl Ester. Molecular formula: C28H28O14. Mole weight: 588.51. BOC Sciences 6
Apigenin 7- β-D-Gucopyranoside Triacetate Methyl Ester Apigenin 7- β-D-Gucopyranoside Triacetate Methyl Ester is an intermediate in synthesizing Isorhoifolin (I819700), a naturally occurring flavonoid that was shown to exhibit potential antidiabetic, antihyperlipidemic and antioxidant effects. Group: Biochemicals. Grades: Highly Purified. Pack Sizes: 50mg, 100mg. Molecular Formula: C28H28O14, Molecular Weight: 588.51. US Biological Life Sciences. USBiological 1
Worldwide

Would you like to list your products on USA Chemical Suppliers?

Our database is helping our users find suppliers everyday.

Add Your Products