A directory of where to buy chemicals in the USA, including: distributors, industrial manufacturers, bulk supplies and wholesalers of raw ingredients & finished goods.
Apelin-13 trifluoroacetate salt is the endogenous ligand of the APJ receptor, activating this G protein-coupled receptor with an EC50 value of 0.37 nM. Synonyms: Apelin-13 triTFA. Molecular formula: C75H114F9N23O22S. Mole weight: 1892.89.
Apelin-17 (human, bovine)
Apelin-17 (human, bovine). Group: Biochemicals. Grades: Purified. CAS No. 217082-57-0. Pack Sizes: 1mg. US Biological Life Sciences.
Worldwide
Apelin-17(human, bovine)
Apelin-17(human, bovine) is an endogenous orphan G protein-coupled receptor APJ agonist. Apelin-17(human, bovine) binds to human APJ receptors expressed in HEK 293 cells (pIC50=9.02). Apelin-17(human, bovine) inhibits the entry of some HIV-1 and HIV-2 into the NP2/CD4 cells expressing APJ[1][2][3]. Uses: Scientific research. Group: Peptides. CAS No. 217082-57-0. Pack Sizes: 1 mg; 5 mg. Product ID: HY-P1066.
Apelin-17 (Human, Bovine)
Apelin-17 (human, bovine) is an endogenous ligand of the G protein-coupled APJ receptor with EC50 value of 2.5 nM that is secreted by adipocytes. It potently inhibits forskolin-stimulated cAMP production in vitro. Synonyms: [Phe17]-Apelin 17. Grade: 98.86%. CAS No. 217082-57-0. Molecular formula: C96H156N34O20S. Mole weight: 2138.56.
Apelin-17 (human, bovine) acetate
Apelin-17 (human, bovine) acetate, secreted by adipocytes, is an endogenous ligand of the G protein-coupled APJ receptor with an EC50 of 2.5 nM. It is an endogenous apelin receptor agonist that potently inhibits forskolin-stimulated cAMP production in vitro. Synonyms: H-Lys-Phe-Arg-Arg-Gln-Arg-Pro-Arg-Leu-Ser-His-Lys-Gly-Pro-Met-Pro-Phe-OH.CH3CO2H; L-lysyl-L-phenylalanyl-L-arginyl-L-arginyl-L-glutaminyl-L-arginyl-L-prolyl-L-arginyl-L-leucyl-L-seryl-L-histidyl-L-lysyl-glycyl-L-prolyl-L-methionyl-L-prolyl-L-phenylalanine acetic acid. Grade: ≥95%. Molecular formula: C98H160N34O22S. Mole weight: 2198.63.
Apelin-36 (human)
Apelin-36 (human) is an endogenous ligand of the G protein-coupled APJ receptor with EC50 value of 20 nM that is secreted by adipocytes. It is the full-length mature peptide produced from the translated 77 amino acid prepropeptide. It acts primarily in the central nervous and peripheral system. It is important in regulating fluid homeostasis, cardiovascular function, insulin and hypertension sensitivity. It potently blocks HIV-1 and HIV-2 strains entry into cells expressing APJ and CD4 and limits HIV infection. It endogenously binds with high affinity to human APJ receptors expressed in HEK 293 cells. Synonyms: H-Leu-Val-Gln-Pro-Arg-Gly-Ser-Arg-Asn-Gly-Pro-Gly-Pro-Trp-Gln-Gly-Gly-Arg-Arg-Lys-Phe-Arg-Arg-Gln-Arg-Pro-Arg-Leu-Ser-His-Lys-Gly-Pro-Met-Pro-Phe-OH; L-leucyl-L-valyl-L-glutaminyl-L-prolyl-L-arginyl-glycyl-L-seryl-L-arginyl-L-asparagyl-glycyl-L-prolyl-glycyl-L-prolyl-L-tryptophyl-L-glutaminyl-glycyl-glycyl-L-arginyl-L-arginyl-L-lysyl-L-phenylalanyl-L-arginyl-L-arginyl-L-glutaminyl-L-arginyl-L-prolyl-L-arginyl-L-leucyl-L-seryl-L-histidyl-L-lysyl-glycyl-L-prolyl-L-methionyl-L-prolyl-L-phenylalanine. Grade: ≥95% by HPLC. CAS No. 252642-12-9. Molecular formula: C184H297N69O43S. Mole weight: 4195.87.
Apelin-36 (human)
Endogenous APJ receptor agonist (EC50 = 20 nM) that is secreted by adipocytes. Binds with high affinity to human APJ receptors expressed in HEK 293 cells (pIC50= 8.61). Involved in regulation of cardiovascular function, fluid homeostasis and feeding. Blocks entry of some HIV-1 and HIV-2 strains into NP-2/CD4 cells expressing APJ. Group: Biochemicals. Grades: Highly Purified. CAS No. 252642-12-9. Pack Sizes: 1mg. Molecular Formula: C184H297N69O43S, Mass Spectrum: Consistent with structure. US Biological Life Sciences.
Worldwide
Apelin-36(human)
Apelin-36(human) is an endogenous orphan G protein-coupled receptor APJ agonist, with an EC50 of 20 nM. Apelin-36(human) shows high affinity to human APJ receptors expressed in HEK 293 cells (pIC50=8.61). Apelin-36 has been linked to two major types of biological activities: cardiovascular and metabolic. Apelin-36(human) inhibits the entry of some HIV-1 and HIV-2 into the NP2/CD4 cells expressing APJ. Uses: Designed for use in research and industrial production. Additional or Alternative Names: LVQPRGSRNGPGPWQGGRRKFRRQRPRLSHKGPMPF;H-LEU-VAL-GLN-PRO-ARG-GLY-SER-ARG-ASN-GLY-PRO-GLY-PRO-TRP-GLN-GLY-GLY-ARG-ARG-LYS-PHE-ARG-ARG-GLN-ARG-PRO-ARG-LEU-SER-HIS-LYS-GLY-PRO-MET-PRO-PHE-OH;LEU-VAL-GLN-PRO-ARG-GLY-SER-ARG-ASN-GLY-PRO-GLY-PRO-TRP-GLN-GLY-GLY-. Product Category: Inhibitors. CAS No. 252642-12-9. Molecular formula: C184H297N69O43S. Purity: 0.9811. Product ID: ACM252642129. Alfa Chemistry ISO 9001:2015 Certified. Categories: Apelin-36 (human).
Apelin-36(human)
Apelin-36(human) is an endogenous orphan G protein-coupled receptor APJ agonist, with an EC 50 of 20 nM. Apelin-36(human) shows high affinity to human APJ receptors expressed in HEK 293 cells (pIC 50 =8.61). Apelin-36 has been linked to two major types of biological activities: cardiovascular and metabolic. Apelin-36(human) inhibits the entry of some HIV-1 and HIV-2 into the NP2/CD4 cells expressing APJ [1] [2] [3] [4]. Uses: Scientific research. Group: Peptides. CAS No. 252642-12-9. Pack Sizes: 1 mg; 5 mg. Product ID: HY-P1064.
Apelin-36 (rat, mouse)
Apelin-36 (rat, mouse). Group: Biochemicals. Grades: Purified. CAS No. 230299-95-3. Pack Sizes: 1mg. US Biological Life Sciences.
Worldwide
Apelin-36 (rat, mouse)
Apelin-36 (rat, mouse) is an endogenous ligand of the G protein-coupled APJ receptor with EC50 value of 5.4 nM that is secreted by adipocytes. It potently inhibits cAMP production in vitro. It is important in regulating fluid homeostasis, cardiovascular function and feeding. It potently blocks HIV-1 and HIV-2 strains entry into cells expressing APJ and CD4 and limits HIV infection. Synonyms: Apelin-36 (rat, mouse); Apelin 36 (rat, mouse); Apelin36 (rat, mouse). Grade: 95%. CAS No. 230299-95-3. Molecular formula: C185H304N68O43S. Mole weight: 4200.93.
a-Pentylcinnamaldehyde diethyl acetal
a-Pentylcinnamaldehyde diethyl acetal. Group: Biochemicals. Grades: Highly Purified. CAS No. 60763-41-9. Pack Sizes: 100mg, 250mg, 500mg. Molecular Formula: C18H28O2. US Biological Life Sciences.
Worldwide
APETx2
APETx2, an ion channel 3 (ASIC3) channel blocker, has been found to exhibit analgesic properties against acid-induced and inflammatory pain. Synonyms: APETx2; 713544-47-9; AKOS024458355; H-Gly-DL-xiThr-DL-Ala-DL-Cys(1)-DL-Ser-DL-Cys(2)-Gly-DL-Asn-DL-Ser-DL-Lys-Gly-DL-xiIle-DL-Tyr-DL-Trp-DL-Phe-DL-Tyr-DL-Arg-DL-Pro-DL-Ser-DL-Cys(3)-DL-Pro-DL-xiThr-DL-Asp-DL-Arg-Gly-DL-Tyr-DL-xiThr-Gly-DL-Ser-DL-Cys(2)-DL-Arg-DL-Tyr-DL-Phe-DL-Leu-Gly-DL-xiThr-DL-Cys(1)-DL-Cys(3)-DL-xiThr-DL-Pro-DL-Ala-DL-Asp-OH. Grade: >98%. CAS No. 713544-47-9. Molecular formula: C196H280N54O61S6. Mole weight: 4561.06.
APETx2
APETx2. Group: Biochemicals. Grades: Purified. CAS No. 713544-47-9. Pack Sizes: 100ug. US Biological Life Sciences.
Worldwide
APF
APF is a fluorescence probe that can selectively, and dose dependently detect certain species among ROS and that are highly resistant to autoxidation. APF can be used in enzymatic and cellular systems [1]. Uses: Scientific research. Group: Fluorescent dye. CAS No. 359010-70-1. Pack Sizes: 500 μg (11.81 mM * 100 μL in Methyl acetate). Product ID: HY-119977.
APF Sialoglycopeptide ammonium salt
APF Sialoglycopeptide ammonium salt is a cutting-edge biomedical compound, demonstrating remarkable capabilities in research of dental caries. Proven to possess potent antimicrobial properties against the notorious Streptococcus mutans, this compound also exhibits an extraordinary affinity for hydroxyapatite, amplifying the process of tooth remineralization. Synonyms: O-(Acetamido-3,5-dideoxy-D-glycero-a-D-galacto-2-nonulopyranosylonic acid)-(2→3)-O-b-D- galactopyranosyl-(1→3)-O-a-2-acetamido-2-deoxy-D-galactopyranosyl-(1 →O)- Thr-Val-Pro-Ala-Ala-Val-Val-Val-Ala; NeuNAc-a(2→3)-Gal-b(1→3)-GalNAc-a-Thr-Val-Pro-Ala-Ala-Val-Val-Val-Ala. Molecular formula: C63H107N11O29. Mole weight: 1482.58.
ApG
ApG is a scientifically advanced compound, specifically designed to study inflammatory skin disorders as well as combat skin infections. It comprises a potent blend of bioactive drugs exhibiting exceptional antimicrobial and anti-inflammatory attributes. Grade: ≥ 95% by HPLC. Molecular formula: C20H25N10O11P (free acid). Mole weight: 612.14 (free acid).
APG-1387
APG-1387 is an inhibitor of IAPs. Study shows that APG-1387 could induce apoptosis of PLC/PRF/5 which was HBV positive both in vitro and in vivo. Synonyms: APG 1387; APG1387. Grade: 98% by HPLC. CAS No. 1570231-89-8. Molecular formula: C60H72N10O10S2. Mole weight: 1157.4.
APG-2449
APG-2449 is an orally active ALK/ROS1/FAK inhibitor. APG-2449 shows antitumor activity in mouse models of non-small cell lung cancer (NSCLC) [1]. Uses: Scientific research. Group: Signaling pathways. CAS No. 2196186-84-0. Pack Sizes: 10 mM * 1 mL; 5 mg; 10 mg; 25 mg; 50 mg; 100 mg. Product ID: HY-155163.
APHA Compound 8
APHA Compound 8 is a synthetic HDAC (histone deacetylase) inhibitor, which is in the same structural class as SAHA. The IC50 for mouse HDAC1 is 0.5 μM. It induces histone hyperacetylation, growth inhibition, and terminal cell differentiation. Synonyms: MC-1353; MC1353; MC 1353; APHA-8; APHA Compound 8; Aroyl pyrrole hydroxy amide #8; APHA 8; APHA8. Grade: ≥98%. CAS No. 676599-90-9. Molecular formula: C16H16N2O3. Mole weight: 284.3.
APHE-2 is a pyrazoloisoquinolinone antibiotic produced by Streptoverticillium griseocarneum. It has weak anti-Gram-positive bacteria activity. Synonyms: 1H-Indole, 3-(2-propyl-5-oxazolyl)-; WS-30581A. CAS No. 93773-64-9. Molecular formula: C14H14N2O. Mole weight: 226.27.
APHE-3
APHE-3 is a pyrazoloisoquinolinone antibiotic produced by Streptoverticillium griseocarneum. It has weak anti-Gram-positive bacteria activity. APHE-3 can also inhibit lymphocyte proliferation in the presence of Phytohemagglutinin, with IC50 of about 0.1 mmol/L. Synonyms: Pimprinine; WS 30581C. Grade: >95% by HPLC. CAS No. 13640-26-1. Molecular formula: C12H10N2O. Mole weight: 198.22.
APHE-4
APHE-4 is a pyrazoloisoquinolinone antibiotic produced by Streptoverticillium griseocarneum. It has weak anti-Gram-positive bacteria activity. Synonyms: WS 30581B. CAS No. 93773-63-8. Molecular formula: C15H16N2O. Mole weight: 240.30.
a-Phenyl-a-(2-pyridyl)acetonitrile
a-Phenyl-a-(2-pyridyl)acetonitrile. Group: Biochemicals. Alternative Names: a-Phenyl-2-pyridineacetonitrile; 2-Pyridyl phenyl acetonitri le; NSC 16276. Grades: Highly Purified. CAS No. 5005-36-7. Pack Sizes: 500mg, 1g, 2g, 5g, 10g. Molecular Formula: C13H10N2. US Biological Life Sciences.
Worldwide
a-Phenyllactic acid 99+%
a-Phenyllactic acid 99+%. Group: Biochemicals. Grades: Reagent Grade. CAS No. 515-30-0. Pack Sizes: 1g, 5g, 25g. US Biological Life Sciences.
Worldwide
a-Phenylpiperidine-2-acetamide ≥97% (HPLC)
a-Phenylpiperidine-2-acetamide ≥97% (HPLC). Group: Biochemicals. Grades: Reagent Grade. Pack Sizes: 1g, 5g, 25g. US Biological Life Sciences.
Aphermate. Uses: Designed for use in research and industrial production. Additional or Alternative Names: alpha,3,3-trimethyl-cyclohexanemethanoformate;Cyclohexanemethanol. alpha.-3,3-trimethyl-,formate;APHERMATE;CYCLOHEXANE-1-METHANOL, ALPHA, 3,3-TRIMETHYL:FORMATE;alpha,3,3-trimethylcyclohexylmethyl formate;l-Cyclocitronelleneformate;alpha,3,3-Trimethylcycl. Product Category: Heterocyclic Organic Compound. CAS No. 25225-08-5. Molecular formula: C11H20O2. Mole weight: 184.28. Purity: 0.96. IUPACName: 1-(3,3-dimethylcyclohexyl)ethyl formate. Canonical SMILES: CC(C1CCCC(C1)(C)C)OC=O. Density: 0.918g/cm³. ECNumber: 246-735-2. Product ID: ACM25225085. Alfa Chemistry ISO 9001:2015 Certified. Categories: Aphera tessellata.
aphidicolan-16β-ol synthase
This is a bifunctional enzyme which also has EC 5.5.1.14 syn-copalyl diphosphate synthase activity. Aphidicolan-16β-ol is a precursor of aphidicolin, a specific inhibitor of DNA polymerase α (EC 2.7.7.7). Group: Enzymes. Synonyms: PbACS. Enzyme Commission Number: EC 4.2.3.42. Storage: Store it at +4 ?C for short term. For long term storage, store it at -20 ?C?-80 ?C. Form: Liquid or lyophilized powder. EXWM-5201; aphidicolan-16β-ol synthase; EC 4.2.3.42; PbACS. Cat No: EXWM-5201.
Aphidicolin
Aphidicolin is an inhibitor of DNA polymerase α and δ, prevents mitotic cell division by interfering DNA polymerase activity. Aphidicolin is an antibiotic produced by mold Cephalosporium aphidicola , inhibits cellular deoxyribonucleic acid synthesis and the growth of herpes simplex virus. Aphidicolin exhibits anti-orthopoxvirus activity and potentiates apoptosis induced by arabinosyl nucleosides in a human promyelocytic leukemia cell line [1] [2] [3]. Uses: Scientific research. Group: Natural products. CAS No. 38966-21-1. Pack Sizes: 10 mM * 1 mL; 1 mg; 5 mg; 10 mg; 25 mg; 50 mg. Product ID: HY-N6733.
Aphidicolin
Aphidicolin is an inhibitor of DNA polymerase α and δ, prevents mitotic cell division by interfering DNA polymerase activity. Aphidicolin is an antibiotic produced by mold Cephalosporium aphidicola, inhibits cellular deoxyribonucleic acid synthesis and the growth of herpes simplex virus. Aphidicolin exhibits anti-orthopoxvirus activity and potentiates apoptosis induced by arabinosyl nucleosides in a human promyelocytic leukemia cell line. Uses: Designed for use in research and industrial production. Product Category: Inhibitors. Appearance: Solid. CAS No. 38966-21-1. Molecular formula: C20H34O4. Mole weight: 338.48. Purity: ≥99.0%. Canonical SMILES: C[C@@]12[C@]34[C@](CC[C@@]1([H])[C@@](C)([C@H](O)CC2)CO)([H])C[C@]([C@](CO)(O)CC4)([H])C3. Product ID: ACM38966211. Alfa Chemistry ISO 9001:2015 Certified.
Aphidicolin
Aphidicolin is an antibiotic produced by Cephalosporium aphidicola and Nigrospora sphaerica, which has the effect of inhibiting mitosis and anti-DNA virus. Aphidicolin potentiates apoptosis induced by arabinosyl nucleosides in a human promyelocytic leukemia cell line. Uses: A reversible inhibitor of eukaryotic nuclear dna replication. Synonyms: (+)-Aphidicolin; (3R,4R,4aR,6aS,8R,9R,11aS,11bS)-4,9-bis(hydroxymethyl)-4,11b-dimethyltetradecahydro-8,11a-methanocyclohepta[a]naphthalene-3,9-diol. Grade: >98%. CAS No. 38966-21-1. Molecular formula: C20H34O4. Mole weight: 338.48.
Aphidicolin
analytical standard. Group: Application areas.
Aphidicolin-17-monoacetate
Aphidicolin-17-monoacetate is an antibiotic produced by Phoma betae PS-13, which inhibits DNA polymerase and interferes with root growth. Molecular formula: C22H36O5. Mole weight: 380.52.
Aphidicolin-3,18-orthoacetate
Aphidicolin-3,18-orthoacetate is an antibiotic produced by Phoma betae. It is a kind of phytotoxin, which can inhibit the growth of the roots of rice and mango. Molecular formula: C22H36O5. Mole weight: 380.52.
Aphidicolin - CAS 38966-21-1
Aphidicolin, CAS 38966-21-1, is a cell-permeable antibiotic that acts as a cell synchronization agent. Blocks the cell cycle at early S-phase. Group: Fluorescence/luminescence spectroscopy.
APHS is a specific and covalent COX-2 inhibitor with neuroprotective effects. COX-2 is a prostaglandin (PG) synthetase overexpressed in colorectal cancer (CRC) and has pleiotropic cancer-promoting effects. APHS modifies COX-2 by acetylating the active site (serine 516), thereby inhibiting prostaglandin production. The neuroprotective activity of APHS is inhibited by prostaglandin E2. APHS also co-inhibits the WNT pathway, an anti-tumor mechanism in addition to COX-2 inhibition [1] [2]. Uses: Scientific research. Group: Signaling pathways. CAS No. 209125-28-0. Pack Sizes: 1 mg (38.11 mM * 100 μL in Methyl acetate); 5 mg (38.11 mM * 500 μL in Methyl acetate); 10 mg (38.11 mM * 1 mL in Methyl acetate). Product ID: HY-129284.
Aphthosin
Aphthosin is a tetrapeptide glycoside isolated from Peltigera aphthosa (L.) Willd. Synonyms: 2,6-Cresotic acid, 4-methoxy-, 4-ester with 6-methyl-β-resorcylic acid, 4-ester with 6-methyl-β-resorcylic acid, 4-ester with methyl 6-methyl-β-resorcylate (8CI). CAS No. 31449-13-5. Molecular formula: C34H30O13. Mole weight: 646.59.
API-1
API-1. Group: Biochemicals. Grades: Purified. CAS No. 36707-00-3. Pack Sizes: 10mg. US Biological Life Sciences.
Worldwide
API-1
Akt/protein kinase B (PKB) inhibitor. Binds the pleckstrin homology domain of Akt and blocks Akt membrane translocation. Inhibits EGF-induced kinase activity of Akt1, Akt2 and Akt3. Induces cell growt h arrest and apoptosis in human cancer cells expressing constitutively active Akt. Synonyms: API 1; API1; NSC177233; NSC 177233; NSC-177233; 4-Amino-5,6,7,8-tetrahydro-5-oxo-8-(beta-D-ribofuranosyl)pyrido[2,3-d]pyrimidine-6-carboxamide. Grade: >98%. CAS No. 36707-00-3. Molecular formula: C28H30FN5O2. Mole weight: 337.29.
API-2
API-2. Group: Biochemicals. Grades: Purified. CAS No. 35943-35-2. Pack Sizes: 10mg. US Biological Life Sciences.
Worldwide
Apicidin
Apicidin (OSI 2040) is a fungal metabolite, acts as an orally active histone deacetylase 7/8 ( HDAC7/8 ) inhibitor, with antiparasitic activity and a broad spectrum antiproliferative activity. Apicidin can be used for cancer research [1] [2] [3] [4]. Uses: Scientific research. Group: Natural products. Alternative Names: OSI 2040. CAS No. 183506-66-3. Pack Sizes: 1 mg; 5 mg. Product ID: HY-N6735.
Apicidin
Apicidin is a cyclic peptide antibiotic with broad-spectrum antiproliferative, antiparasitic and antiprotozoan activity. It is a histone deacetylase (HDAC) inhibitor with anti-angiogenesis and apoptosis-inducing effects. Synonyms: OSI 2040; Cyclo[(2S)-2-amino-8-oxodecanoyl-1-methoxy-L-tryptophyl-L-isoleucyl-(2R)-2-piperidinecarbonyl]; Cyclo(8-oxo-L-2-aminodecanoyl-1-methoxy-L-tryptophyl-L-isoleucyl-D-2-piperidinecarbonyl); Apicidin Ia; 2H-Pyrido[1,2-a][1,4,7,10]tetraazacyclododecine-1,4,7,10(3H,12H)-tetrone, octahydro-6-[(1-methoxy-1H-indol-3-yl)methyl]-9-[(1S)-1-methylpropyl]-3-(6-oxooctyl)-, (3S,6S,9S,15aR)-. Grade: >98%. CAS No. 183506-66-3. Molecular formula: C34H49N5O6. Mole weight: 623.78.
Apicidin
Apicidin is a cyclic peptide antibiotic with broad spectrum antiparasitic and antiprotozoan activity. Apicidin, a histone deacetylase inhibitor, is anti-angiogenic and induces apoptosis. A potent, cell permeable inhibitor of histone deacetylase (IC50 = 700 pM for parasitic histone deacetylase). Inhibits HeLa cell proliferation (IC50 = 50 - 100 nM) and induces the transcriptional activation of p21 (WAF1) in a reversible manner. Also prevents H-ras-induced invasive phenotype of MCF-10A cells possibly by down regulating MMP-2 in a reversible manner. Apicidin has antiproliferative activity on HeLa cells accompanied by cell arrest at the G1 phase. Apicidin induces selective changes in the expression of p21 and gelsolin. Group: Biochemicals. Alternative Names: Cyclo[(2S)-2-amino-8-oxodecanoyl-1-methoxy-L-tryptophyl-L-isoleucyl-(2R)-2-piperidinecarbonyl]; Cyclo(8-oxo-L-2-aminodecanoyl-1-methoxy-L-tryptophyl-L-isoleucyl-D-2-piperidinecarbonyl); Apicidin Ia; OSI 2040. Grades: Highly Purified. CAS No. 183506-66-3. Pack Sizes: 2mg. US Biological Life Sciences.
Worldwide
Apicidin
?98% (HPLC), from microbial. Group: Fluorescence/luminescence spectroscopy.
Apicidin, Fusarium sp.
A potent, cell-permeable inhibitor of histone deacetylase (IC??= 700 pM for parasitic histone deactetylase) that also exibits antiprotozoal and potential anti-malarial properties. Group: Fluorescence/luminescence spectroscopy.
Cyclopeptide inhibitor of histone deactylases (HDACs). Inhibits HeLa cell proliferation (IC50=50-. Group: Biochemicals. Alternative Names: Cyclo- N-O-methyl-L-tryptophanyl-Lisoleucinyl- Dpipecolinyl- L-2-amino-8-oxodecanoyl. Grades: Highly Purified. CAS No. 183506-66-3. Pack Sizes: 1mg, 5mg. US Biological Life Sciences.
Worldwide
Apicularen A
Apicularen A is a macrolide antibiotic produced by Chondromyces robustus Cma 13. Apicularen A has no antibacterial activity, but for human and animal tumor cells such as KB-3-1, KB-V1, K-562, HL-60, U-937, A-498, A-549, PC-3 and SK-OV -3 grade has strong cytotoxicity. CAS No. 220757-04-0. Molecular formula: C25H31NO6. Mole weight: 441.52.
Apicularen B
Apicularen B is a macrolide antibiotic produced by Chondromyces robustus Cma 13. Apicularen B has low cytotoxicity and weak anti-Gram-positive bacteria activity. CAS No. 220757-06-2. Molecular formula: C33H44N2O11. Mole weight: 644.71.
Apidaecin IB acetate
Apidaecin IB acetate is an insect antimicrobial peptide with a minimum concentration of 8 μM against Escherichia coli (E. coli ML35, o18k1h7 and ATCC 25922). Synonyms: H-Gly-Asn-Asn-Arg-Pro-Val-Tyr-Ile-Pro-Gln-Pro-Arg-Pro-Pro-His-Pro-Arg-Leu-OH.CH3CO2H; glycyl-L-asparagyl-L-asparagyl-L-arginyl-L-prolyl-L-valyl-L-tyrosyl-L-isoleucyl-L-prolyl-L-glutaminyl-L-prolyl-L-arginyl-L-prolyl-L-prolyl-L-histidyl-L-prolyl-L-arginyl-L-leucine acetic acid; 18-L-leucine-Apidaecin Ia acetate; Apidaecin Ib acetate. Grade: ≥95%. Molecular formula: C97H154N32O25. Mole weight: 2168.46.
Apigenin
1g Pack Size. Group: Aroma Chemicals, Building Blocks, Organics. Formula: C15H10O5. CAS No. 520-36-5. Prepack ID 22930039-1g. Molecular Weight 270.24. See USA prepack pricing.
Apigenin
Apigenin. CAS No. 520-36-5. Product ID: PE-0323. Category: Active Pharmaceutical Ingredient. Product Keywords: Pharmaceutical Excipients; Other Materials; Active Pharmaceutical Ingredient; /; Apigenin; PE-0323; 520-36-5; 520-36-5. Grade: Pharmaceutical Grade.
Apigenin
Apigenin. Group: Biochemicals. Grades: Purified. CAS No. 520-36-5. Pack Sizes: 10mg, 50mg. US Biological Life Sciences.
Worldwide
Apigenin
Apigenin is a trihydroxyflavone that is flavone substituted by hydroxy groups at positions 4', 5 and 7. It induces autophagy in leukaemia cells. It has a role as a metabolite and an antineoplastic agent. It is a conjugate acid of an apigenin-7-olate. Alternative Names: 5,7-Dihydroxy-2-(4-hydroxyphenyl)-4H-chromen-4-one. Apigenol. Versulin. CAS No. 520-36-5. Product ID: PIPE-0556. Molecular formula: C15H10O5. Mole weight: 270.24. EINECS: 208-292-3. SMILES: C1=CC(=CC=C1C2=CC(=O)C3=C(C=C(C=C3O2)O)O)O. Appearance: Yellow needles from aqueous pyridine. Category: Natural Extract.
Apigenin
Apigenin (4',5,7-Trihydroxyflavone) is a competitive CYP2C9 inhibitor with a K i of 2 μM. Uses: Scientific research. Group: Natural products. Alternative Names: 4',5,7-Trihydroxyflavone; Apigenol; C.I. Natural Yellow 1. CAS No. 520-36-5. Pack Sizes: 10 mM * 1 mL; 5 mg; 10 mg; 50 mg; 100 mg; 200 mg; 500 mg. Product ID: HY-N1201.
Apigenin
Apigenin - Product ID: NST-10-78. Category: Flavonoids. Alternative Names: Baicalein-7-O-glucuronide. Purity: 98%. Test method: HPLC. CAS No. 520-36-5. Pack Sizes: 10g, 20g, 50g, 100g. Appearance: Yellow Powder. Molecular formula: C15H10O5. Mole weight: 270.24. Storage: +2 +8 °C.
Apigenin
United States Pharmacopeia (USP) Reference Standard. Group: Pharmacopeia & metrological institutes standardsfood additives, flavours & adulterants. Alternative Names: 5,7-Dihydroxy-2-(4-hydroxyphenyl)-4H-1-benzopyran-4-one, 4',5,7-Trihydroxyflavone, Pelargidenon 1449.
Apigenin (4',5,7-Trihydroxyflavone)
Induces the reversion of transformed phenotypes of v-H-ras-transformed NIH 3T3 cells at low concentration (12.5 uM) by inhibiting MAP kinase activity. Also inhibits the proliferation of malignan. Group: Biochemicals. Alternative Names: 4',5,7-Trihydroxyflavone. Grades: Highly Purified. Pack Sizes: 100mg. US Biological Life Sciences.
Apigenin 4'-β-D-glucuronide Triacetate Methyl Ester is an intermediate in synthesizing Isorhoifolin, a naturally occurring flavonoid that was shown to exhibit potential antidiabetic, antihyperlipidemic and antioxidant effects. Synonyms: Apigenin 4'-β-D-Gucopyranoside Triacetate Methyl Ester. Molecular formula: C28H28O14. Mole weight: 588.51.
Apigenin 4'-O- β-D-Glucuronide
Flavone component of the aerial parts of alfalfa (Medicago sativa L.) and pyrethrum flowers (Chrysanthemum cinerarifolium). Apigenin 4'-O- β-D-Glucuronide can be utilized for food or feed use and biological study of chemical composition of protein-xanthophyll concentrate dietary supplement made from alfalfa. Group: Biochemicals. Grades: Highly Purified. CAS No. 51771-57-4. Pack Sizes: 1mg, 5mg. Molecular Formula: C21H18O11, Molecular Weight: 446.36. US Biological Life Sciences.
Worldwide
apigenin 4'-O-methyltransferase
Converts apigenin into acacetin. Naringenin can also act as an acceptor, but more slowly. Group: Enzymes. Synonyms: flavonoid O-methyltransferase; flavonoid methyltransferase; S-adenosyl-L-methionine:5,7,4'-trihydroxyflavone 4'-O-methyltransferase. Enzyme Commission Number: EC 2.1.1.75. CAS No. 118251-36-8. Storage: Store it at +4 ?C for short term. For long term storage, store it at -20 ?C?-80 ?C. Form: Liquid or lyophilized powder. EXWM-1976; apigenin 4'-O-methyltransferase; EC 2.1.1.75; 118251-36-8; flavonoid O-methyltransferase; flavonoid methyltransferase; S-adenosyl-L-methionine:5,7,4'-trihydroxyflavone 4'-O-methyltransferase. Cat No: EXWM-1976.
Apigenin-4'-O-sulfate Potassium Salt
Apigenin-4'-O-sulfate Potassium Salt is a sulfated form of Apigenin (A726500) flavone, present in numerous plant species. Group: Biochemicals. Grades: Highly Purified. CAS No. 120537-28-2. Pack Sizes: 1mg, 5mg. Molecular Formula: C15H9KO8S, Molecular Weight: 388.39. US Biological Life Sciences.
Worldwide
Apigenin 6,8-di-C-glucoside
Vicenin -2 might be a useful lead for the development of multiple target-oriented therapeutic modalities for the treatment of diabetes and diabetes-associated complications. Synonyms: Vicenin II; Vicenin 2; Violantin. Grade: >98%. CAS No. 23666-13-9. Molecular formula: C27H30O15. Mole weight: 594.5.
Apigenin 6-C-α-L-arabinopyranosyl-8-C- β-D-xylopyranoside. Group: Biochemicals. CAS No. 677021-30-6. Pack Sizes: 5mg. US Biological Life Sciences.
Worldwide
Apigenin 6-glucosyl-7-O-methyl ether
Apigenin 6-glucosyl-7-O-methyl ether. Uses: Designed for use in research and industrial production. Additional or Alternative Names: SWERTISIN;APIGENIN 6-GLUCOSYL-7-O-METHYL ETHER;4',5-Dihydroxy-7-methoxy-6-β-D-glucopyranosylflavone;6-(β-D-Glucopyranosyl)-5-hydroxy-2-(4-hydroxyphenyl)-7-methoxy-4H-1-benzopyran-4-one. Product Category: Heterocyclic Organic Compound. CAS No. 6991-10-2. Molecular formula: C22H22O11. Mole weight: 462.4. Product ID: ACM6991102. Alfa Chemistry ISO 9001:2015 Certified.
Apigenin 7-β-D-glucuronide Triacetate Methyl Ester is an intermediate in synthesizing Isorhoifolin, a naturally occurring flavonoid that was shown to exhibit potential antidiabetic, antihyperlipidemic and antioxidant effects. Synonyms: Apigenin 7-β-D-Gucopyranoside Triacetate Methyl Ester. Molecular formula: C28H28O14. Mole weight: 588.51.
Apigenin 7- β-D-Gucopyranoside Triacetate Methyl Ester is an intermediate in synthesizing Isorhoifolin (I819700), a naturally occurring flavonoid that was shown to exhibit potential antidiabetic, antihyperlipidemic and antioxidant effects. Group: Biochemicals. Grades: Highly Purified. Pack Sizes: 50mg, 100mg. Molecular Formula: C28H28O14, Molecular Weight: 588.51. US Biological Life Sciences.