A directory of where to buy chemicals in the USA, including: distributors, industrial manufacturers, bulk supplies and wholesalers of raw ingredients & finished goods.
Search for products or services, then visit the suppliers website for prices or more information.
| Product | Description | |
|---|---|---|
| ADP-L-glycero-b-D-manno-heptose | ADP-L-glycero-b-D-manno-heptose. Molecular formula: C17H27N5O16P2. Mole weight: 619.4. |  |
| ADP - lyophilized | ADP - lyophilized is a pharmaceutical compound used in the biomedical industry for the analysis of enzyme activity as well as the investigation of energy metabolism and cellular signaling pathways. With its lyophilized formulation, this compound is designed to improve stability and facilitate reconstitution. Synonyms: Adenosine-5'-diphosphate, Sodium salt. Grade: ≥ 95% by HPLC. Molecular formula: C10H15N5O10P2 (free acid). Mole weight: 427.20 (free acid). | |
| ADPM06 | ADPM06 is a nonporphyrin photodynamic therapeutic (PDT) agent, which is an established treatment modality for cancer. It exhibits IC50s in the micro-molar range in human tumor cells and induces apoptosis. Synonyms: ADPM-06; ADPM 06; Azadipyrromethane. CAS No. 490035-90-0. Molecular formula: C34H24BBr2F2N3O2. Mole weight: 715.2. | |
| ADP-phosphoglycerate phosphatase | Also acts on 2,3-bisphosphoglycerate. Group: Enzymes. Synonyms: adenosine diphosphate phosphoglycerate phosphatase. Enzyme Commission Number: EC 3.1.3.28. CAS No. 37288-12-3. Storage: Store it at +4 ?C for short term. For long term storage, store it at -20 ?C?-80 ?C. Form: Liquid or lyophilized powder. EXWM-3631; ADP-phosphoglycerate phosphatase; EC 3.1.3.28; 37288-12-3; adenosine diphosphate phosphoglycerate phosphatase. Cat No: EXWM-3631. |  |
| ADP-ribose 1''-phosphate phosphatase | The enzyme is highly specific for ADP-D-ribose 1''-phosphate. Involved together with EC 3.1.4.37, 2',3'-cyclic-nucleotide 3'-phosphodiesterase, in the breakdown of adenosine diphosphate ribose 1'',2''-cyclic phosphate (Appr>p), a by-product of tRNA splicing. Group: Enzymes. Synonyms: POA1; Appr1p phosphatase; Poa1p; ADP-ribose 1''-phosphate phosphohydrolase. Enzyme Commission Number: EC 3.1.3.84. Storage: Store it at +4 ?C for short term. For long term storage, store it at -20 ?C?-80 ?C. Form: Liquid or lyophilized powder. EXWM-3690; ADP-ribose 1''-phosphate phosphatase; EC 3.1.3.84; POA1; Appr1p phosphatase; Poa1p; ADP-ribose 1''-phosphate phosphohydrolase. Cat No: EXWM-3690. | |
| ADP-ribose diphosphatase | ADP-ribose diphosphatase (EC 3.6.1.13) is an enzyme that catalyzes a hydrolysis reaction in which water nucleophilically attacks ADP-ribose to produce AMP and D-ribose 5-phosphate. Enzyme hydrolysis occurs by the breakage of a phosphoanhydride bond and is dependent on Mg2+ ions that are held in complex by the enzyme. Group: Enzymes. Synonyms: ADPribose pyrophosphatase; adenosine diphosphoribose pyrophosphatase; ADPR-PPase; ADP-ribose ribophosphohydrolase. Enzyme Commission Number: EC 3.6.1.13. CAS No. 9024-83-3. Storage: Store it at +4 ?C for short term. For long term storage, store it at -20 ?C?-80 ?C. Form: Liquid or lyophilized powder. EXWM-4597; ADP-ribose diphosphatase; EC 3.6.1.13; 9024-83-3; ADPribose pyrophosphatase; adenosine diphosphoribose pyrophosphatase; ADPR-PPase; ADP-ribose ribophosphohydrolase. Cat No: EXWM-4597. | |
| ADP-ribosylation factor GTPase-activating protein 3 (152-160) | A fragment of ADP-ribosylation factor GTPase-activating protein 3. ARFGAP3 (ADP Ribosylation Factor GTPase Activating Protein 3) is a Protein Coding gene. Diseases associated with ARFGAP3 include Phelan-Mcdermid Syndrome and Ceroid Lipofuscinosis, Neuronal, 4B, Autosomal Dominant. This peptide can be used in Ovarian carcinoma research. | |
| ADP-ribosyl cyclase/cyclic ADP-ribose hydrolase | This multiunctional enzyme catalyses both the synthesis and hydrolysis of cyclic ADP-ribose, a calcium messenger that can mobilize intracellular Ca2+ stores and activate Ca2+ influx to regulate a wide range of physiological processes. In addition, the enzyme also catalyses EC 2.4.99.20, 2'-phospho-ADP-ribosyl cyclase/2'-phospho-cyclic-ADP-ribose transferase. cf. EC 3.2.2.5, NAD+ glycohydrolase. Group: Enzymes. Synonyms: NAD+ nucleosidase; NADase (ambiguous); DPNase (ambiguous); DPN hydrolase (ambiguous); NAD hydrolase (ambiguous); nicotinamide adenine dinucleotide nucleosidase (ambiguous); NAD glycohydrolase (misleading); NAD nucleosidase (ambiguous); nicotinamide adenine dinucleotide glycohydrolase (misleading); CD38 (. Enzyme Commission Number: EC 3.2.2.6. CAS No. 9032-65-9. Storage: Store it at +4 ?C for short term. For long term storage, store it at -20 ?C?-80 ?C. Form: Liquid or lyophilized powder. EXWM-3988; ADP-ribosyl cyclase/cyclic ADP-ribose hydrolase; EC 3.2.2.6; 9032-65-9; NAD+ nucleosidase; NADase (ambiguous); DPNase (ambiguous); DPN hydrolase (ambiguous); NAD hydrolase (ambiguous); nicotinamide adenine dinucleotide nucleosidase (ambiguous); NAD glycohydrolase (misleading); NAD nucleosidase (ambiguous); nicotinamide adenine dinucleotide glycohydrolase (misleading); CD38 (gene name); BST1 (gene name). Cat No: EXWM-3988. | |
| ADP-ribosyl-[dinitrogen reductase] hydrolase | The enzyme restores the activity of EC 1.18.6.1, nitrogenase, by catalysing the removal of ADP-ribose from an arginine residue of the dinitrogenase reductase component of nitrogenase. This activity occurs only when the nitrogenase product, ammonium, is not available. The combined activity of this enzyme and EC 2.4.2.37, NAD+-dinitrogen-reductase ADP-D-ribosyltransferase, controls the level of activity of nitrogenase. Group: Enzymes. Synonyms: azoferredoxin glycosidase; azoferredoxin-activating enzymes; dinitrogenase reductase-activating glycohydrolase; ADP-ribosyl glycohydrolase; draG (gene name). Enzyme Commission Number: EC 3.2.2.24. CAS No. 125626-63-3. Storage: Store it at +4 ?C for short term. For long term storage, store it at -20 ?C?-80 ?C. Form: Liquid or lyophilized powder. EXWM-3978; ADP-ribosyl-[dinitrogen reductase] hydrolase; EC 3.2.2.24; 125626-63-3; azoferredoxin glycosidase; azoferredoxin-activating enzymes; dinitrogenase reductase-activating glycohydrolase; ADP-ribosyl glycohydrolase; draG (gene name). Cat No: EXWM-3978. | |
| ADPS | ADPS is a kind of new Trinder's reagents, which are high water-soluble aniline derivatives, widely used in diagnostic and biochemical tests. Uses: Scientific research. Group: Biochemical assay reagents. Alternative Names: ESPAS. CAS No. 82611-88-9. Pack Sizes: 10 mM * 1 mL; 500 mg. Product ID: HY-15904. |  |
| ADP-specific glucokinase | Requires Mg2+. The enzyme from Pyrococcus furiosus is highly specific for D-glucose; there is some activity with 2-deoxy-D-glucose, but no activity with D-fructose, D-mannose or D-galactose as the substrate. No activity is detected when ADP is replaced by ATP, GDP, phosphoenolpyruvate, diphosphate or polyphosphate. Group: Enzymes. Synonyms: ADP-dependent glucokinase. Enzyme Commission Number: EC 2.7.1.147. CAS No. 173585-07-4. Hexokinase (ADP-Dependent). Storage: Store it at +4 ?C for short term. For long term storage, store it at -20 ?C?-80 ?C. Form: Liquid or lyophilized powder. EXWM-2977; ADP-specific glucokinase; EC 2.7.1.147; 173585-07-4; ADP-dependent glucokinase. Cat No: EXWM-2977. | |
| ADP-specific phosphofructokinase | ADP can be replaced by GDP, ATP and GTP, to a limited extent. Divalent cations are necessary for activity, with Mg2+ followed by Co2+ being the most effective. Group: Enzymes. Synonyms: ADP-6-phosphofructokinase, ADP-dependent phosphofructokinase. Enzyme Commission Number: EC 2.7.1.146. CAS No. 237739-62-7. Storage: Store it at +4 ?C for short term. For long term storage, store it at -20 ?C?-80 ?C. Form: Liquid or lyophilized powder. EXWM-2976; ADP-specific phosphofructokinase; EC 2.7.1.146; 237739-62-7; ADP-6-phosphofructokinase, ADP-dependent phosphofructokinase. Cat No: EXWM-2976. | |
| ADP-sugar diphosphatase | Has a specificity that is distinct from that of UDP-sugar diphosphatase (EC 3.6.1.45). Group: Enzymes. Synonyms: ADP-sugar pyrophosphatase; adenosine diphosphosugar pyrophosphatase. Enzyme Commission Number: EC 3.6.1.21. CAS No. 37289-32-0. Storage: Store it at +4 ?C for short term. For long term storage, store it at -20 ?C?-80 ?C. Form: Liquid or lyophilized powder. EXWM-4605; ADP-sugar diphosphatase; EC 3.6.1.21; 37289-32-0; ADP-sugar pyrophosphatase; adenosine diphosphosugar pyrophosphatase. Cat No: EXWM-4605. | |
| ADP-thymidine kinase | The deoxypyrimidine kinase complex induced by Herpes simplex virus catalyses this reaction as well as those of EC 2.7.1.21 (thymidine kinase), EC 2.7.1.114 (AMP-thymidine kinase) and EC 2.7.4.9 (dTMP kinase). Group: Enzymes. Synonyms: ADP:dThd phosphotransferase; adenosine diphosphate-thymidine phosphotransferase. Enzyme Commission Number: EC 2.7.1.118. CAS No. 82114-39-4. Storage: Store it at +4 ?C for short term. For long term storage, store it at -20 ?C?-80 ?C. Form: Liquid or lyophilized powder. EXWM-2958; ADP-thymidine kinase; EC 2.7.1.118; 82114-39-4; ADP:dThd phosphotransferase; adenosine diphosphate-thymidine phosphotransferase. Cat No: EXWM-2958. | |
| ADRA1D receptor agonist 1 | ADRA1D receptor agonist 1 is a potent, selective and orally active α1D adrenoceptor antagonist, with a Ki of 1.6 nM. Synonyms: 5-chloro-1-[(1R)-1-(3-cyanophenyl)ethyl]-2-imino-1,2-dihydropyridine-3-carboxamide hydrochloride. CAS No. 1191908-14-1. Molecular formula: C15H14Cl2N4O. Mole weight: 337.20. | |
| Adrafinil | α-Adrenergic agonist. Treatment of depression. Group: Biochemicals. Alternative Names: 2-[ (Diphenylmethyl) sulfinyl]-N-hydroxyacetamide; 2- (Benzhydrylsulfinyl) acetohydroxamic Acid; CRL 40028; Olmifon. Grades: Highly Purified. CAS No. 63547-13-7. Pack Sizes: 10mg. US Biological Life Sciences. |  Worldwide |
| Adrafinil | Adrafinil (CRL-40028, Olmifon), prodrug of modafinil, is a mild central nervous system stimulant drug used to relieve excessive sleepiness and inattention, Adrafinil is believed to serve as an alpha-1 adrenoceptor agonist. Uses: Scientific research. Group: Signaling pathways. Alternative Names: CRL 40028. CAS No. 63547-13-7. Pack Sizes: 10 mM * 1 mL; 5 mg; 10 mg; 50 mg; 100 mg. Product ID: HY-17549. | |
| Adrenal Gland, Bovine | Adrenal Gland, Bovine. Group: Biologicals. Grades: Tissue. Pack Sizes: 50Ea. US Biological Life Sciences. | Worldwide |
| Adrenal Gland, Rabbit | Adrenal Gland, Rabbit. Group: Biologicals. Grades: Tissue. Pack Sizes: 50Ea. US Biological Life Sciences. | Worldwide |
| Adrenaline-D6 Racemate (Adrenaline Impurity 40) | Adrenaline-D6 Racemate (Adrenaline Impurity 40). Uses: For analytical and research use. Group: Impurity standards. CAS No. 1219803-77-6. Molecular formula: C9H7D6NO3. Mole weight: 189.24. Catalog: APB1219803776. |  |
| Adrenaline HCl | Adrenaline HCl. Alternative Names: (-)-adrenalinehydrochlorid;l-methylaminoethanolcathecholhydrochloride;nci-c55663;supranephrinsolution;(r)-4-(1-hydroxy-2-(methylamino)ethyl)-1,2Chemicalbook-benzenediolhydrochloride;l-epinephrinehydrochloride;(R)-4-[1-hydroxy-2-(methylamino)ethyl]pyrocatecholhydrochloride;EpinephrineHydrochloricAcid. CAS No. 55-31-2. Product ID: API55312. Molecular formula: C9H14ClNO3. Mole weight: 219.67. EINECS: 200-230-3. SMILES: CNC[C@@H](C1=CC(=C(C=C1)O)O)O.Cl. Application: Local anesthetics & Analgesics. Category: Anesthetic Analgesia APIs. |  |
| Adrenaline Impurity | An impurity of Epinephrine. Epinephrine is a natural neurotransmitter that is released from the adrenal medulla and activates adrenoceptors. Synonyms: 4-(2-amino-1-methoxyethyl)benzene-1,2-diol. Grade: > 95%. CAS No. 138-65-8. Molecular formula: C10H15NO3. Mole weight: 197.24. | |
| Adrenaline Impurity 1 | An impurity of Epinephrine. Epinephrine is an endogenous catcholamine with combined α-and β-agonist activity and its principal sympathomimetic hormone is produced by the adrenal medulla. Synonyms: 2-Amino-1-(2-hydroxyphenyl)ethan-1-one; SCHEMBL4014026. CAS No. 72481-17-5. Molecular formula: C8H9NO2. Mole weight: 151.16. | |
| Adrenaline Impurity 10 | Adrenaline Impurity 10. Uses: For analytical and research use. Group: Impurity standards. CAS No. 1416249-73-4. Molecular formula: C9H10ClNO3. Mole weight: 215.63. Catalog: APB1416249734. | |
| Adrenaline Impurity 10 HCl | An impurity of Epinephrine. Epinephrine is an endogenous catcholamine with combined α-and β-agonist activity and its principal sympathomimetic hormone is produced by the adrenal medulla. Molecular formula: C9H10ClNO3. Mole weight: 215.63. | |
| Adrenaline Impurity 2 | An impurity of Epinephrine. Epinephrine is an endogenous catcholamine with combined α-and β-agonist activity and its principal sympathomimetic hormone is produced by the adrenal medulla. Synonyms: 2-octopamine. CAS No. 2234-25-5. Molecular formula: C8H11NO2. Mole weight: 153.18. | |
| Adrenaline Impurity 26 | Adrenaline Impurity 26. Uses: For analytical and research use. Group: Impurity standards. CAS No. 16899-83-5. Molecular formula: C10H14ClNO3. Mole weight: 231.68. Catalog: APB16899835. | |
| Adrenaline Impurity 3 | An impurity of Epinephrine. Epinephrine is an endogenous catcholamine with combined α-and β-agonist activity and its principal sympathomimetic hormone is produced by the adrenal medulla. Molecular formula: C13H13Cl2FN2O3. Mole weight: 335.16. | |
| Adrenaline Impurity 4 | An impurity of Epinephrine. Epinephrine is an endogenous catcholamine with combined α-and β-agonist activity and its principal sympathomimetic hormone is produced by the adrenal medulla. Synonyms: 1-Ethyl-7-chloro-6-fluoro-4-oxo-1,4-dihydro-1,8-naphthyridine-3-carboxylic acid ethyl ester; 7-chloro-1-ethyl-6-fluoro-1,4-dihydro-4-oxo-1,8-naphthyridine-3-carboxylic acid ethyl ester; SCHEMBL3977245. CAS No. 79286-86-5. Molecular formula: C13H12ClFN2O3. Mole weight: 298.70. | |
| Adrenaline Impurity 5 | An impurity of Epinephrine. Epinephrine is an endogenous catcholamine with combined α-and β-agonist activity and its principal sympathomimetic hormone is produced by the adrenal medulla. Synonyms: 2-Chloro-1-(2-hydroxyphenyl)ethan-1-one; 2'-Hydroxy-alpha-chloroacetophenone; SCHEMBL6129338. CAS No. 53074-73-0. Molecular formula: C8H7ClO2. Mole weight: 170.52. | |
| Adrenaline Impurity 6 HCl | An impurity of Epinephrine. Epinephrine is an endogenous catcholamine with combined α-and β-agonist activity and its principal sympathomimetic hormone is produced by the adrenal medulla. CAS No. 857565-22-1. Molecular formula: C9H12ClNO3. Mole weight: 217.65. | |
| Adrenaline Impurity 7 HCl | An impurity of Epinephrine. Epinephrine is an endogenous catcholamine with combined α-and β-agonist activity and its principal sympathomimetic hormone is produced by the adrenal medulla. CAS No. 29705-82-6. Molecular formula: C9H12ClNO3. Mole weight: 217.65. | |
| Adrenaline Impurity 8 HCl | An impurity of Epinephrine. Epinephrine is an endogenous catcholamine with combined α-and β-agonist activity and its principal sympathomimetic hormone is produced by the adrenal medulla. Synonyms: 1-(4-Hydroxyphenyl)-2-(methylamino)ethan-1-one, hydrochloride (1:1); 4-Hydroxy-alpha-methylaminoacetophenone, hydrochloride. CAS No. 67828-68-6. Molecular formula: C9H12ClNO2. Mole weight: 201.65. | |
| Adrenaline Impurity 9 HCl | An impurity of Epinephrine. Epinephrine is an endogenous catcholamine with combined α-and β-agonist activity and its principal sympathomimetic hormone is produced by the adrenal medulla. Molecular formula: C9H12ClNO2. Mole weight: 201.65. | |
| Adrenaline Impurity D | An impurity of Epinephrine. Epinephrine is a natural neurotransmitter that is released from the adrenal medulla and activates adrenoceptors. Synonyms: N-Benzyl Epinephrine. Grade: > 95%. CAS No. 1095714-91-2. Molecular formula: C16H19NO3. Mole weight: 273.33. | |
| Adrenaline Impurity F | An impurity of Epinephrine. Epinephrine is a natural neurotransmitter that is released from the adrenal medulla and activates adrenoceptors. Synonyms: 1-(3,4-dihydroxyphenyl)-2-(methylamino)ethanesulfonic acid. Grade: > 95%. CAS No. 78995-75-2. Molecular formula: C9H13NO5S. Mole weight: 247.27. | |
| Adrenaline Related Compound 2 | VMA is an impurity of Epinephrine. Epinephrine is a natural neurotransmitter that is released from the adrenal medulla and activates adrenoceptors. Synonyms: VMA; 4-Hydroxy-3-methoxymandelic acid. Grade: > 95%. CAS No. 55-10-7. Molecular formula: C9H10O5. Mole weight: 198.18. | |
| Adrenalone | Adrenalone, a ketone derivative of epinephrine, is a potent inhibitor of dopamine β oxidase. Uses: Vasoconstrictor agents. Synonyms: 3,4-Dihydroxy-α-methylaminoacetophenone; 3',4'-Dihydroxy-2-(methylamino)acetophenone; 4-Methylaminoacetopyrocatechol; Adrenolone; Adrenon; Adrenone; Chemosan; Haemodan; Kephrine; Ketogaze; Methaminoacetocatechol; NSC 243611; Stryphnon; Stryphnone; Styphnone; Stypnon; Stypnone; 1-(3,4-dihydroxyphenyl)-2-(methylamino)ethan-1-one. Grade: ≥95%. CAS No. 99-45-6. Molecular formula: C9H11NO3. Mole weight: 181.19. | |
| Adrenalone hydrochloride | Adrenalone hydrochloride. Group: Biochemicals. Alternative Names: 3', 4'-Dihydroxy-2- methyl aminoacetophenone hydrochloride. Grades: Highly Purified. CAS No. 62-13-5. Pack Sizes: 10g, 25g. US Biological Life Sciences. | Worldwide |
| Adrenalone hydrochloride | Adrenalone hydrochloride is an adrenergic agonist used as a topical vasoconstrictor and hemostatic. Adrenalone hydrochloride is an inhibitor of dopamine β oxidase. Adrenalone hydrochloride is chemically similar to known norepinephrine transporter (NET) ligands with an IC 50 of 36.9 μM [1] [2]. Uses: Scientific research. Group: Signaling pathways. CAS No. 62-13-5. Pack Sizes: 50 mg; 100 mg; 500 mg. Product ID: HY-B1308. | |
| Adrenalone hydrochloride | United States Pharmacopeia (USP) Reference Standard. Group: Pharmacopeia & metrological institutes standards. | |
| Adrenalone hydrochloride 98+% (HPLC) | Adrenalone hydrochloride 98+% (HPLC). Group: Biochemicals. Grades: Reagent Grade. CAS No. 62-13-5. Pack Sizes: 1g, 5g, 25g, 100g, 250g. US Biological Life Sciences. | Worldwide |
| Adrenergic Receptor-Targeted Compound Library | A unique collection of 219 bioactive compounds specifically targeting adrenergic receptors, effective tool for screening new drugs or new target identification; - Bioactivity and safety confirmed by pre-clinical research and clinical trials; - Detailed compound information with structure, target, activity, IC50 value, and biological activity description; - Structurally diverse, medicinally active, and cell permeable; - NMR and HPLC validated to ensure high purity and quality. Uses: Scientific use. Product Category: L2700. Categories: Adrenergic Receptor-Targeted Compounds Libraries. |  |
| Adrenic acid | Adrenic Acid (cis-7,10,13,16-Docosatetraenoic acid) is a naturally polyunsaturated fatty acid in the adrenal gland, brain, kidney, and vasculature. Adrenic Acid can regulate the vascular tone in arteries of the adrenal cortex. Adrenic Acid also is an inflammation enhancer in non-alcoholic fatty liver disease [1] [2]. Uses: Scientific research. Group: Natural products. Alternative Names: cis-7,10,13,16-Docosatetraenoic acid. CAS No. 28874-58-0. Pack Sizes: 5 mg (300 mM * 50 μL in Ethanol); 10 mg (300 mM * 100 μL in Ethanol). Product ID: HY-W013215. | |
| Adrenic Acid | Adrenic Acid. Uses: Designed for use in research and industrial production. Additional or Alternative Names: Cis-7,10,13,16-Docosatetraenoic Acid. Product Category: Heterocyclic Organic Compound. CAS No. 28874-58-0. Molecular formula: C22H36O2. Mole weight: 332.53. Purity: 0.99. Product ID: ACM28874580. Alfa Chemistry ISO 9001:2015 Certified. |  |
| Adrenochrome | Adrenochrome (Adraxone) is an oxidation product of Epinephrine. Adrenochrome is a potent coronary constricting agent in the rat heart. Adrenochrome can be used for neurological disorder research [1] [2] [3]. Uses: Scientific research. Group: Signaling pathways. Alternative Names: Adraxone. CAS No. 54-06-8. Pack Sizes: 5 mg; 10 mg. Product ID: HY-116513. | |
| Adrenochrome | An impurity of Phenylephrine which selectively binds to alpha receptors which cause blood vessels to constrict. Synonyms: Adrenochrome. Grade: > 95%. CAS No. 54-06-8. Molecular formula: C9H9NO3. Mole weight: 179.18. | |
| Adrenochrome Bisulfite Sodium Salt | Adrenochrome Bisulfite Sodium Salt is a derivative of Adrenochrome. Synonyms: Sodium 3-Hydroxy-1-methyl-5,6-dioxo-2,3,3a,4,5,6-hexahydro-1H-indole-3a-sulfonate; Adrenochrome Impurity 1; 3aH-Indole-3a-sulfonic acid, 1,2,3,4,5,6-hexahydro-3-hydroxy-1-methyl-5,6-dioxo-, sodium salt (1:1). Grade: ≥95%. CAS No. 5818-84-8. Molecular formula: C9H10NNaO6S. Mole weight: 283.23. | |
| Adrenochrome Bisulfite Sodium Salt | Adrenochrome Bisulfite Sodium Salt. Uses: For analytical and research use. Group: Building blocks. Alternative Names: Adrenochrome bisulfite sodium salt,3aH-Indole-3a-sulfonic acid, 1,2,3,4,5,6-hexahydro-3-hydroxy-1-methyl-5,6-dioxo-, sodium salt (1:1), 3a(4H)-Indolinesulfonic acid, 5,6-dihydro-3-hydroxy-1-methyl-5,6-dioxo-, sodium salt (7CI), 1,2,3,4,5,6-Hexahydro-3-hydroxy-1-methyl-5,6-dioxo-3aH-indole-3a-sulfonic acid sodium salt, 3aH-Indole-3a-sulfonic acid, 1,2,3,4,5,6-hexahydro-3-hydroxy-1-methyl-5,6-dioxo-, monosodium salt (9CI). CAS No. 5818-84-8. Pack Sizes: 10MG. IUPAC Name: sodium;3-hydroxy-1-methyl-5,6-dioxo-3,4-dihydro-2H-indole-3a-sulfonate. Molecular formula: C9H10NO6S.Na. Mole weight: 283.23. Catalog: APS5818848. SMILES: [Na+].CN1CC(O)C2(CC(=O)C(=O)C=C12)S(=O)(=O)[O-]. Format: Neat. Shipping: Room Temperature. | |
| Adrenochrome Bisulfite Sodium Salt | Adrenochrome Bisulfite Sodium Salt is a derivative of Adrenochrome (A305250), the substance mainly responsible for the red colours produced during the mild oxidation of adrenaline. Group: Biochemicals. Grades: Highly Purified. CAS No. 5818-84-8. Pack Sizes: 10mg, 100mg. Molecular Formula: C9H10NNaO6S. US Biological Life Sciences. | Worldwide |
| Adrenochrome Impurity 2 | Adrenochrome Impurity 2 is an impurity of Adrenochrome, which was first isolated from the products of an enzymatic oxidation. CAS No. 87708-46-1. Molecular formula: C9H9NO3. Mole weight: 179.17. | |
| Adrenochrome monoaminoguanidine mesilate | Adrenochrome monoaminoguanidine mesilate. Group: Biochemicals. Alternative Names: 2- (1, 2, 3, 6-Tetra hydro-3- hydroxy-1- methyl -6-oxo-5H-indol-5-yl ide ne ) -hydrazinecarboximidam ide monomethanesulfonate salt; A-Peest; AMM. Grades: Highly Purified. CAS No. 4009-68-1. Pack Sizes: 1mg, 2mg, 5mg, 10mg, 25mg. Molecular Formula: C11H17N5O5S. US Biological Life Sciences. | Worldwide |
| Adrenochrome Monoaminoguanidine Mesilate | Adrenochrome Monoaminoguanidine Mesilate is an Adrenochrome derivative. Uses: An adrenochrome derivative; used as hemostatic agent. Synonyms: 2-(1,2,3,6-Tetrahydro-3-hydroxy-1-methyl-6-oxo-5H-indol-5-ylidene)-hydrazinecarboximidamide Monomethanesulfonate Salt; A-Peest; AMM; Adchnon S; S-Adchnon; S-Adchnone. Grade: ≥95%. CAS No. 4009-68-1. Molecular formula: C11H17N5O5S. Mole weight: 331.35. | |
| Adrenochrome monosemicarbazone | Adrenochrome monosemicarbazone is a pharmaceutical compound exhibiting immense promise in studying a myriad of ailments including Parkinson's disease, renowned for its magnificent antioxidant and immunomodulatory attributes. Synonyms: Hydrazinecarboxamide, 2-[1,2,3,5(or 1,2,3,6)-tetrahydro-3-hydroxy-1-methyl-5(or 6)-oxo-6H(or 5H)-indol-6(or 5)-ylidene]-; 5,6-Indolinedione, 3-hydroxy-1-methyl-, monosemicarbazone; 5,6-Indolinedione, 3-hydroxy-1-methyl-, semicarbazone; (1,2,3,5(or 1,2,3,6)-tetrahydro-3-hydroxy-1-methyl-5(or 6)-oxo-6H(or 5H)-indol-6(or 5)-al) semicarbazone. CAS No. 30552-37-5. Molecular formula: C10H12N4O3. Mole weight: 236.23. | |
| Adrenochrome semicarbazone | Adrenochrome semicarbazone. Uses: For analytical and research use. Group: Pharma & vet compounds & metabolites; pharma & vet compounds & metabolites. Alternative Names: Adrenochrome semicarbazone (6CI), Adchnon, Cromosil, 5,6-Indolinedione, 3-hydroxy-1-methyl-, 5-semicarbazone (7CI,8CI), Adroxon, 2-(1,2,3,6-Tetrahydro-3-hydroxy-1-methyl-6-oxo-5H-indol-5-ylidene)hydrazinecarboxamide, Carbazochrom, Adrezon, Carbazochrome, Adrenoxyl, Adrenostazin, 3-Hydroxy-1-methyl-5,6-indolindione 5-semicarbazone, Sangostazin, Adrokson, NSC 73742,Adenochrome semicarbazone, Adrenochrome monosemicarbazone, Cromadrenal, Adedolon, Cartabes, Sangostasin, Hydrazinecarboxamide, 2-(1,2,3,6-tetrahydro-3-hydroxy-1-methyl-6-oxo-5H-indol-5-ylidene)-. CAS No. 69-81-8. Molecular formula: C10H12N4O3. Mole weight: 236.23. Catalog: APS69818. Format: Neat. Shipping: Room Temperature. | |
| Adrenocorticoptropic Hormone Fragment 22 - 39 | Adrenocorticoptropic Hormone Fragment 22 - 39. Group: Biochemicals. Grades: Highly Purified. CAS No. 37548-29-1. Pack Sizes: 1mg, 2.5mg. Molecular Formula: C90H125N19O32, Molecular Weight: 1985.06. US Biological Life Sciences. | Worldwide |
| Adrenocorticotropic hormone | Adrenocorticotropic hormone (ACTH) is a polypeptide tropic hormone produced by the anterior pituitary gland. Adrenocorticotropic hormone regulates cortisol and androgen production [1] [2]. Uses: Scientific research. Group: Peptides. Alternative Names: ACTH; Adrenocorticotrophic hormone. CAS No. 9002-60-2. Pack Sizes: 5 mg; 10 mg. Product ID: HY-106373. | |
| Adrenocorticotropic Hormone (ACTH) (1-39), human | Adrenocorticotropic Hormone (ACTH) (1-39), human is a melanocortin receptor agonist. Uses: Scientific research. Group: Peptides. Alternative Names: 1-39-Corticotropin (human). CAS No. 12279-41-3. Pack Sizes: 5 mg; 10 mg; 25 mg. Product ID: HY-P1211. | |
| Adrenocorticotropic Hormone (ACTH) (1-39), rat | Adrenocorticotropic Hormone (ACTH) (1-39), rat is a potent melanocortin 2 (MC2) receptor agonist. Uses: Scientific research. Group: Peptides. Alternative Names: ACTH (1-39) (mouse, rat). CAS No. 77465-10-2. Pack Sizes: 500 μg; 1 mg; 5 mg; 10 mg. Product ID: HY-P1477. | |
| Adrenocorticotropic Hormone (ACTH) (18-39), human TFA | Adrenocorticotropic Hormone (ACTH) (18-39), human TFA is a corticotropinlike intermediate lobe peptide, which is is produced in the melanotrophs of the intermediate lobe of the pituitary [1]. Uses: Scientific research. Group: Peptides. Alternative Names: CLIP (human) TFA. CAS No. 73724-75-1. Pack Sizes: 5 mg; 10 mg. Product ID: HY-P1476A. | |
| Adrenocorticotropic Hormone Fragment 1-16 human, rat | ACTH (1-16) is an agonist of the melanocortin-1 and 3 receptors (K1 = 0.267 ± 0.116 and 19.0 ± 4.3 nmol/L respectively). Synonyms: ACTH (1-16) (human); H-Ser-Tyr-Ser-Met-Glu-His-Phe-Arg-Trp-Gly-Lys-Pro-Val-Gly-Lys-Lys-OH. CAS No. 5576-42-1. Molecular formula: C89H133N25O22S. Mole weight: 1937.23. | |
| Adrenocorticotropic Hormone Fragment 4-10 human, rat | ?97% (HPLC). Group: Fluorescence/luminescence spectroscopy. | |
| Adrenocorticotropic Hormone Fragment 7-38 human | Adrenocorticotropic Hormone Fragment 7-38 human. Synonyms: Corticostatin; (7-28)-Corticotropin; Acth(7-38); CIP peptide. CAS No. 68563-24-6. Molecular formula: C167H257N47O46. Mole weight: 3659.11. | |
| adrenodoxin-NADP+ reductase | A flavoprotein (FAD). The enzyme, which transfers electrons from NADPH to adrenodoxin molecules, is the first component of the mitochondrial cytochrome P-450 electron transfer systems, and is involved in the biosynthesis of all steroid hormones. Group: Enzymes. Synonyms: adrenodoxin reductase; nicotinamide adenine dinucleotide phosphate-adrenodoxin reductase; AdR; NADPH:adrenal ferredoxin oxidoreductase; NADPH-adrenodoxin reductase. Enzyme Commission Number: EC 1.18.1.6. Storage: Store it at +4 ?C for short term. For long term storage, store it at -20 ?C?-80 ?C. Form: Liquid or lyophilized powder. EXWM-1111; adrenodoxin-NADP+ reductase; EC 1.18.1.6; adrenodoxin reductase; nicotinamide adenine dinucleotide phosphate-adrenodoxin reductase; AdR; NADPH:adrenal ferredoxin oxidoreductase; NADPH-adrenodoxin reductase. Cat No: EXWM-1111. | |
| Adrenomedullin (11-50), rat | Adrenomedullin (11-50), rat is the C-terminal fragment (11-50) of the adrenomedullin in rats. Rat adrenomedullin induces selective arterial vasodilation through CGRP1 receptor. Synonyms: Ser-Thr-Gly-Cys-Arg-Phe-Gly-Thr-Cys-Thr-Met-Gln-Lys-Leu-Ala-His-Gln-Ile-Tyr-Gln-Phe-Thr-Asp-Lys-Asp-Lys-Asp-Gly-Met-Ala-Pro-Arg-Asn-Lys-Ile-Ser-Pro-Gln-Gly-Tyr-NH2 (Disulfide bridge: Cys4-Cys9). Grade: ≥95%. CAS No. 163648-32-6. Molecular formula: C194H304N58O59S4. Mole weight: 4521.17. | |
| ADRENOMEDULLIN (11-50) (RAT) | ADRENOMEDULLIN (11-50) (RAT). Uses: Designed for use in research and industrial production. Additional or Alternative Names: STGCRFGTCTMQKLAHQIYQFTDKDKDGMAPRNKISPQGY-NH2 (DISULFIDE BRIDGE: 4-9);ADRENOMEDULLIN (11-50) (RAT);H-SER-THR-GLY-CYS-ARG-PHE-GLY-THR-CYS-THR-MET-GLN-LYS-LEU-ALA-HIS-GLN-ILE-TYR-GLN-PHE-THR-ASP-LYS-ASP-LYS-ASP-GLY-MET-ALA-PRO-ARG-ASN-LYS-ILE-SER-PRO-GLN-GL. Product Category: Heterocyclic Organic Compound. CAS No. 163648-32-6. Product ID: ACM163648326. Alfa Chemistry ISO 9001:2015 Certified. | |
| Adrenomedullin (1-50), rat | Adrenomedullin (1-50), rat, a 50-amino acid peptide, induces selective arterial vasodilation by activation of the CGRP1 receptor. Synonyms: Tyr-Arg-Gln-Ser-Met-Asn-Gln-Gly-Ser-Arg-Ser-Thr-Gly-Cys-Arg-Phe-Gly-Thr-Cys-Thr-Met-Gln-Lys-Leu-Ala-His-Gln-Ile-Tyr-Gln-Phe-Thr-Asp-Lys-Asp-Lys-Asp-Gly-Met-Ala-Pro-Arg-Asn-Lys-Ile-Ser-Pro-Gln-Gly-Tyr-NH2 (Disulfide bridge: Cys14-Cys19). Grade: ≥95%. Molecular formula: C248H381N77O75S5. Mole weight: 5729.50. | |
| Adrenomedullin (1-52), human | Adrenomedullin is an antimicrobial peptide produced by adrenal medulla, skin, Homo sapiens (Human). It has antibacterial activity against Gram-positive and Gram-negative bacteria. In addition to controlling fluid-electrolyte homeostasis, adrenomedullin is an effective vasodilatory peptide hormone and can inhibit ACTH secretion of pituitary gland. Synonyms: H-Tyr-Arg-Gln-Ser-Met-Asn-Asn-Phe-Gln-Gly-Leu-Arg-Ser-Phe-Gly-Cys(1)-Arg-Phe-Gly-Thr-Cys(1)-Thr-Val-Gln-Lys-Leu-Ala-His-Gln-Ile-Tyr-Gln-Phe-Thr-Asp-Lys-Asp-Lys-Asp-Asn-Val-Ala-Pro-Arg-Ser-Lys-Ile-Ser-Pro-Gln-Gly-Tyr-NH2; L-tyrosyl-L-arginyl-L-glutaminyl-L-seryl-L-methionyl-L-asparagyl-L-asparagyl-L-phenylalanyl-L-glutaminyl-glycyl-L-leucyl-L-arginyl-L-seryl-L-phenylalanyl-glycyl-L-cysteinyl-L-arginyl-L-phenylalanyl-glycyl-L-threonyl-L-cysteinyl-L-threonyl-L-valyl-L-glutaminyl-L-lysyl-L-leucyl-L-alanyl-L-histidyl-L-glutaminyl-L-isoleucyl-L-tyrosyl-L-glutaminyl-L-phenylalanyl-L-threonyl-L-alpha-aspartyl-L-lysyl-L-alpha-aspartyl-L-lysyl-L-alpha-aspartyl-L-asparagyl-L-valyl-L-alanyl-L-prolyl-L-arginyl-L-seryl-L-lysyl-L-isoleucyl-L-seryl-L-prolyl-L-glutaminyl-glycyl-L-tyrosinamide (16->21)-disulfide; Human adrenomedullin; Adrenomedullin (human); Human adrenomedullin-(1-52)-NH2. Grade: >95%. CAS No. 148498-78-6. Molecular formula: C264H406N80O77S3. Mole weight: 6028.82. | |
| Adrenomedullin (16-31), human | Adrenomedullin (16-31), human is the 16-31 fragment of the amino acid residue of human adreomedullin (HADM). Synonyms: H-Cys-Arg-Phe-Gly-Thr-Cys-Thr-Val-Gln-Lys-Leu-Ala-His-Gln-Ile-Tyr-NH2; L-cysteinyl-L-arginyl-L-phenylalanyl-glycyl-L-threonyl-L-cysteinyl-L-threonyl-L-valyl-L-glutaminyl-L-lysyl-L-leucyl-L-alanyl-L-histidyl-L-glutaminyl-L-isoleucyl-L-tyrosinamide (1->6)-disulfide. Grade: ≥95%. CAS No. 318480-38-5. Molecular formula: C82H129N25O21S2. Mole weight: 1865.19. | |
| Adrenomedullin (AM) (13-52), human | Adrenomedullin (AM) (13-52), human is a 40-amino acid peptide that is used as an endothelium-dependent vasodilator agent and a high affinity ligand for the adrenomedullin receptor. Synonyms: Ser-Phe-Gly-Cys-Arg-Phe-Gly-Thr-Cys-Thr-Val-Gln-Lys-Leu-Ala-His-Gln-Ile-Tyr-Gln-Phe-Thr-Asp-Lys-Asp-Lys-Asp-Asn-Val-Ala-Pro-Arg-Ser-Lys-Ile-Ser-Pro-Gln-Gly-Tyr-NH2 (Disulfide bridge: Cys16-Cys21). Grade: ≥95%. CAS No. 154765-05-6. Molecular formula: C200H308N58O59S2. Mole weight: 4533.13. | |
Our database is helping our users find suppliers everyday.
