A directory of where to buy chemicals in the USA, including: distributors, industrial manufacturers, bulk supplies and wholesalers of raw ingredients & finished goods.
Search for products or services, then visit the suppliers website for prices or more information.
| Product | Description | |
|---|---|---|
| Adrenocorticotropic Hormone Fragment 7-38 human | Synonyms: Corticostatin; (7-28)-Corticotropin; Acth(7-38); CIP peptide. CAS No. 68563-24-6. Molecular formula: C167H257N47O46. Mole weight: 3659.11. |  |
| adrenodoxin-NADP+ reductase | A flavoprotein (FAD). The enzyme, which transfers electrons from NADPH to adrenodoxin molecules, is the first component of the mitochondrial cytochrome P-450 electron transfer systems, and is involved in the biosynthesis of all steroid hormones. Group: Enzymes. Synonyms: adrenodoxin reductase; nicotinamide adenine dinucleotide phosphate-adrenodoxin reductase; AdR; NADPH:adrenal ferredoxin oxidoreductase; NADPH-adrenodoxin reductase. Enzyme Commission Number: EC 1.18.1.6. Storage: Store it at +4 ?C for short term. For long term storage, store it at -20 ?C?-80 ?C. Form: Liquid or lyophilized powder. EXWM-1111; adrenodoxin-NADP+ reductase; EC 1.18.1.6; adrenodoxin reductase; nicotinamide adenine dinucleotide phosphate-adrenodoxin reductase; AdR; NADPH:adrenal ferredoxin oxidoreductase; NADPH-adrenodoxin reductase. Cat No: EXWM-1111. |  |
| Adrenomedullin (11-50), rat | Adrenomedullin (11-50), rat is the C-terminal fragment (11-50) of the adrenomedullin in rats. Rat adrenomedullin induces selective arterial vasodilation through CGRP1 receptor. Synonyms: Ser-Thr-Gly-Cys-Arg-Phe-Gly-Thr-Cys-Thr-Met-Gln-Lys-Leu-Ala-His-Gln-Ile-Tyr-Gln-Phe-Thr-Asp-Lys-Asp-Lys-Asp-Gly-Met-Ala-Pro-Arg-Asn-Lys-Ile-Ser-Pro-Gln-Gly-Tyr-NH2 (Disulfide bridge: Cys4-Cys9). Grades: ≥95%. CAS No. 163648-32-6. Molecular formula: C194H304N58O59S4. Mole weight: 4521.17. | |
| ADRENOMEDULLIN (11-50) (RAT) | ADRENOMEDULLIN (11-50) (RAT). Uses: Designed for use in research and industrial production. Additional or Alternative Names: STGCRFGTCTMQKLAHQIYQFTDKDKDGMAPRNKISPQGY-NH2 (DISULFIDE BRIDGE: 4-9);ADRENOMEDULLIN (11-50) (RAT);H-SER-THR-GLY-CYS-ARG-PHE-GLY-THR-CYS-THR-MET-GLN-LYS-LEU-ALA-HIS-GLN-ILE-TYR-GLN-PHE-THR-ASP-LYS-ASP-LYS-ASP-GLY-MET-ALA-PRO-ARG-ASN-LYS-ILE-SER-PRO-GLN-GL. Product Category: Heterocyclic Organic Compound. CAS No. 163648-32-6. Product ID: ACM163648326. Alfa Chemistry ISO 9001:2015 Certified. |  |
| Adrenomedullin (1-50), rat | Adrenomedullin (1-50), rat, a 50-amino acid peptide, induces selective arterial vasodilation by activation of the CGRP1 receptor. Synonyms: Tyr-Arg-Gln-Ser-Met-Asn-Gln-Gly-Ser-Arg-Ser-Thr-Gly-Cys-Arg-Phe-Gly-Thr-Cys-Thr-Met-Gln-Lys-Leu-Ala-His-Gln-Ile-Tyr-Gln-Phe-Thr-Asp-Lys-Asp-Lys-Asp-Gly-Met-Ala-Pro-Arg-Asn-Lys-Ile-Ser-Pro-Gln-Gly-Tyr-NH2 (Disulfide bridge: Cys14-Cys19). Grades: ≥95%. Molecular formula: C248H381N77O75S5. Mole weight: 5729.50. | |
| Adrenomedullin (1-52), human | Adrenomedullin is an antimicrobial peptide produced by adrenal medulla, skin, Homo sapiens (Human). It has antibacterial activity against Gram-positive and Gram-negative bacteria. In addition to controlling fluid-electrolyte homeostasis, adrenomedullin is an effective vasodilatory peptide hormone and can inhibit ACTH secretion of pituitary gland. Synonyms: H-Tyr-Arg-Gln-Ser-Met-Asn-Asn-Phe-Gln-Gly-Leu-Arg-Ser-Phe-Gly-Cys(1)-Arg-Phe-Gly-Thr-Cys(1)-Thr-Val-Gln-Lys-Leu-Ala-His-Gln-Ile-Tyr-Gln-Phe-Thr-Asp-Lys-Asp-Lys-Asp-Asn-Val-Ala-Pro-Arg-Ser-Lys-Ile-Ser-Pro-Gln-Gly-Tyr-NH2; L-tyrosyl-L-arginyl-L-glutaminyl-L-seryl-L-methionyl-L-asparagyl-L-asparagyl-L-phenylalanyl-L-glutaminyl-glycyl-L-leucyl-L-arginyl-L-seryl-L-phenylalanyl-glycyl-L-cysteinyl-L-arginyl-L-phenylalanyl-glycyl-L-threonyl-L-cysteinyl-L-threonyl-L-valyl-L-glutaminyl-L-lysyl-L-leucyl-L-alanyl-L-histidyl-L-glutaminyl-L-isoleucyl-L-tyrosyl-L-glutaminyl-L-phenylalanyl-L-threonyl-L-alpha-aspartyl-L-lysyl-L-alpha-aspartyl-L-lysyl-L-alpha-aspartyl-L-asparagyl-L-valyl-L-alanyl-L-prolyl-L-arginyl-L-seryl-L-lysyl-L-isoleucyl-L-seryl-L-prolyl-L-glutaminyl-glycyl-L-tyrosinamide (16->21)-disulfide; Human adrenomedullin; Adrenomedullin (human); Human adrenomedullin-(1-52)-NH2. Grades: >95%. CAS No. 148498-78-6. Molecular formula: C264H406N80O77S3. Mole weight: 6028.82. | |
| Adrenomedullin (16-31), human | Adrenomedullin (16-31), human is the 16-31 fragment of the amino acid residue of human adreomedullin (HADM). Synonyms: H-Cys-Arg-Phe-Gly-Thr-Cys-Thr-Val-Gln-Lys-Leu-Ala-His-Gln-Ile-Tyr-NH2; L-cysteinyl-L-arginyl-L-phenylalanyl-glycyl-L-threonyl-L-cysteinyl-L-threonyl-L-valyl-L-glutaminyl-L-lysyl-L-leucyl-L-alanyl-L-histidyl-L-glutaminyl-L-isoleucyl-L-tyrosinamide (1->6)-disulfide. Grades: ≥95%. CAS No. 318480-38-5. Molecular formula: C82H129N25O21S2. Mole weight: 1865.19. | |
| Adrenomedullin (AM) (13-52), human | Adrenomedullin (AM) (13-52), human is a 40-amino acid peptide that is used as an endothelium-dependent vasodilator agent and a high affinity ligand for the adrenomedullin receptor. Synonyms: Ser-Phe-Gly-Cys-Arg-Phe-Gly-Thr-Cys-Thr-Val-Gln-Lys-Leu-Ala-His-Gln-Ile-Tyr-Gln-Phe-Thr-Asp-Lys-Asp-Lys-Asp-Asn-Val-Ala-Pro-Arg-Ser-Lys-Ile-Ser-Pro-Gln-Gly-Tyr-NH2 (Disulfide bridge: Cys16-Cys21). Grades: ≥95%. CAS No. 154765-05-6. Molecular formula: C200H308N58O59S2. Mole weight: 4533.13. | |
| Adrenomedullin (AM) (1-52), human TFA | Adrenomedullin (AM) (1-52), human TFA is an adrenomedullin analogue with NH2 terminus truncation that affects cell proliferation and angiogenesis in cancer. Synonyms: Human adrenomedullin-(1-52)-NH2 (TFA); Tyr-Arg-Gln-Ser-Met-Asn-Asn-Phe-Gln-Gly-Leu-Arg-Ser-Phe-Gly-Cys-Arg-Phe-Gly-Thr-Cys-Thr-Val-Gln-Lys-Leu-Ala-His-Gln-Ile-Tyr-Gln-Phe-Thr-Asp-Lys-Asp-Lys-Asp-Asn-Val-Ala-Pro-Arg-Ser-Lys-Ile-Ser-Pro-Gln-Gly-Tyr-NH2.TFA (Disulfide bridge: Cys16-Cys21). Grades: >98%. Molecular formula: C266H407F3N80O79S3. Mole weight: 6142.76. | |
| Adrenomedullin (AM) (1-52), human TFA | Adrenomedullin (AM) (1-52), human (TFA) affects cell proliferation and angiogenesis in cancer. Uses: Scientific research. Group: Peptides. Alternative Names: Human adrenomedullin-(1-52)-NH2 TFA. Pack Sizes: 500 ?g; 1 mg. Product ID: HY-P1455A. |  |
| Adrenomedullin (AM) (22-52), human | Adrenomedullin (AM) (22-52), human, an NH2 terminal truncated adrenomedullin analogue, is an adrenomedullin receptor antagonist, and also antagonizes the calcitonin generelated peptide (CGRP) receptor in the hindlimb vascular bed of the cat[1][2]. Uses: Scientific research. Group: Peptides. Alternative Names: 22-52-Adrenomedullin (human). CAS No. 159899-65-7. Pack Sizes: 500 ?g; 1 mg; 5 mg. Product ID: HY-P1471. | |
| Adrenomedullin (AM) (22-52), human | Adrenomedullin (AM) (22-52), human, an adrenomedullin analogue with NH2 terminus truncation, is an adrenomedullin receptor antagonist that also antagonizes calcitonin-generating peptide (CGRP) receptors in the vascular bed of the hindlimb of cats. Synonyms: 22-52-Adrenomedullin (human); Thr-Val-Gln-Lys-Leu-Ala-His-Gln-Ile-Tyr-Gln-Phe-Thr-Asp-Lys-Asp-Lys-Asp-Asn-Val-Ala-Pro-Arg-Ser-Lys-Ile-Ser-Pro-Gln-Gly-Tyr-NH2; L-threonyl-L-valyl-L-glutaminyl-L-lysyl-L-leucyl-L-alanyl-L-histidyl-L-glutaminyl-L-isoleucyl-L-tyrosyl-L-glutaminyl-L-phenylalanyl-L-threonyl-L-alpha-aspartyl-L-lysyl-L-alpha-aspartyl-L-lysyl-L-alpha-aspartyl-L-asparagyl-L-valyl-L-alanyl-L-prolyl-L-arginyl-L-seryl-L-lysyl-L-isoleucyl-L-seryl-L-prolyl-L-glutaminyl-glycyl-L-tyrosinamide. Grades: ≥95%. CAS No. 159899-65-7. Molecular formula: C159H252N46O48. Mole weight: 3575.97. | |
| Adrenomedullin Fragment 22-52 human | ?97% (HPLC). Group: Fluorescence/luminescence spectroscopy. |  |
| Adrenomedullin (porcine) | Synonyms: ADM (porcine); H-Tyr-Arg-Gln-Ser-Met-Asn-Asn-Phe-Gln-Gly-Leu-Arg-Ser-Phe-Gly-Cys-Arg-Phe-Gly-Thr-Cys-Thr-Val-Gln-Lys-Leu-Ala-His-Gln-Ile-Tyr-Gln-Phe-Thr-Asp-Lys-Asp-Lys-Asp-Gly-Val-Ala-Pro-Arg-Ser-Lys-Ile-Ser-Pro-Gln-Gly-Tyr-NH2 (Disulfide bridge: Cys16-Cys21); Adrenomedullin (1-52), porcine. Grades: ≥95%. CAS No. 912862-96-5. Molecular formula: C262H403N79O76S3. Mole weight: 5971.77. | |
| Adrenomedullin (rat) | Adrenomedullin (rat), a synthetic rat adrenomedullin (rADM), induces a potent and sustained hypotensive activity in anesthesized rats. Synonyms: ADM (1-50) (rat); H-Tyr-Arg-Gln-Ser-Met-Asn-Gln-Gly-Ser-Arg-Ser-Thr-Gly-Cys-Arg-Phe-Gly-Thr-Cys-Thr-Met-Gln-Lys-Leu-Ala-His-Gln-Ile-Tyr-Gln-Phe-Thr-Asp-Lys-Asp-Lys-Asp-Gly-Met-Ala-Pro-Arg-Asn-Lys-Ile-Ser-Pro-Gln-Gly-Tyr-NH2 (Disulfide bridge: Cys14-Cys19). Grades: ≥95%. CAS No. 161383-47-7. Molecular formula: C242H381N77O75S5. Mole weight: 5729.49. | |
| Adrenomedullin (rat) | Adrenomedullin (rat) is an effective vasodilator peptide. Adrenomedullin is actively secreted by endothelial cells (EC) and vascular smooth muscle cells (VSMC) [1]. Uses: Scientific research. Group: Peptides. CAS No. 161383-47-7. Pack Sizes: 1 mg; 5 mg; 10 mg. Product ID: HY-P4853. | |
| Adrenorphin | Adrenorphin is an opioid octapeptide that acts as an agonist of μ-opioid receptor. Synonyms: L-Valinamide, L-tyrosylglycylglycyl-L-phenylalanyl-L-methionyl-L-arginyl-L-arginyl-; L-Tyrosylglycylglycyl-L-phenylalanyl-L-methionyl-L-arginyl-L-arginyl-L-valinamide; Adrenorphin (human); Adrenorphin (ox); BAM 8; Metaphinamide; Metorphamide; Metorphamide (ox); Metorphinamide; H-Tyr-Gly-Gly-Phe-Met-Arg-Arg-Val-NH2. Grades: >95%. CAS No. 88377-68-8. Molecular formula: C44H69N15O9S. Mole weight: 984.18. | |
| Adrenorphin TFA | Adrenorphin TFA is an opioid octapeptide that acts as an agonist of μ-opioid receptor with a Ki of 12 nM. Synonyms: Adrenorphin (human), trifluoroacetate (salt); L-Tyrosylglycylglycyl-L-phenylalanyl-L-methionyl-L-arginyl-L-arginyl-L-valinamide trifluoroacetate; Adrenorphin (ox) trifluoroacetat; BAM 8 trifluoroacetate; Metaphinamide trifluoroacetate; Metorphamide trifluoroacetate; Metorphamide (ox) trifluoroacetate; Metorphinamide trifluoroacetate; H-Tyr-Gly-Gly-Phe-Met-Arg-Arg-Val-NH2.TFA; Adrenorphin 3TFA. Grades: ≥95%. Molecular formula: C46H70F3N15O11S. Mole weight: 1098.22. | |
| Adrenosterone | Steroid hormone with weak androgenic effects. Group: Biochemicals. Alternative Names: Androst-4-ene-3,11,17-trione; 11-Keto-4-androstene-3,17-dione; 11-Oxo-4-androstene-3,17-dione; Reichstein's substance G; NSC 12166. Grades: Highly Purified. CAS No. 382-45-6. Pack Sizes: 500mg. US Biological Life Sciences. |  Worldwide |
| Adriamycinone | Adriamycinone. Uses: Designed for use in research and industrial production. Additional or Alternative Names: Adriamycinone;Doxorubicinone. Product Category: Heterocyclic Organic Compound. Appearance: Red Solid. CAS No. 24385-10-2. Molecular formula: C21H18O9. Mole weight: 414.36. Product ID: ACM24385102. Alfa Chemistry ISO 9001:2015 Certified. | |
| Adriforant hydrochloride | Adriforant hydrochloride (PF-3893787 hydrochloride) is a novel histamine H4 receptor antagonist binding affinity ( K i =2.4 nM) and is also a functional ( K i =1.56 nM) antagonist. Uses: Scientific research. Group: Signaling pathways. Alternative Names: PF-3893787 hydrochloride. CAS No. 2096455-90-0. Pack Sizes: 10 mM * 1 mL; 5 mg; 10 mg; 50 mg; 100 mg. Product ID: HY-19705B. | |
| Adrogolide | Adrogolide,a quinoline derivative, has been found to be a dopamine D1 receptor agonist that was once studied in Parkinson's disease. Synonyms: A-86929;9,10-Dihydroxy-2-propyl-4,5,5a(R),6,7,11b(S)-hexahydrobenzo[f]thieno[2,3-c]quinoline. Grades: 98%. CAS No. 171752-56-0. Molecular formula: C22H25NO4S. Mole weight: 399.51. | |
| Adrogolide hydrochloride | Adrogolide hydrochloride (ABT-431 hydrochloride) is a chemically stable prodrug that can convert to the dopamine D1 receptor agonist A-86929. Adrogolide hydrochloride ameliorates the MPTP (HY-15608)-induced Parkinson's Disease in marmoset model, reduces the dyskinesias tendency. Adrogolide hydrochloride reverses Risperidone (HY-11018)-induced cognitive deficits in monkey [1]. Uses: Scientific research. Group: Signaling pathways. Alternative Names: ABT-431 hydrochloride; DAS-431 hydrochloride. CAS No. 166591-11-3. Pack Sizes: 1 mg. Product ID: HY-118956. | |
| Adropin (34-76) (human, mouse, rat) | Adropin, a secreted factor involved in energy homeostasis and lipid metabolism, is encoded by the energy homeostasis-related gene (Enho) and expressed in the liver and brain. In diet-induced obesity (DIO) mice, adropin (34-76) reduced hepatosteatosis and insulin resistance, regardless of obesity or food intake. In addition, adropin could be a regulator of endothelial function. Synonyms: H-Cys-His-Ser-Arg-Ser-Ala-Asp-Val-Asp-Ser-Leu-Ser-Glu-Ser-Ser-Pro-Asn-Ser-Ser-Pro-Gly-Pro-Cys-Pro-Glu-Lys-Ala-Pro-Pro-Pro-Gln-Lys-Pro-Ser-His-Glu-Gly-Ser-Tyr-Leu-Leu-Gln-Pro-OH (Disulfide bridge: Cys1-Cys23); L-Cysteinyl-L-histidyl-L-seryl-L-arginyl-L-seryl-L-alanyl-L-alpha-aspartyl-L-valyl-L-alpha-aspartyl-L-seryl-L-leucyl-L-seryl-L-alpha-glutamyl-L-seryl-L-seryl-L-prolyl-L-asparaginyl-L-seryl-L-seryl-L-prolylglycyl-L-prolyl-L-cysteinyl-L-prolyl-L-alpha-glutamyl-L-lysyl-L-alanyl-L-prolyl-L-prolyl-L-prolyl-L-glutaminyl-L-lysyl-L-prolyl-L-seryl-L-histidyl-L-alpha-glutamylglycyl-L-seryl-L-tyrosyl-L-leucyl-L-leucyl-L-glutaminyl-L-proline cyclic (1?23)-disulfide. Grades: ≥95%. CAS No. 1802086-30-1. Molecular formula: C190H293N55O68S2. Mole weight: 4499.82. | |
| Adropin (34-76) (human, mouse, rat) | Adropin (34-76) is a secretory domain of Adropin. Adropin (34-76) can inhibit cAMP level and glucose production in hepatocytes, and has a hypoglycemic effect. Adropin (34-76) plays an antifibrotic role by inhibiting the GLI1 signaling pathway [1] [2]. Uses: Scientific research. Group: Peptides. CAS No. 1802086-30-1. Pack Sizes: 1 mg; 5 mg; 10 mg. Product ID: HY-P4860. | |
| ADS032 | ADS032 is a sulfonylurea compound that is an NLRP1 and NLRP3 inflammasome inhibitor. ADS032 reduces the secretion of inflammatory factors and inhibits the oligomerization of ASC. ADS032 has anti-inflammatory effects in a variety of inflammatory models and can be used in the study of inflammatory diseases[1]. Uses: Scientific research. Group: Signaling pathways. CAS No. 2757333-37-0. Pack Sizes: 10 mM * 1 mL; 5 mg; 10 mg; 25 mg; 50 mg; 100 mg. Product ID: HY-156798. | |
| ADT-007 | ADT-007 is a potent and orally active pan-RAS inhibitor with strong anticancer effects. ADT-007 binds RAS in a nucleotide-free conformation to block GTP activation. ADT-007 potently and selectively inhibits the growth of cancer cells with mutated or hyper-activated wild-type RAS isozymes[1]. Uses: Scientific research. Group: Signaling pathways. CAS No. 1945941-09-2. Pack Sizes: 10 mM * 1 mL; 5 mg; 10 mg; 25 mg; 50 mg; 100 mg. Product ID: HY-157887. | |
| a-D-Thiomannose sodium salt | A-D-Thiomannose sodium salt, hailed for its biomedicinal potential, is a chemical compound of great interest. Known for its participation in glycosylation and oligosaccharide synthesis, it is celebrated for its perceived therapeutic value in treating bacterial infections and preventing cancer. While much work remains to be done, it is a substance ripe for further exploration and experimentation. CAS No. 111057-34-2. Molecular formula: C6H11O5S.Na. Mole weight: 218.21. | |
| ADT-OH | ADT-OH is a hydrogen sulfide-releasing donor. ADT-OH induces apoptosis and upregulates FADD. ADT-OH inhibits FAK/Paxillin. ADT-OH has the potential for the research of cancer diseases [1] [5]. Uses: Scientific research. Group: Signaling pathways. Alternative Names: 5-(4-Hydroxyphenyl)-3H-1,2-dithiole-3-thione; ACS 1. CAS No. 18274-81-2. Pack Sizes: 10 mM * 1 mL; 5 mg; 10 mg; 25 mg; 50 mg; 100 mg. Product ID: HY-109582. | |
| ADT-OH | ADT-OH is a derivative of anethole dithiolethione (ADT) and synthetic hydrogen sulfide (H2S) donor. ADT is a putative neuroprotectant and antioxidant that increases glutathione levels in cultured astroglial cells. ADT-OH was shown to reduce tPA-enhanced Akt activation and VEGF expression in brain microvascular endothelial cells. Synonyms: 5-(4-hydroxyphenyl)-3H-1,2-dithiole-3-thione; Desmethylanethol trithione; 3H-1,2-Dithiole-3-thione, 5-(4-hydroxyphenyl)-. CAS No. 18274-81-2. Molecular formula: C9H6OS3. Mole weight: 226.326. | |
| AdTx1 | AdTx1 is a high affinity, selective and non-competitive α1A adrenoceptor antagonist with Ki value of 0.35 nM. It is a 65 amino-acid peptide originally isolated from the venom of the green mamba. It is stabilized by four disulfide bridges and belongs to the family of the three-finger-fold peptide. It displays no significant activity against a range of other GPCRs. It antagonizes effects of phenylephrine on intra-urethral pressure in rats and on isolated rabbit prostate muscle in vitro. It is used as a potent relaxant of smooth muscles. Synonyms: ρ-Da1a. Grades: >98%. Molecular formula: C310H481N87O100S8. Mole weight: 7283.22. | |
| Aducanumab | Aducanumab (BIIB037) is a human monoclonal antibody that selectively targets aggregated amyloid-beta (Aβ). Aducanumab shows brain penetration, and can be used for Alzheimer's disease (AD) research [1]. Uses: Scientific research. Group: Inhibitory antibodies. Alternative Names: BIIB037. CAS No. 1384260-65-4. Pack Sizes: 1 mg; 5 mg; 10 mg. Product ID: HY-P9967. | |
| Aducanumab | Aducanumab is a human monoclonal antibody targeting amyloid-β (Aβ). Aducanumab has been approved for the treatment of Alzheimer's disease (AD). Synonyms: BIIB037. CAS No. 1384260-65-4. | |
| a-D-[UL-13C6]Glucose-1-phosphate dipotassium salt hydrate | a-D-[UL-13C6]Glucose-1-phosphate dipotassium salt hydrate is a biomedical compound, serving the purpose of labeling and monitoring glucose metabolism in diverse biochemical investigations. Its distinctive attributes, encompassing stable isotope 13C and potassium salt formulation, render it remarkably proficient in dissecting intricate glucose metabolic pathways. This remarkable substance plays a pivotal role in unraveling the intricate interplay between glucose utilization and its consequential effect on crucial cellular processes. | |
| ADU-S100 ammonium salt | ML RR-S2 CDA ammonium salt is an inducer of stimulator of interferon genes (STING). It can increases type I interferon production by THP-1 human monocytes relative to unmodified cyclic di-AMP, indicating the ML enhances its action at human STING. Synonyms: MIW815 ammonium salt; ML RR-S2 CDA ammonium salt; [P(R)]-5'-O-[(R)-hydroxymercaptophosphinyl]-P-thioadenylyl-(2'?5')-adenosine, cyclic nucleotide, diammonium salt; STING Inducer-1. Grades: 98%. CAS No. 1638750-96-5. Molecular formula: C20H30N12O10P2S2. Mole weight: 724.6. | |
| ADU-S100 disodium salt | ADU-S100 disodium salt (MIW815 disodium salt) is an activator of stimulator of interferon genes (STING) for treating cancer. Synonyms: MIW815 disodium salt; ML RR-S2 CDA disodium salt; 2',3'-c-di-AM(PS)2 (Rp,Rp); Adenosine, [P(R)]-5'-O-[(R)-hydroxymercaptophosphinyl]-P-thioadenylyl-(2'?5')-, cyclic nucleotide, sodium salt (1:2); ADU-S 100; MIW 815. Grades: 98%. CAS No. 1638750-95-4. Molecular formula: C20H22N10Na2O10P2S2. Mole weight: 734.51. | |
| Adustin | Akrabicin is an antibiotic produced in Streptomyces galactis against yeast and tinea mold. Synonyms: (3-Hydroxy-2-furanyl)phenylmethanone; Methanone, (3-hydroxy-2-furanyl)phenyl-; (2E)-2-[hydroxy(phenyl)methylidene]furan-3-one; 2-Benzoyl-3-hydroxyfuran. CAS No. 69579-74-4. Molecular formula: C11H8O3. Mole weight: 188.18. | |
| Advantame | Advantame is a combination of Aspartame (A790015) and Vanillin (V097500). Advantame was developed as a high-intensity, low calorie sweetener that is 20,000 times sweeter than sucrose. Group: Biochemicals. Grades: Highly Purified. CAS No. 245650-17-3. Pack Sizes: 10mg, 25mg. Molecular Formula: C24H30N2O7. US Biological Life Sciences. | Worldwide |
| Advantame | Advantame is a non-caloric artificial sweetener, analogue of aspartame, commonly used as a food additive [1]. Uses: Scientific research. Group: Signaling pathways. CAS No. 714229-20-6. Pack Sizes: 10 mM * 1 mL; 5 mg; 10 mg; 25 mg; 50 mg; 100 mg. Product ID: HY-122351A. | |
| ADW742 | NVP-ADW742 is a novel small weight molecular inhibitor of IGF-IR with potential anticancer activity. NVP-ADW742 inhibited IGF-IR-mediated proliferation with an IC50 of 11.12 μmol/l. NVP-ADW742 induced early suppression of Akt, P38 and GSK-3β phosphorylation. NVP-ADW742 was found to suppresse survival and resistance to chemotherapy in acute myeloid leukemia cells. Synonyms: NVP-ADW742; NVP ADW-742; NVP ADW 742; ADW 742; ADW-742; ADW742; GSK 552602A; GSK-552602A; GSK552602A. Grades: 0.98. CAS No. 475488-23-4. Molecular formula: C28H31N5O. Mole weight: 453.59. | |
| ADWX 1 | ADWX 1. Group: Biochemicals. Grades: Highly Purified. Pack Sizes: 100ug. US Biological Life Sciences. | Worldwide |
| ADWX 1 | ADWX 1 has been found to be a Kv1.3 channel blocker and could probably ameliorate autoimmune encephalomyelitis at some extent. Synonyms: ADWX1. Grades: >98%. Molecular formula: C169H281N57O46S7. Mole weight: 4071.86. | |
| ADX 10059 hydrochloride | The hydrochloride salt form of ADX 10059, which has been reported to be a negative allosteric modulator. Synonyms: ADX-10059 Hydrochloride; ADX10059 Hydrochloride; ADX 10059 Hydrochloride; ADX10059 HCl; 2-[(3-Fluorophenyl)ethynyl]-4,6-dimethyl-3-pyridinamine hydrochloride. Grades: ≥99% by HPLC. CAS No. 757949-98-7. Molecular formula: C15H13FN2.HCl. Mole weight: 276.74. | |
| ADX 10059 hydrochloride | ADX 10059 hydrochloride. Group: Biochemicals. Grades: Purified. CAS No. 757949-98-7. Pack Sizes: 10mg, 50mg. US Biological Life Sciences. | Worldwide |
| ADX-47273 | ?98% (HPLC). Group: Fluorescence/luminescence spectroscopy. | |
| ADX-47273 | ADX-47273 is a drug used in scientific research which acts as a positive allosteric modulator selective for the metabotropic glutamate receptor subtype mGluR5. Synonyms: TKI-258 Dilactic Acid; TKI 258 Dilactic Acid; TKI258 Dilactic Acid; ADX-47273; ADX 47273; ADX47273. Grades: >98%. CAS No. 851881-60-2. Molecular formula: C20H17F2N3O2. Mole weight: 369.36. | |
| ADX-47273 | ADX-47273 is a potent, selective and brain-penetrant mGluR5 positive allosteric modulator (PAM), with an EC 50 of 0.17 μM for potentiation of glutamate (50 nM) response. ADX-47273 has antipsychotic and procognitive activities [1] [2]. Uses: Scientific research. Group: Signaling pathways. CAS No. 851881-60-2. Pack Sizes: 10 mM * 1 mL; 5 mg; 10 mg; 50 mg; 100 mg. Product ID: HY-13058. | |
| ADX71743 | ?98% (HPLC). Group: Fluorescence/luminescence spectroscopy. | |
| ADX71743 | ADX71743 is a highly selective, noncompetitive and brain-penetrant metabotropic glutamate receptor 7 negative allosteric modulator ( mGlu7 NAM ). ADX71743 has anxiolytic-like activity [1] [2]. Uses: Scientific research. Group: Signaling pathways. CAS No. 1431641-29-0. Pack Sizes: 1 mg; 5 mg. Product ID: HY-110278. | |
| ADX88178 | This active molecular is a selectiveMetabotropic glutamate receptor 4 agonist and modulator under the development of Addex Therapeutics. In the marble burying test, ADX88178 can reduce the number of buried marbles Meanwhile, in the EPM (elevated plus maze) test, it can also increase open-arm exploration, indicative of anxiolytic-like efficacy. Now, preclinical trials for Anxiety disorders, Cocaine abuse, Multiple sclerosis and Parkinson's diseas were on-going. Uses: Anxiety disorders; cocaine abuse; multiple sclerosis; parkinson's disease. Synonyms: ADX-88178; ADX 88178; ADX88178. SCHEMBL369060; GTPL6238; SCHEMBL 369060; GTPL 6238; SCHEMBL-369060; GTPL-6238; 5-methyl-N-(4-methylpyrimidin-2-yl)-4-(1H-pyrazol-4-yl)-1,3-thiazol-2-amine. Grades: 98%. CAS No. 1235318-89-4. Molecular formula: C12H12N6S. Mole weight: 272.33. | |
| Adxanthromycin A | Adxanthromycin A, a new inhibitor of ICAM-1/LFA-1 mediated cell adhesion from Streptomyces sp. NA-148. Molecular formula: C42H40O17. Mole weight: 816.76. | |
| Adxanthromycin B | Adxanthromycin B, a new inhibitor of ICAM-1/LFA-1 mediated cell adhesion from Streptomyces sp. NA-148. Molecular formula: C48H50O22. Mole weight: 978.90. | |
| a-D-Xylopyranoside,4-nitrophenyl | a-D-Xylopyranoside,4-nitrophenyl. Uses: Designed for use in research and industrial production. Additional or Alternative Names: PNPX, p-Nitrophenyl-alpha-D-xyloside, CID82482, EINECS 233-572-7, p-Nitrophenyl alpha-D-xylopyranoside, 10238-28-5. Product Category: Heterocyclic Organic Compound. Appearance: WHITE TO OFF-WHITE POWDER. CAS No. 10238-28-5. Molecular formula: C11H13NO7. Mole weight: 271.2234. Purity: 0.96. IUPACName: (2R,3R,4S,5R)-2-(4-nitrophenoxy)oxane-3,4,5-triol. Canonical SMILES: C1C(C(C(C(O1)OC2=CC=C(C=C2)[N+](=O)[O-])O)O)O. Density: 1.597 g/cm³. ECNumber: 233-572-7. Product ID: ACM10238285. Alfa Chemistry ISO 9001:2015 Certified. | |
| a-D-Xylopyranosyl azide | a-D-Xylopyranosyl azide is a crucial compound in the research and development of various drugs targeting glycogen metabolism disorders and bacterial infections. With its azide group is a-D-Xylopyranosyl azide plays a vital role in drug discovery and development to combat diseases such as diabetes, cancer and compound-resistant infections. CAS No. 100842-21-5. | |
| AE-37 | Cas No. 195615-83-9. | |
| AE9C90CB | ?98% (HPLC). Group: Fluorescence/luminescence spectroscopy. | |
| AEA-d11 | AEA-d11. Group: Others. Purity: >99%. Mole weight: 358.602. Stability: 3 Months. Storage: -20°C. Avanti Polar Lipids; lipid products; bioactive lipids; fluorescent lipids; singnal transduction; cell pathways; AEA-d11; C20:4 anandamide-d11. Cat No: FLBZ-098. | |
| AEA-[d11] | AEA-[d11] is the labelled analogue of AEA, which has a role as a neurotransmitter, a vasodilator agent and a human blood serum metabolite. Synonyms: C20:4 anandamide-d11; AEA-d11; (5Z, 8Z, 11Z, 14Z)-N-(2-Hydroxyethyl)(16, 16, 17, 17, 18, 18, 19, 19, 20, 20, 20-2H11)-5, 8, 11, 14-icosatetraenamide; 5,8,11,14-Eicosatetraenamide-16,16,17,17,18,18,19,19,20,20,20-d11, N-(2-hydroxyethyl)-, (5Z,8Z,11Z,14Z)-; Anandamide-d11; Arachidonylethanolamide-d11; N-Arachidonoylethanolamine-d11; N-Arachidonoyl-2-hydroxyethylamide-d11; Arachidonoyl-EA-d11; N-(2-Hydroxyethyl)anachidonamide-d11; 5,8,11,14-Eicosatetraenoylethanolamide-d11; Anandamide(20:4, n-6)-d11. Grades: >99%. CAS No. 2260669-86-9. Molecular formula: C22H26D11NO2. Mole weight: 358.60. | |
| AEA-d4 | AEA-d4. Group: Others. Synonyms: 5Z,8Z,11Z,14Z-eicosatetraenoylethanolaminde-d4. Purity: >99%. Mole weight: 351.559. Stability: 3 Months. Storage: -20°C. Avanti Polar Lipids; lipid products; bioactive lipids; fluorescent lipids; singnal transduction; cell pathways; 5Z,8Z,11Z,14Z-eicosatetraenoylethanolaminde-d4; AEA-d4; C20:4 ananadamide-d4. Cat No: FLBZ-101. | |
| AEB-1102 | AEB-1102 is a derivative of human arginase that is more effective and stable for argine levels modulation compared to native human arginase I. It is potentially used as a therapeutic for the degradation of arginine. Uses: Arginase derivative. Synonyms: pegzilarginase; AEB-1102; AEB 1102; AEB1102. | |
| AEBP2 human | recombinant, expressed in baculovirus infected Sf9 cells, ?48% (SDS-PAGE). Group: Fluorescence/luminescence spectroscopy. | |
| AEBSF HCl | AEBSF is a water-soluble, irreversible serine protease inhibitor that inhibits proteases like chymotrypsin, kallikrein, plasmin, thrombin, and trypsin. Synonyms: 4-(2-Aminoethyl)benzenesulfonyl fluoride hydrochloride; AEBSF hydrochloride; AEBSF. Grades: 98%. CAS No. 30827-99-7. Molecular formula: C8H11ClFNO2S. Mole weight: 239.69. | |
| AEBSF hydrochloride | AEBSF hydrochloride is an irreversible inhibitor of serine proteases , such as chymotrypsin, kallikrein, plasmin, thrombin, and trypsin. Uses: Scientific research. Group: Signaling pathways. CAS No. 30827-99-7. Pack Sizes: 10 mM * 1 mL; 100 mg; 200 mg. Product ID: HY-12821. | |
| AEBSF hydrochloride (4-(2-Aminoethyl) benzenesulfonyl fluoride hydrochloride) | 500mg Pack Size. Group: Biochemicals. Formula: C8H10FNO2S ·HCl. CAS No. 30827-99-7. Prepack ID 11939321-500mg. Molecular Weight 239.7. See USA prepack pricing. |  |
| AEC Red Substrate Kit, BioAssay (aminoethyl carbazole), Chromogen Solution (20X) | AEC Red Substrate Kit, BioAssay (aminoethyl carbazole), Chromogen Solution (20X). Group: Molecular Biology. Pack Sizes: 12ml. US Biological Life Sciences. | Worldwide |
| AEC Red Substrate Kit, BioAssay (aminoethyl carbazole), Hydrogen Peroxide Solution (20X) | AEC Red Substrate Kit, BioAssay (aminoethyl carbazole), Hydrogen Peroxide Solution (20X). Group: Molecular Biology. Pack Sizes: 12ml. US Biological Life Sciences. | Worldwide |
| AEC Red Substrate Kit, BioAssay (aminoethyl carbazole), Substrate Buffer (20X) | AEC Red Substrate Kit, BioAssay (aminoethyl carbazole), Substrate Buffer (20X). Group: Molecular Biology. Pack Sizes: 12ml. US Biological Life Sciences. | Worldwide |
| AEE788 | AEE788 is an inhibitor of the EGFR and ErbB2 with IC 50 values of 2 and 6 nM, respectively. Uses: Scientific research. Group: Signaling pathways. Alternative Names: NVP-AEE 788. CAS No. 497839-62-0. Pack Sizes: 10 mM * 1 mL; 5 mg; 10 mg; 50 mg; 100 mg. Product ID: HY-10045. | |
| AEE788 | ?98% (HPLC). Group: Fluorescence/luminescence spectroscopy. | |
| AEE 788 | AEE 788. Group: Biochemicals. Grades: Purified. CAS No. 497839-62-0. Pack Sizes: 10mg, 50mg. US Biological Life Sciences. | Worldwide |
Our database is helping our users find suppliers everyday.
