American Chemical Suppliers
A directory of where to buy chemicals in the USA, including: distributors, industrial manufacturers, bulk supplies and wholesalers of raw ingredients & finished goods.
Search for products or services, then visit the suppliers website for prices or more information.
Product | Description | |
---|---|---|
CJ-12954 Quick inquiry Where to buy Suppliers range | It is produced by the strain of Phanerochaete velutina CL6387. CJ-12954 has strong anti-helicobacter pylori activity. Synonyms: (3R)-5,7-Dimethoxy-3-{6-[(2R,5R)-7-methyl-1,6-dioxaspiro[4.4]non-2-yl]hexyl}-2-benzofuran-1(3H)-one. Molecular formula: C24H34O6. Mole weight: 418.52. | |
CJ-13014 Quick inquiry Where to buy Suppliers range | It is produced by the strain of Phanerochaete velutina CL6387. CJ-13014 is stereoisomer with CJ-12954 and it has strong anti-helicobacter pylori activity. Molecular formula: C24H34O6. Mole weight: 418.52. | |
CJ-13136 Quick inquiry Where to buy Suppliers range | CJ-13136 is originally isolated from Pseudonocardia sp. CL38489. It has highly selective anti-helicobacter pylori activity. Synonyms: 3-Methyl-2-((2E)-3,7-dimethyl-2,6-octenyl)quinoline-4(1H)-one; SCHEMBL14519803. Molecular formula: C20H25NO. Mole weight: 295.42. | |
CJ-13610 Quick inquiry Where to buy Suppliers range | CJ-13610 is an inhibitor of 5-lipoxygenase (5-LO). It inhibits 5-LO product formation in human polymorphonuclear leukocytes (PMNLs) challenged with A23187 in vitro. It also inhibits 5-LO product formation induced by phosphorylation in PMNLs and HeLa cells. Synonyms: 4-[3-[4-(2-methylimidazol-1-yl)phenyl]sulfanylphenyl]oxane-4-carboxamide; Tetrahydro-4-[3-[[4-(2-methyl-1H-imidazol-1-yl)phenyl]thio]phenyl]-2H-pyran-4-carboxamide. Grades: ≥98%. CAS No. 179420-17-8. Molecular formula: C22H23N3O2S. Mole weight: 393.5. | |
CJ-13981 Quick inquiry Where to buy Suppliers range | It is originally isolated from CL15036. CJ-13981 inhibited SSASE in rat liver and human liver with IC50 of 4.4 μmol/L and 2.8 μmol/L respectively. Molecular formula: C18H30O6. Mole weight: 342.43. | |
CJ 14258 Quick inquiry Where to buy Suppliers range | CJ 14258, produced by the strain of Hericium ramosum CL 24240, is a selective binding inhibitor of κ-opioid receptor with IC50 of 32 μmol/L. Synonyms: Antibiotic CJ 14258; (12S,15S)-15-O-Demethyl-10,29-dideoxy-11,12-dihydro-striatin C. Molecular formula: C25H38O6. Mole weight: 434.56. | |
CJ-14877 Quick inquiry Where to buy Suppliers range | It is originally isolated from Marasmiellus sp. CL21624. CJ-14877 inhibited human blood interleukin-1β (IL-1β) production induced by lipoglycan (LPS) with an IC50 of 0.1 μmol/L. Synonyms: 2-Pyridinecarboxylic acid, 5-[(1S,2S)-1,2-dihydroxypropyl]-, methyl ester. Molecular formula: C10H13NO4. Mole weight: 211.21. | |
CJ-14897 Quick inquiry Where to buy Suppliers range | It is originally isolated from Marasmiellus sp. CL21624. CJ-14897 inhibited human blood interleukin-1β (IL-1β) production induced by lipoglycan (LPS) with an IC50 of 0.059 μmol/L. Synonyms: (+)-CJ-14897; 2-Pyridinecarboxylic acid, 5-((1S,2S)-2-(acetyloxy)-1-hydroxypropyl)-, methyl ester; UNII-10M04QP59K. CAS No. 377755-95-8. Molecular formula: C12H15NO5. Mole weight: 253.25. | |
CJ-15161 Quick inquiry Where to buy Suppliers range | CJ-15161 is a κ-opioid receptor agonist. Synonyms: CJ 15161; CJ15161; 4-(((S)-2-((S)-3-Hydroxypyrrolidin-1-yl)-1-phenylethyl)(methyl)amino)-N-propylbenzamide. CAS No. 204970-97-8. Molecular formula: C23H31N3O2. Mole weight: 381.52. | |
CJ-15183 Quick inquiry Where to buy Suppliers range | CJ-15183 is originally isolated from Aspergillus aculeatus CL38916. It has strong inhibitory activity against rat liver, human liver and Candida albicans SSase, and has antifungal activity against filamentous fungi and yeast-like fungi. Molecular formula: C28H38O13. Mole weight: 582.59. | |
CJ-15208 Quick inquiry Where to buy Suppliers range | CJ-15208 is produced by the strain of Ctenomyces serratus. It selectively inhibits κ-opioid receptor binding with an IC50 of 47 nmol/L. Synonyms: (3S,6S,9S,14aR)-6-((1H-indol-3-yl)methyl)-3,9-dibenzyldecahydropyrrolo[1,2-a][1,4,7,10]tetraazacyclododecine-1,4,7,10-tetraone; c[L-Phe-D-pro-L-Phe-L-trp]. CAS No. 210236-47-8. Molecular formula: C34H35N5O4. Mole weight: 577.67. | |
CJ 15544 Quick inquiry Where to buy Suppliers range | CJ 15544 is a potent κ-opioid receptor antagonist from a fungus, Hericium ramosum CL 24240. Synonyms: Antibiotic CJ 15544. Molecular formula: C25H34O6. Mole weight: 430.53. | |
CJ-15696 Quick inquiry Where to buy Suppliers range | CJ-15696 is a furopyridine antibiotic produced by the strain of Cladobotryum varium CL12284. It has moderate activity against gram-positive bacteria, including drug-resistant bacteria. Molecular formula: C19H19NO3. Mole weight: 309.36. | |
CJ-15801 Quick inquiry Where to buy Suppliers range | It is originally isolated from Seimatosporium sp. CL28611. CJ-15801 has only anti-MRSA activity with MIC of 6.25-50 μg/mL. Synonyms: CJ-15,801; BDBM50285609; 3-[[(R)-2,4-Dihydroxy-3,3-dimethylbutanoyl]amino]acrylic acid. Molecular formula: C9H15NO5. Mole weight: 217.22. | |
CJ-16169 Quick inquiry Where to buy Suppliers range | CJ-16169 is a furopyridine antibiotic produced by the strain of Cladobotryum varium CL12284. It has weak activity against gram-positive bacteria. Molecular formula: C19H21NO3. Mole weight: 311.37. | |
CJ-16170 Quick inquiry Where to buy Suppliers range | CJ-16170 is a furopyridine antibiotic produced by the strain of Cladobotryum varium CL12284. It has weak activity against gram-positive bacteria. Molecular formula: C19H21NO3. Mole weight: 311.37. | |
CJ-16173 Quick inquiry Where to buy Suppliers range | CJ-16173 is a furopyridine antibiotic produced by the strain of Cladobotryum varium CL12284. It has weak activity against gram-positive bacteria. Molecular formula: C19H19NO4. Mole weight: 325.36. | |
CJ-16367 Quick inquiry Where to buy Suppliers range | It is originally isolated from CL39457. CJ-16367 is mainly resistant to Gram-positive bacteria, including multi-drug resistant strains, but its activity is weak. Molecular formula: C23H31NO5. Mole weight: 401.49. | |
CJ-17572 Quick inquiry Where to buy Suppliers range | It is produced by the strain of Pezicula sp. CJ-11877. CJ-17572 has anti-MRSA and Enterococcus faecalis activity with MIC of 10-20 μg/mL. Synonyms: 3-[hydroxy(1,2,6-trimethyl-1,2,4a,5,6,7,8,8a-octahydronaphthalen-1-yl)methylidene]-5-(1-hydroxyethyl)-1-methylpyrrolidine-2,4-dione. Molecular formula: C21H31NO4. Mole weight: 361.47. | |
CJ-17665 Quick inquiry Where to buy Suppliers range | CJ-17665 is produced by the strain of Aspergillus ochraceus. It inhibits growth of multi-drug resistant MRSA, Streptococcus pyogenes and Enterococcus faecalis with MIC of 12.5, 12.5 and 25 μg/mL, respectively. Molecular formula: C26H33N3O4. Mole weight: 451.56. | |
CJ-19784 Quick inquiry Where to buy Suppliers range | CJ-19784 is an antibiotic which is mainly resistant to Candida albicans, Cryptococcus neoformans and Aspergillus fumigatus. It is produced by the strain of Acanthostigmella sp. CL-12082. Synonyms: 4H-1-Benzopyran-4-one,2-(3-bromo-2-hydroxyphenyl)-5-hydroxy-3,7,8-trimethoxy. CAS No. 399509-71-8. Molecular formula: C18H15BrO7. Mole weight: 423.21. | |
CJ-21058 Quick inquiry Where to buy Suppliers range | CJ-21058 is a SecA inhibitor originally isolated from CL47745. It shows antiprotozoal effects (IC50 = 7 μM, T. brucei) and inhibits post-translational protein transport into the endoplasmic reticulum. It shows antibacterial and antifungal effects in vivo. Synonyms: CHEMBL565009; (5R,Z)-3-(Hydroxy((1R,2S,6S,8aS)-1,3,6-trimethyl-2-((E)-prop-1-en-1-yl)-1,2,4a,5,6,7,8,8a-octahydro-naphthalen-1-yl)methylene)-5-(hydroxymethyl)-1-methylpyrrolidine-2,4-dione. Grades: >98% by HPLC. CAS No. 405072-57-3. Molecular formula: C23H33NO4. Mole weight: 387.51. | |
CJ-21058 ((5R, Z)-3-(Hydroxy((1R, 2S, 6S, 8aS)-1, 3, 6-trimethyl-2-((E)-prop-1-en-1-yl)-1, 2, 4a, 5, 6, 7, 8, 8a-octahydro-naphthalen-1-yl)methylene)-5-(hydroxymethyl)-1-methylpyrrolidine-2, 4-dione) Quick inquiry Where to buy Suppliers range | Antibiotic. SecA inhibitor. Antibacterial and antifungal. Cytotoxic. Methyl analog of equisetin. Group: Biochemicals. Grades: Highly Purified. CAS No. 405072-57-3. Pack Sizes: 1mg, 5mg. US Biological Life Sciences. | Worldwide |
CJ-21164 Quick inquiry Where to buy Suppliers range | It is produced by the strain of Chloridium sp. CL48903. The IC50 of CJ-21164 inhibiting G6Pase in rat liver microsomes was 1.6 μmol/L. Synonyms: CHEMBL3218304. Molecular formula: C38H37ClO14. Mole weight: 753.14. | |
CJ-42794 Quick inquiry Where to buy Suppliers range | CJ-42794 is a selective prostaglandin E receptor subtype 4 (EP4) antagonist. It inhibits [3H]-PGE2 binding to the human EP4 receptor with a mean pKi of 8.5. It competitively antagonized cAMP accumulation with a pA2 value of 8.7 in HEK293 cells overexpressing rat prostanoid EP4 receptors. It did not exhibit any remarkable binding to 65 additional proteins, including GPCRs, enzymes, and ion channels. It reversed the inhibitory effects of PGE2 on LPS-induced TNFα production in a concentration-dependent manner. It has excellent pharmacological properties that make it a useful tool for exploring the physiological role of EP4 receptors. Uses: Cj-42794 has excellent pharmacological properties that make it a useful tool for exploring the physiological role of ep4 receptors. Synonyms: CJ-042794; CJ 042794; CJ042794; RQ-00015986, RQ-15986. 4-[ (1S) -1-[[5-chloro-2- (4-fluorophenoxy) benzoyl]amino]ethyl]benzoic acid; (S) -4- (1- (5-chloro-2- (4-fluorophenoxy) benzaMido) ethyl) benzoic acid;CJ-042794;4-((S)-1-(2-(4-fluorophenoxy)-5-chlorobenzamido)ethyl)benzoic acid. Grades: >98%. CAS No. 847728-01-2. Molecular formula: C22H17ClFNO4. Mole weight: 413.83. | |
CJ463 Quick inquiry Where to buy Suppliers range | CJ463 is a potent ans selective Urokinase (uPA) inhibitor, which plays a crucial role in carcinogenesis by facilitating tumor cell invasion and metastasis. It may be a novel agent for treatment of lung cancer. Uses: Cj463 may be a novel agent for treatment of lung cancer. Synonyms: CJ-463; CJ 463; CJ463. (S) -N- (4-carbamimidoylbenzyl) -3-hydroxy-2- ( (R) -3-hydroxy-2- ( (phenylmethyl) sulfonamido) propanamido) propanamide. Grades: 98%. CAS No. 600142-19-6. Molecular formula: C21H27N5O6S. Mole weight: 477.54. | |
CJB 090 dihydrochloride hydrate Quick inquiry Where to buy Suppliers range | ≥98% (HPLC). Uses: For analytical and research use. Group: Fluorescence/Luminescence Spectroscopy. CAS No. 595584-40-0 (anhydrous). Pack Sizes: 5MG, 25MG. Mole weight: 556.35 (anhydrous basis). Catalog: ALP595584400. Assay: ≥98% (HPLC). | |
Cjc1295 Quick inquiry Where to buy Suppliers range | Cjc1295. Group: Heterocyclic Organic Compound. Alternative Names: CJC1295;Y(d -A)DAIFTQSYRKVLAQLSARKLLQDILSR-NH2;L-Tyrosyl-D-alanyl-L-alpha-aspartyl-L-alanyl-L-isoleucyl-L-phenylalanyl-L-threonyl-L-glutaminyl-L-seryl-L-tyrosyl-L-arginyl-L-lysyl-L-valyl-L-leucyl-L-alanyl-L-glutaminyl-L-seryl-L-alanyl-L-arginyl-L-lysyl-L-leucyl-L-leucyl-L-glutaminyl-L-alpha-aspartyl-L-isoleucyl-L-leucyl-L-seryl-L-arginyl-N6-[3-(2,5-dihydro-2,5-dioxo-1H-pyrrol-1-yl)-1-oxopropyl]-L-lysinamide;CJC-1295 Acetate;CJC1295 with out DAC. CAS No. 863288-34-0. Product ID: ACM863288340. Molecular formula: C159H258N46O45. Mole weight: 0. Density: 1.45. | |
CJC1295 With DAC Quick inquiry Where to buy Suppliers range | CJC1295 is a synthetic analogue of growth hormone-releasing hormone. Grades: 98%. CAS No. 446262-90-4. Molecular formula: C165H269N47O46. Mole weight: 3647.19. | |
CJC1295 With DAC Quick inquiry Where to buy Suppliers range | CJC1295 With DAC. Uses: API. CAS No. 446262-90-4. Product ID: HB00124. | |
CJC1295 Without DAC Quick inquiry Where to buy Suppliers range | CJC-1295 is a 30-amino acid peptide and a growth hormone releasing hormone (GHRH) analog. It prolongs stimulation of growth hormone (GH) and insulin-like growth factor I secretion. It also extends the half-life and bioavailability of growth-hormone-releasing hormone 1-29. Synonyms: CJC 1295; CJC1295; L-tyrosyl-D-alanyl-L-alpha-aspartyl-L-alanyl-L-isoleucyl-L-phenylalanyl-L-threonyl-L-glutaminyl-L-seryl-L-tyrosyl-L-arginyl-L-lysyl-L-valyl-L-leucyl-L-alanyl-L-glutaminyl-L-leucyl-L-seryl-L-alanyl-L-arginyl-L-lysyl-L-leucyl-L-leucyl-L-glutaminyl-L-alpha-aspartyl-L-isoleucyl-L-leucyl-L-seryl-L-argininamide. Grades: >98%. CAS No. 863288-34-0. Molecular formula: C152H252N44O42. Mole weight: 3367.9. | |
CJC1295 Without DAC Quick inquiry Where to buy Suppliers range | CJC1295 Without DAC. Uses: API. CAS No. 863288-34-0. Product ID: HB00107. | |
C-Jun-amino-terminal kinase-interacting protein 2 (683-692) Quick inquiry Where to buy Suppliers range | C-Jun-amino-terminal kinase-interacting protein 2. Uses: Tumor Antigen Derived Peptides. CAS No. Product ID: ta-068. | |
c-Jun Control Cell Extract, Non-Phosphorylated Quick inquiry Where to buy Suppliers range | c-Jun Control Cell Extract, Non-Phosphorylated. Group: Molecular Biology. Pack Sizes: 1x150ul. US Biological Life Sciences. | Worldwide |
c-Jun Control Cell Extract, Phosphorylated Quick inquiry Where to buy Suppliers range | c-Jun Control Cell Extract, Phosphorylated. Group: Molecular Biology. Pack Sizes: 1x150ul. US Biological Life Sciences. | Worldwide |
c-Jun Control Cell Extracts Quick inquiry Where to buy Suppliers range | C-Jun is a component of the transcription factor AP-1 that binds and activates transcription at TRE/AP-1 elements. The transcriptional activity of c-Jun is regulated by phosphorylation at Ser63 and Ser73 (1,2). Extracellular signals including growth factors, transforming oncoproteins and UV irradiation stimulate phosphorylation of c-Jun at Ser63/73 and activate c-Jun dependent transcription. Mutation of Ser63/73 renders c-Jun nonresponsive to mitogenic and stress induced signaling pathways. The MAP kinase homologue, SAPK/JNK, binds to the N-terminal region of c-Jun and phosphorylates c-Jun at Ser63/73. In addition, the activity of SAPK/JNK is stimulated by the same signals that activate c-Jun (3,4). Nonphosphorylated c-Jun (Ser63) II Cell Extracts: Total cell extracts from NIH/3T3 cells, prepared without treatment, serve as a negative control. Group: Biologicals. Grades: Lysate. Pack Sizes: 10Blots. US Biological Life Sciences. | Worldwide |
c-JUN peptide Quick inquiry Where to buy Suppliers range | c-JUN peptide comprises residues 33 - 57 of the JNK binding (δ) domain of human c-Jun. It is a JNK/c-Jun interaction inhibitor that disrupts JNK/c-Jun interaction, up-regulation of p21cip/waf and modulation of inflammatory gene expression. It Specifically induces apoptosis in HeLa tumor cells. Uses: Peptide Inhibitors. CAS No. 610273-01-3. Product ID: R0857. | |
CK0106023 Quick inquiry Where to buy Suppliers range | CK0106023 was specific inhibitor of KSP. In tumor-bearing mice, CK0106023 exhibited antitumor activity comparable to or exceeding that of paclitaxel and caused the formation of monopolar mitotic figures identical to those produced in cultured cells. KSP was most abundant in proliferating human tissues and was absent from cultured postmitotic neurons. Synonyms: CK 0106023; CK-0106023; N-(1-(3-benzyl-7-chloro-4-oxo-3,4-dihydroquinazolin-2-yl)propyl)-4-bromo-N-(3-(dimethylamino)propyl)benzamide. CAS No. 336115-72-1. Molecular formula: C30H32BrClN4O2. Mole weight: 595.97. | |
CK-102 Quick inquiry Where to buy Suppliers range | CK-102 is a bio-active chemical compound. Synonyms: CK102; CK 102; 3,4-Dimethyl-9(10H)-acridone. Grades: 98%. CAS No. 6236-97-1. Molecular formula: C15H13NO. Mole weight: 223.27. | |
CK-119 Quick inquiry Where to buy Suppliers range | CK-119, a dihydropyridazino-pyridazine compound, is a potent IL-1 blocker to inhibit cell growth of fibroblast-like corneal and conjunctival cells mainly through the inhibition of DNA and RNA syntheses but not protein synthesis. Synonyms: diethyl 6-[(4-chlorophenyl)methyl]-1,4-dimethyl-5-oxopyridazino[4,5-c]pyridazine-3,4-dicarboxylate; CK-119; CK119; CK 119; UNII-AL53N923EI; GC-6119; GC 6119; GC6119. Grades: >98%. CAS No. 197917-10-5. Molecular formula: C21H23ClN4O5. Mole weight: 446.88. | |
CK 17 Quick inquiry Where to buy Suppliers range | CK 17 is a interleukin-1 antagonist. It can suppress fibroblast proliferation. Synonyms: CK 17; CK17; CK-17; 5-Bromotetrahydro-5-methyl-3-phenyl-2-(phenylimino)-4H-1,3-thiazin-4-one. Grades: 98%. CAS No. 86727-00-6. Molecular formula: C17H15BrN2OS. Mole weight: 375.29. | |
CK 1827452 Quick inquiry Where to buy Suppliers range | CK-1827452 is a diaryl urea compound that increases cardiac myosin ATPase activity in a dose-dependent manner that is selective for cardiac myosin over non-cardiac myosins. It promotes myosin cross-bridge formation, increasing the duration and amount of myocyte contraction without affecting intracellular calcium or cAMP. It has been shown to increase cardiac efficiency in clinical studies of patients with chronic heart failure. Group: Biochemicals. Alternative Names: Methyl 4- [ [2-Fluoro-3- [N'- (6-methylpyridin-3-yl) ureido] phenyl] methyl] piperazine-1-carboxylate; 4- [ [2-Fluoro-3- [ [ [ (6-methyl-3-pyridinyl) amino] carbonyl] amino] phenyl] methyl] -1-piperazinecarboxylic Acid Methyl Ester; Omecamtiv Mecarbil. Grades: Highly Purified. CAS No. 873697-71-3. Pack Sizes: 5mg, 10mg. Molecular Formula: C??H??FN?O?, Molecular Weight: 401.43. US Biological Life Sciences. | Worldwide |
CK-2130 Quick inquiry Where to buy Suppliers range | CK-2130 is a bio-active imidazolone developed to treat congestive heart failure. It inhibited human platelet aggregation produced by adenosine diphosphate and sodium arachidonate. Uses: Ck-2130 is used to treat congestive heart failure. Synonyms: CK 2130; CK-2130; CK2130. 4-Ethyl-1,3-dihydro-5-[4-[(2-methyl-1H-imidazol)-1-yl]benzoyl]-2H-imidazol-2-one;CK2130;4-Ethyl-5-[4-(2-methylimidazol-1-yl)benzoyl]-1,3-dihydroimidazol-2-one. Grades: >98 %. CAS No. 101184-07-0. Molecular formula: C16H16N4O2. Mole weight: 296.33. | |
CK-2289 Quick inquiry Where to buy Suppliers range | CK-2289 is an type III cyclic 3'5'-adenosine monophosphate phosphodiesterase inhibitor. It may be used in the treatment of congestive heart failure. Uses: Ck-2289 may be used in the treatment of congestive heart failure. Synonyms: CK 2289; CK-2289; CK2289. 4-[4-(1H-Imidazol-1-yl)benzoyl]-5-ethyl-1H-imidazol-2(3H)-one;4-Ethyl-5-[4-(1H-imidazol-1-yl)benzoyl]-1H-imidazol-2(3H)-one;2H-Imidazol-2-one,4-ethyl-1,3-dihydro-5-[4-(1H-imidazol-1-yl)benzoyl]-;4-Ethyl-1,3-dihydro-5-[4-(1H-imidazol-1-yl)benzoyl]-2H-imidazol-2-one. Grades: >98 %. CAS No. 101183-99-7. Molecular formula: C15H14N4O2. Mole weight: 282.30. | |
CK2 inhibitor 10 Quick inquiry Where to buy Suppliers range | CK2 inhibitor 10 is a potent and ATP-competitive inhibitor of protein kinase (CK2; IC50 values of 32 nM and 46 nM for CK2α and CK2α' respectively). Compound 10 dose-dependently inhibits the kinases. It exhibits potent cytotoxicity towards lung cancer cells A549, colorectal cancer cells HCT-116, and breast cancer cells MCF-7. Synonyms: CK2-IN-3b; 4-(2-(4-methoxybenzamido)thiazol-5-yl)benzoic acid. Grades: 99%. CAS No. 1361229-76-6. Molecular formula: C18H14N2O4S. Mole weight: 354.38. | |
Ck2 inhibitor ii Quick inquiry Where to buy Suppliers range | Ck2 inhibitor ii. Group: Heterocyclic Organic Compound. Alternative Names: 4,5,6,7-tetrabroMo-N,N-diMethyl-1H-benzo[d]iMidazol-2-aMine;2-Dimethylamino-4,5,6,7-tetrabromobenzimidazole. CAS No. 749234-11-5. Molecular formula: C9H7Br4N3. Mole weight: 476.791. Melting Point: >330? (Decomposition). | |
CK 3197 Quick inquiry Where to buy Suppliers range | CK 3197 is a Phosphoric diester hydrolase inhibitor originated by Bayer HealthCare Pharmaceuticals. CK 3197 has hemodynamic and myocardial energetic effects. In Jan 2007, preclinical for Heart failure in USA was discontinued. Uses: Heart failure. Synonyms: CK 3197; CK-3197; CK3197. 1-benzoyl-5-(4-(4,5-dihydro-2-methyl-1H-imidazol-1-yl)benzoyl)-4-ethyl-1,3-dihydro-2H-Imidazol-2-one. Grades: 98%. CAS No. 132523-92-3. Molecular formula: C23H22N4O3. Mole weight: 402.45. | |
CK-492B Quick inquiry Where to buy Suppliers range | CK-492B is a bio-active chemical compound. Synonyms: CK492B; CK 492B; 1,4-Bis-(3-(1-adamantyl carbamylguanidino)propyl)piperazine. Grades: 98%. CAS No. 64169-11-5. Molecular formula: C36H66N10O8S2. Mole weight: 831.11. | |
CK-636 Quick inquiry Where to buy Suppliers range | CK-636 is an Arp2/3 complex inhibitor. CK-636 binds between Arp2 and Arp3, where it appears to block movement of Arp2 and Arp3 into their active conformation. CK-636 inserts into the hydrophobic core of Arp3 and alters its conformation. Synonyms: CK636; CK 636; CK-636; CK0944636; CK-0944636; CK 0944636. CAS No. 442632-72-6. Molecular formula: C16H16N2OS. Mole weight: 284.38. | |
CK-636 Quick inquiry Where to buy Suppliers range | ≥98% (HPLC). Uses: For analytical and research use. Group: Fluorescence/Luminescence Spectroscopy. CAS No. 442632-72-6. Pack Sizes: 5MG, 25MG. Mole weight: 284.38. Catalog: AP442632726. Assay: ≥98% (HPLC). | |
CK 666 Quick inquiry Where to buy Suppliers range | CK 666. CAS No. 442633-00-3. | |
CK 666 Quick inquiry Where to buy Suppliers range | CK 666. Group: Biochemicals. Grades: Purified. CAS No. 442633-00-3. Pack Sizes: 10mg, 50mg. US Biological Life Sciences. | Worldwide |
CK 666 Quick inquiry Where to buy Suppliers range | CK 666 has been found to be an inhibitor of the Arp2/3 complex and could also restrain actin polymerization. Synonyms: CK 666; CK666; CK-666; 2-Fluoro-N-[2-(2-methyl-1H-indol-3-yl)ethyl]benzamide. Grades: ≥99% by HPLC. CAS No. 442633-00-3. Molecular formula: C18H17FN2O. Mole weight: 296.34. | |
CK-666 Quick inquiry Where to buy Suppliers range | ≥98% (HPLC), powder. Uses: For analytical and research use. Group: Fluorescence/Luminescence Spectroscopy. CAS No. 442633-00-3. Pack Sizes: 5MG, 25MG. Mole weight: 296.34. Catalog: AP442633003. Assay: ≥98% (HPLC). | |
CK 683A Quick inquiry Where to buy Suppliers range | CK 683A is a bio-active chemical,but no detailed information has been published yet. Synonyms: CK 683A; CK683A; CK-683A. 1,7-Bis((1-adamantyl)carbamylguanidino)-4-methyl-4-azaheptane. Grades: 98%. CAS No. 83539-21-3. Molecular formula: C32H57N9O5S. Mole weight: 679.92. | |
CK 869 Quick inquiry Where to buy Suppliers range | CK 869 has been found to inhibit actin polymerization as well as human and bovine actin-related protein 2/3 (Arp2/3) complex. Synonyms: CK-869; CK 869; CK869; CK-0157869; CK 0157869; CK0157869; 2-(3-Bromophenyl)-3-(2,4-dimethoxyphenyl)-4-thiazolidinone. Grades: ≥98% by HPLC. CAS No. 388592-44-7. Molecular formula: C17H16BrNO3S. Mole weight: 394.28. | |
CK 869 Quick inquiry Where to buy Suppliers range | CK 869. Group: Biochemicals. Grades: Purified. CAS No. 388592-44-7. Pack Sizes: 10mg, 50mg. US Biological Life Sciences. | Worldwide |
CKD-516 Quick inquiry Where to buy Suppliers range | This active molecular is a tubulin polymerisation inhibitor which is applicated for solid cancer treatment. CKD-516 disruptes tubulin of the endothelial cytoskeleton selectively. In Jun 2012, a South Korea company, Chong Kun Dang initiated enrolment in a phase I trial for solid tumours treatment in South Korea. In Dec 2014, Phase-I clinical trials in Solid tumours in South Korea was on going. Uses: Solid tumours. Synonyms: CKD-516 HCl; CKD 516 HCl; CKD516 HCl; (2S)-2-amino-3-methyl-N-[4-[3-(1,2,4-triazol-1-yl)-4-(3,4,5-trimethoxybenzoyl)phenyl]-1,3-thiazol-2-yl]butanamide;hydrochloride;1188371-47-2 (free base). Grades: 98%. CAS No. 1188371-47-2. Molecular formula: C26H28N6O5S. Mole weight: 536.6. | |
CKD-516 HCl Quick inquiry Where to buy Suppliers range | CKD-516 is tubulin inhibitor for solid cancer, which was initiated phase 1 trial in Korea in 2010. CKD-516 selectively disrupted tubulin component of the endothelial cytoskeleton. Serial DCE-MRI showed a significant decrease in K-trans and IAUGC parameters from baseline at 4 h (39.9 % in K-trans; -45.0 % in IAUGC) and at 24 h (-32.2 % in K-trans; -36.5 % in IAUGC), and a significant recovery at 48 h (22.9 % in K-trans; 34.8 % in IAUGC) following administration of CKD-516 at a 0.7-mg/kg dose. When the tumors were stratified according to the initial K-trans value of 0.1, tumors with a high K-trans?>?0.1 which was indicative of having well-developed pre-existing vessels, showed greater reduction in K-trans and IAUGC values. On histologic examination, the degree of necrosis of treated tumors was significantly greater than that of untreated tumors. In summary, CKD-516 is an effective VDA which results in rapid vascular shutdown by targeting the tubulin component of tumor vessels and thus leads to necrosis. Synonyms: Valecobulin hydrochloride; CKD516 hydrochloride; CKD 516 hydrochloride. CAS No. 1240321-53-2. Molecular formula: C26H29ClN6O5S. Mole weight: 573.07. | |
CKD 602 Quick inquiry Where to buy Suppliers range | CKD-602 is a topoisomerase I inhibitor. It is a synthetic and water-soluble camptothecin derivative which forms stable DNA-topoisomerase complexes during DNA replication and induces cell cycle arrest in the G2/M phase. CKD-602 has a significant effect on intracerebral glioma growth, with animals having significantly smaller tumors than those in the control group. Synonyms: (4S)-4-Ethyl-4-hydroxy-11-[2-[(1-methylethyl)amino]ethyl]-1H-pyrano[3',4':6,7]indolizino[1,2-b]quinoline-3,14(4H,12H)dione phosphate; Belotecan hydrochloride. Grades: ≥98% by HPLC. CAS No. 213819-48-8. Molecular formula: C25H27N3O4·H3PO4. Mole weight: 531.49. | |
CKD-602 Quick inquiry Where to buy Suppliers range | CKD-602 Inhibitor. Uses: Scientific use. Product Category: T7551. CAS No. 213819-48-8. | |
CKD-711 Quick inquiry Where to buy Suppliers range | It is produced by the strain of Streptomyces sp. CK-4416. CKD-711 strongly inhibited mammalian α-glucosidase activity, but weakly inhibited mammalian α-amylase from microorganism and mammal, which was similar to acarbose in vivo and in vitro. Synonyms: 4-Deoxy-4-{[(1R,2R,3S,4R,5S,6S)-3,4,5-trihydroxy-6-(hydroxymethyl)-7-oxabicyclo[4.1.0]hept-2-yl]amino}-α-D-glucopyranosyl-(1->4)-α-D-glucopyranosyl-(1->4)-D-glucopyranose. Molecular formula: C25H43NO20. Mole weight: 677.60. | |
CKI 7 dihydrochloride Quick inquiry Where to buy Suppliers range | CKI 7 is a CK1 inhibitor, and also inhibits SGK, S6K1 and MSK1. In combination with SB 431542, CKI 7 was shown to induce retinal cell differentiation from human ESCs and iPSCs. Synonyms: CKI-7 dihydrochloride; N-(2-Aminoethyl)-5-chloroisoquinoline-8-sulphonamide dihydrochloride. Grades: >98%. CAS No. 1177141-67-1. Molecular formula: C11H14Cl3N3O2S. Mole weight: 358.67. | |
CL075 Quick inquiry Where to buy Suppliers range | CL075 is a thiazoloquinolone derivative that stimulates TLR8 in human peripheral blood mononuclear cells. Uses: Toll-like receptor agonists. Synonyms: CL 075; CL-075; Thiazolo[4,5-c]quinolin-4-amine, 2-propyl-; 2-Propylthiazolo[4,5-c]quinolin-4-amine; 3M 002; 3M-002; 3M002. Grades: ≥95%. CAS No. 256922-53-9. Molecular formula: C13H13N3S. Mole weight: 243.33. | |
CL097 Quick inquiry Where to buy Suppliers range | CL097 is a human TLR7/8 and mouse TLR7 agonist. Synonyms: CL 097; CL-097; 3H-Imidazo[4,5-c]quinolin-4-amine, 2-(ethoxymethyl)-; 2-(Ethoxymethyl)-1H-imidazo[4,5-C]quinolin-4-amine. Grades: ≥95%. CAS No. 1026249-18-2. Molecular formula: C13H14N40. Mole weight: 242.28. | |
CL 218872 Quick inquiry Where to buy Suppliers range | CL 218872 has been found to be a benzodiazepine agonist and has been found to exhibit anxiolytic and anticonvulsant activities. Synonyms: CL 218872; CL218872; CL-218872; 3-Methyl-6-[-3-(trifluoromethyl)phenyl]-1,2,4-triazolo[4,3-b]pyridazine. Grades: ≥99% by HPLC. CAS No. 66548-69-4. Molecular formula: C13H9F3N4. Mole weight: 278.24. | |
CL 218872 Quick inquiry Where to buy Suppliers range | CL 218872. Group: Biochemicals. Grades: Purified. CAS No. 66548-69-4. Pack Sizes: 10mg, 50mg. US Biological Life Sciences. | Worldwide |
CL264 Quick inquiry Where to buy Suppliers range | CL264 is a small-molecule agonist of TLR7. Synonyms: Glycine, N-[4-[[6-amino-2-(butylamino)-7,8-dihydro-8-oxo-9H-purin-9-yl]methyl]benzoyl]-; N-[4-[[6-Amino-2-(butylamino)-7,8-dihydro-8-oxo-9H-purin-9-yl]methyl]benzoyl]glycine; CL 246; CL 264; CL-264; (4-((6-amino-2-(butylamino)-8-oxo-7,8-dihydro-9H-purin-9-yl)methyl)benzoyl)glycine. Grades: ≥95%. CAS No. 1510712-69-2. Molecular formula: C47H73N13O7S. Mole weight: 413.43. | |
CL2 Linker Quick inquiry Where to buy Suppliers range | CL2 Linker is a cleavableADC linker. CL2-SN-38 and CL2A-SN-38 are equivalent in drug substitution (~6), cell binding (Kd ~1.2 nM), cytotoxicity (IC50 ~2.2 nM), and serum stability in vitro (t1/2 ~20 hours). CAS No. 2270986-66-6. Molecular formula: C68H103N11O22. Mole weight: 1426.61. | |
CL307 Quick inquiry Where to buy Suppliers range | CL307 is an agonist of TLR7. Synonyms: Benzamide, 4-[[6-amino-2- (butylamino) -7, 8-dihydro-8-oxo-9H-purin-9-yl]methyl]-N-[2-[[3-[[4-[ (3-aminopropyl) amino]butyl]amino]propyl]amino]-2-oxoethyl]-; CL 307; CL-307; N1-glycinyl[4-((6-amino-2-(butylamino)-8-hydroxy-9H-purin-9-yl)methyl)benzoyl]spermine; 4- ( (6-amino-2- (butylamino) -8-oxo-7, 8-dihydro-9H-purin-9-yl) methyl) -N- (2- ( (3- ( (4- ( (3-aminopropyl) amino) butyl) amino) propyl) amino) -2-oxoethyl) benzamide; 4-[[6-Amino-2- (butylamino) -7, 8-dihydro-8-oxo-9H-purin-9-yl]methyl]-N-[2-[[3-[[4-[ (3-aminopropyl) amino]butyl]amino]propyl]amino]-2-oxoethyl]benzamide. Grades: ≥95%. CAS No. 1548551-79-6. Molecular formula: C29H47N11O3. Mole weight: 597.76. |