A directory of where to buy chemicals in the USA, including: distributors, industrial manufacturers, bulk supplies and wholesalers of raw ingredients & finished goods.
PI4KA inhibitor-F1 is a potent PI4KA inhibitor. Synonyms: PI4KA inhibitor-F1. Grade: 98%. CAS No. 1384097-27-1. Molecular formula: C27H18F5N5O4S. Mole weight: 603.5.
GSK J1
GSK-J1 is a highly potent H3K27 histone demethylase inhibitor with IC50 of 28 nM and 53 nM in cell-free assays for JMJD3 (KDM6B) and UTX (KDM6A), respectively, >10-fold selectivity over other tested demethylases. Synonyms: GSKJ1; GSKJ 1; GSKJ-1. Grade: 98%. CAS No. 1373422-53-7. Molecular formula: C22H23N5O2. Mole weight: 389.45.
GSK-J1
GSK-J1 is a potent inhibitor of H3K27me3/me2-demethylases JMJD3/KDM6B and UTX/KDM6A , with IC 50 of 60 nM towards KDM6B. Uses: Scientific research. Group: Signaling pathways. CAS No. 1373422-53-7. Pack Sizes: 10 mM * 1 mL; 5 mg; 10 mg; 25 mg; 50 mg; 100 mg. Product ID: HY-15648.
GSK-J1 lithium salt is a potent inhibitor of H3K27me3/me2-demethylases JMJD3/KDM6B and UTX/KDM6A, with an IC50 of 60 nM towards KDM6B. Synonyms: Lithium 3-{[2-(2-pyridinyl)-6-(1,2,4,5-tetrahydro-3H-3-benzazepin-3-yl)-4-pyrimidinyl]amino}propanoate; β-Alanine, N-[2-(2-pyridinyl)-6-(1,2,4,5-tetrahydro-3H-3-benzazepin-3-yl)-4-pyrimidinyl]-, lithium salt (1:1). Molecular formula: C22H22LiN5O2. Mole weight: 395.38.
GSK-J1 sodium salt
GSK-J1 is a potent and selective inhibitor of the H3K27 histone demethylases JMJD3 and UTX (IC50s = 18 and 56 μM, respectively; IC50 = 60 nM in JMJD3 antibody-based assays). Synonyms: N-[2-(2-pyridinyl)-6-(1,2,4,5-tetrahydro-3H-3-benzazepin-3-yl)-4-pyrimidinyl]-β-alanine, monosodium salt. Grade: ≥95%. CAS No. 1797832-71-3. Molecular formula: C22H22N5O2·Na. Mole weight: 411.4.
GSK-J1 Sodium Salt
GSK-J1 Sodium Salt. Group: Biochemicals. Alternative Names: 3-((6-(4,5-Dihydro-1H-benzo[d]azepin-3(2H)-yl)-2-(pyridin-2-yl)pyrimidin-4-yl)amino)propanoate Monosodium Salt. Grades: Highly Purified. Pack Sizes: 5mg. Molecular Formula: C22H22N5NaO2, Molecular Weight: 411.43. US Biological Life Sciences.
Worldwide
GSK-J2
GSK-J2, a benzazepin derivative, has been found to have poor activity as a JMJD3 inhibitor so that could be used in the biological study of GSK-J1 as a negative control. IC50: > 100 μM. Uses: Gsk-j2 has been found to have poor activity as a jmjd3 inhibitor so that could be used in the biological study of gsk-j1 as a negative control. Synonyms: SK-J2; GSK J2; GSKJ2; 1394854-52-4; SCHEMBL15937902; 3705AH. Grade: 98%. CAS No. 1394854-52-4. Molecular formula: C22H23N5O2. Mole weight: 389.45.
GSK-J2
GSK-J2 is an isomer of GSK-J1 that does not have any specific activity. GSK-J1 is a potent inhibitor of H3K27me3/me2-demethylases JMJD3/KDM6B and UTX/KDM6A. Uses: Scientific research. Group: Signaling pathways. CAS No. 1394854-52-4. Pack Sizes: 10 mM * 1 mL; 5 mg; 10 mg; 50 mg; 100 mg. Product ID: HY-15648A.
GSK-J2 sodium salt
GSK-J2 is a pyridine regio-isomer of GSK-J1 which poorly inhibits JMJD3 with an IC50 value greater than 100 μM. Synonyms: 3-((6-(4,5-dihydro-1H-benzo[d]azepin-3(2H)-yl)-2-(pyridin-3-yl)pyrimidin-4-yl)amino)propanoic acid, monosodium salt. Grade: ≥90%. CAS No. 2108665-15-0. Molecular formula: C22H23N5O2·Na. Mole weight: 412.4.
GSK-J4 is a potent dual inhibitor of H3K27me3/me2-demethylases JMJD3/KDM6B and UTX/KDM6A with IC 50 s of 8.6 and 6.6 μM, respectively. GSK-J4 inhibits LPS-induced TNF-α production in human primary macrophages with an IC 50 of 9 μM. GSK J4 is a cell permeable proagent of GSK-J1 [1] [2] [3]. GSK-J4 induces endoplasmic reticulum stress-related apoptosis [4]. Uses: Scientific research. Group: Signaling pathways. CAS No. 1373423-53-0. Pack Sizes: 10 mM * 1 mL; 5 mg; 10 mg; 50 mg; 100 mg. Product ID: HY-15648B.
GSK-J4 is a cell permeable, potent and selective histone demethylase. GSK-J4 is a prodrug of GSK J1, which is the first selective inhibitor of the H3K27 histone demethylase JMJD3 and UTX with IC50 of 60 nM in a cell-free assay and inactive against a panel of demethylases of the JMJ family. GSK-J4 is used to probe the consequences of demethylation of H3K27me3. GSK-J4 inhibits the lipopolysaccharide-induced production of cytokines, including pro-inflammatory tumour necrosis factor (TNF). Uses: Designed for use in research and industrial production. Additional or Alternative Names: GSK-J4 free base; GSK-J-4; GSK-J 4; GSK-J4. Product Category: Others. Appearance: Solid powder. CAS No. 1373423-53-0. Molecular formula: C24H27N5O2. Mole weight: 417.51. Purity: >98%. IUPACName: ethyl 3-((2-(pyridin-2-yl)-6-(1,2,4,5-tetrahydro-3H-benzo[d]azepin-3-yl)pyrimidin-4-yl)amino)propanoate. Canonical SMILES: O=C(OCC)CCNC1=NC(C2=NC=CC=C2)=NC(N3CCC4=CC=CC=C4CC3)=C1. Product ID: ACM1373423530. Alfa Chemistry ISO 9001:2015 Certified.
GSK J4 HCl
GSK J4 HCl is a cell permeable prodrug of GSK J1, which is the first selective inhibitor of the H3K27 histone demethylase JMJD3 and UTX with IC50 of 60 nM and inactive against a panel of demethylases of the JMJ family. Synonyms: GSK-J4; 1373423-53-0; GSK J4; Ethyl 3-((6-(4,5-dihydro-1H-benzo[d]azepin-3(2H)-yl)-2-(pyridin-2-yl)pyrimidin-4-yl)amino)propanoateethyl 3-[[2-pyridin-2-yl-6-(1,2,4,5-tetrahydro-3-benzazepin-3-yl)pyrimidin-4-yl]amino]propanoate. Grade: >98%. CAS No. 1373423-53-0. Molecular formula: C24H27N5O2.HCl. Mole weight: 453.96.
GSK-J4 hydrochloride
GSK-J4 hydrochloride is a potent dual inhibitor of H3K27me3/me2-demethylases JMJD3/KDM6B and UTX/KDM6A with IC 50 s of 8.6 and 6.6 μM, respectively. GSK-J4 hydrochloride inhibits LPS-induced TNF-α production in human primary macrophages with an IC 50 of 9 μM. GSK-J4 hydrochloride is a cell permeable proagent of GSK-J1 [1] [2] [3]. Uses: Scientific research. Group: Signaling pathways. CAS No. 1797983-09-5. Pack Sizes: 10 mM * 1 mL; 5 mg; 10 mg; 50 mg. Product ID: HY-15648F.
GSK-J4 hydrochloride
GSK-J4 (hydrochloride) is an ethyl ester derivative of GSK-J1 which blocks demethylation of histone H3K27 with an IC50 value greater than 50 μM in vitro. Synonyms: N-[2-(2-pyridinyl)-6-(1,2,4,5-tetrahydro-3H-3-benzazepin-3-yl)-4-pyrimidinyl]-β-alanine, ethyl ester, monohydrochloride. Grade: ≥95%. CAS No. 1797983-09-5. Molecular formula: C24H27N5O2·HCl. Mole weight: 454.
GSK-J4 Hydrochloride
GSK-J4 Hydrochloride. Group: Biochemicals. Alternative Names: Ethyl 3-((6-(4,5-Dihydro-1H-benzo[d]azepin-3(2H)-yl)-2-(pyridin-2-yl)pyrimidin-4-yl)amino)propanoate Monohydrochloride. Grades: Highly Purified. Pack Sizes: 5mg. Molecular Formula: C24H28ClN5O2, Molecular Weight: 453.96. US Biological Life Sciences.
Worldwide
GSK-J5 hydrochloride
GSK-J5 is a pyridine regio-isomer of GSK-J4 and it is a weak inhibitor of JMJD3 (IC50 > 100 μM), making it an ideal inactive control molecule for elucidating the functional role of JMJD3 inhibition. Synonyms: N-[2-(3-pyridinyl)-6-(1,2,4,5-tetrahydro-3H-3-benzazepin-3-yl)-4-pyrimidinyl]-β-alanine, ethyl ester, monohydrochoride. Grade: ≥95%. CAS No. 1797983-32-4. Molecular formula: C24H27N5O2·HCl. Mole weight: 454.
GSK-J5 Hydrochloride
GSK-J5 Hydrochloride is a selective jumonji H3K27 demethylase inhibitor that modulates the proinflammatory macrophage response. The histone H3 lysine 27 (H3K27) demethylase JMJD3 plays important roles in the transcriptional regulation of cell differentiation, development, the inflammatory response, and cancer.1,2 GSK-J4 (Item No. 12073) is a cell-permeable prodrug which is modified by intracellular esterases to give GSK-J1 (Item No. 12054), an inhibitor of JMJD3. GSK-J5 is a pyridine regio-isomer of GSK-J4. Like GSK-J4, this isomer is cell-permeable and hydrolyzed to a free base.3 However, the free base is a weak inhibitor of JMJD3 (IC50 > 100 μM), making it an ideal inactive control molecule for elucidating the functional role of JMJD3 inhibition.3. Group: Biochemicals. Alternative Names: N-[2-(3-Pyridinyl)-6-(1,2,4,5-tetrahydro-3H-3-benzazepin-3-yl)-4-pyrimidinyl]- β-alanineEthyl Ester Hydochloride. Grades: Highly Purified. CAS No. 1394854-51-3. Pack Sizes: 5mg. US Biological Life Sciences.
GSK-LSD1 2HCl is an irreversible, and selective LSD1 inhibitor with IC50 of 16 nM, > 1000 fold selective over other closely related FAD utilizing enzymes (i.e. LSD2, MAO-A, MAO-B). Synonyms: GSK LSD1 2HCl; GSK-LSD1 Dihydrochloride. Grade: >98%. CAS No. 1431368-48-7. Molecular formula: C14H22Cl2N2. Mole weight: 289.24.
GSK-LSD1 dihydrochloride
GSK-LSD1 dihydrochloride is a potent, selective and irreversible lysine specific demethylase 1 (LSD1) inhibitor with an IC50 of 16 nM. Uses: Scientific research. Group: Signaling pathways. CAS No. 2102933-95-7. Pack Sizes: 10 mM * 1 mL; 1 mg; 5 mg; 10 mg; 25 mg; 50 mg. Product ID: HY-100546A.
GSK PERK Inhibitor
GSK PERK Inhibitor is an inhibitors of PERK, an important transmembrane protein of endoplasmic reticulum (ER). GSK PERK Inhibitor can be useful in the treatment of cancer, ocular diseases, and diseases associated with activated unfolded protein response pathways. As a result, GSK PERK Inhibitor has potential use in the treatment of diseases such as Alzheimer's disease, stroke, Type 1 diabetes, Parkinson disease, Huntington's disease, amyotrophic lateral sclerosis, myocardial infarction, cardiovascular disease, atherosclerosis, and arrhythmias, and more specifically cancers of the breast, colon, pancreatic, and lung. Group: Biochemicals. Alternative Names: 1-[5- (4-Amino-7-methyl-7H-pyrrolo[2, 3-d]pyrimidin-5-yl) -2, 3-dihydro-1H-indol-1-yl]-2-[3-fluoro-5- (trifluoromethyl) phenyl]ethanone; 3-Fluoro-GSK2606414. Grades: Highly Purified. CAS No. 1337531-89-1. Pack Sizes: 1mg, 2mg, 5mg, 10mg. US Biological Life Sciences.
GsMTx4 is a spider venom peptide that selectively inhibits cationic-permeable mechanosensitive channels (MSCs) belonging to the Piezo and TRP channel families. GsMTx4 also blocks cation-selective stretch-activated channels (SACs) , attenuates lysophosphatidylcholine (LPC)-induced astrocyte toxicity and microglial reactivity. GsMTx4 is an important pharmacological tool for identifying the role of these excitatory MSCs in normal physiology and pathology [1] [2] [4]. Uses: Scientific research. Group: Peptides. CAS No. 1209500-46-8. Pack Sizes: 500 μg; 1 mg; 5 mg. Product ID: HY-P1410.
GsMTx4
GsMTx4 is a mechanosensitive and stretch-activated ion channel inhibitor. It is used as a tool for identifying the role of these excitatory MSCs in normal physiology and pathology. Grade: >98%. CAS No. 1209500-46-8. Molecular formula: C185H273N49O45S6. Mole weight: 4095.86.
GsMTx4 TFA is a spider venom peptide that selectively inhibits cationic-permeable mechanosensitive channels (MSCs) belonging to the Piezo and TRP channel families. GsMTx4 TFA also blocks cation-selective stretch-activated channels (SACs) , attenuates lysophosphatidylcholine (LPC)-induced astrocyte toxicity and microglial reactivity. GsMTx4 TFA is an important pharmacological tool for identifying the role of these excitatory MSCs in normal physiology and pathology[1][2][4]. Uses: Scientific research. Group: Peptides. Pack Sizes: 500 ?g; 1 mg; 5 mg. Product ID: HY-P1410A.
GsMTx4 TFA
GsMTx4 is a TRPC1 and TRPC6 blocker, and also blocks stretch-activated cation channels in astrocytes, cardiac cells, and skeletal muscle cells. Synonyms: H-Gly-Cys-Leu-Glu-Phe-Trp-Trp-Lys-Cys-Asn-Pro-Asn-Asp-Asp-Lys-Cys-Cys-Arg-Pro-Lys-Leu-Lys-Cys-Ser-Lys-Leu-Phe-Lys-Leu-Cys-Asn-Phe-Ser-Phe-OH.TFA; glycyl-L-cysteinyl-L-leucyl-L-alpha-glutamyl-L-phenylalanyl-L-tryptophyl-L-tryptophyl-L-lysyl-L-cysteinyl-L-asparagyl-L-prolyl-L-asparagyl-L-alpha-aspartyl-L-alpha-aspartyl-L-lysyl-L-cysteinyl-L-cysteinyl-L-arginyl-L-prolyl-L-lysyl-L-leucyl-L-lysyl-L-cysteinyl-L-seryl-L-lysyl-L-leucyl-L-phenylalanyl-L-lysyl-L-leucyl-L-cysteinyl-L-asparagyl-L-phenylalanyl-L-seryl-L-phenylalanine trifluoroacetic acid. Molecular formula: C185H278N48O46S6. Mole weight: 4103.
GSTO1-IN-1
GSTO1-IN-1 is a potent glutathione S-transferase omega 1 (GSTO1) inhibitor with an IC50 of 31 nM. Uses: Scientific research. Group: Signaling pathways. CAS No. 568544-03-6. Pack Sizes: 10 mM * 1 mL; 5 mg; 10 mg; 50 mg; 100 mg. Product ID: HY-111530.
GST protein, tag-free
recombinant, expressed in E. coli, ?70% (SDS-PAGE), buffered aqueous glycerol solution. Group: Fluorescence/luminescence spectroscopy.
GT1a-Oligosaccharide
GT1a-Oligosaccharide is an advanced oligosaccharide, finding applications in studying intricate neurological afflictions. Its specialized affinity towards toxins and pathogens endows it with unparalleled efficiency in studying viral invasions. Synonyms: Neu5Aca2-8Neu5Aca2-3Galb1-3GalNAcb1-4 (Neu5Aca2-3)Galb1-4Glc. Molecular formula: C59H93N4O45Na3. Mole weight: 1647.34.
GT1b-Ganglioside
GT1b-Ganglioside is demonstrated to protect mouse brain cells against L-cysteine-induced damage of mitochondrial DNA and increased lipid peroxidation, suggested to operate through scavenging of OH radicals promoted by L-cysteine. GT1b-Ganglioside is also demonstrated to suppress seizures, damage to mitochondrial DNA and lipid peroxidation induced by kainic acid. Synonyms: Trisialoganglioside-GT1b (porcine brain); Ganglioside GT1b; Ganglioside G1; GT1b. Grade: >99%. CAS No. 59247-13-1. Molecular formula: C95H174N8O47. Mole weight: 2180.42.
GT1b-Oligosaccharide
GT1b-Oligosaccharide is an extraordinary compound, manifesting promising applications in studying the complexities of neurological disorders and autoimmune diseases. CAS No. 75663-36-4. Molecular formula: C59H96N4O45. Mole weight: 1581.39.
GT1c-Oligosaccharide
GT1c-Oligosaccharide is a remarkable compound widely utilized in studying intricate cellular mechanisms in a spectrum of ailments, such as debilitating cancers and complex neurodegenerative disorders. Synonyms: Galb1-3GalNAcb1-4(Neu5Aca2-8Neu5Aca2-8Neu5Aca2-3)Galb1-4Glc. Molecular formula: C59H93N4O45Na3. Mole weight: 1647.34.
GT 2016
GT 2016. Group: Biochemicals. Grades: Purified. CAS No. 152241-24-2. Pack Sizes: 10mg, 50mg. US Biological Life Sciences.
Worldwide
GT 2016
GT 2016 is a high affinity and brain-penetrant histamine H3 receptor antagonist (Ki = 43.8 nM). It displays selectivity against H1 and H2 receptors (IC50 >10 μM). GT 2016 increases the release of histamine in the cerebral cortex. GT 2016 exhibits no effect on histamine methyltransferase in vitro at concentrations up to 3 μM. Synonyms: GT-2016,GT2016, GT 2016; 5-Cyclohexyl-1-[4-(1H-imidazol-5-yl)-1-piperidinyl]-1-pentanone. Grade: ≥98% by HPLC. CAS No. 152241-24-2. Molecular formula: C19H31N3O. Mole weight: 317.47.
GT2-Oligosaccharide
GT2-Oligosaccharide is a multifaceted biomedical marvel, effectively aiding in the formidable research of cardiovascular diseases, cancer, and diabetes. Acting as a prowess-inducing inhibitor of α-glucosidases, this spellbinding remedy boasts unprecedented potential in orchestrating the delicate symphony of blood glucose regulation. Synonyms: GalNAcb1-4(Neu5Aca2-8Neu5Aca2-8Neu5Aca2-3)Galb1-4Glc. Molecular formula: C53H83N4O40Na3. Mole weight: 1485.20.
GT3-Oligosaccharide
GT3-Oligosaccharide is an extraordinary biomedical compound emanating from pristine natural sources, acting as a potent antioxidant. It is anti-inflammatory and immunomodulatory crusader, finding applications in studying cancer, cardiovascular ailments and neurodegenerative ravages. Synonyms: Neu5Aca2-8Neu5Aca2-8Neu5Aca2-3Galb1-4Glc. Molecular formula: C45H70N3O35Na3. Mole weight: 1282.01.
GT 949
GT 949 is a potent and selective EAAT2 positive allosteric modulator (EC50 = 0.26 nM) which exhibits no significant effect on DAT, SERT and NET or NMDA receptors. Synonyms: 3-((4-Cyclohexylpiperazin-1-yl)(1-phenethyl-1H-tetrazol-5-yl)methyl)-6-methoxyquinolin-2(1H)-one. Grade: ≥98%. CAS No. 460330-27-2. Molecular formula: C30H37N7O2. Mole weight: 527.66.
GT 949
GT 949 is a selective excitatory amino acid transporter-2 (EAAT2) positive allosteric modulator with an EC50 of 0.26 nM[1]. Uses: Scientific research. Group: Signaling pathways. CAS No. 460330-27-2. Pack Sizes: 10 mM * 1 mL; 5 mg; 10 mg; 25 mg; 50 mg; 100 mg. Product ID: HY-114381.
GTFTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS
It is a derivative of Exendin-4 peptide. Synonyms: Gly-Thr-Phe-Thr-Ser-Asp-Val-Ser-Lys-Gln-Met-Glu-Glu-Glu-Ala-Val-Arg-Leu-Phe-Ile-Glu-Trp-Leu-Lys-Asn-Gly-Gly-Pro-Ser-Ser-Gly-Ala-Pro-Pro-Pro-Ser. Grade: ≥95%. Molecular formula: C170H262N44O56S. Mole weight: 3850.28.
GTP
Guanosine-5'-triphosphate sodium salt could be used as a phosphoryl donor in signal transduction and protein synthesis. Alternative Names: Guanosine 5'-triphosphate trisodium salt. GTP Trisodium salt. 5'-GTP trisodium salt. MFCD00077781. CAS No. 36051-31-7. Product ID: PIPB-0427. Molecular formula: C10H13N5Na3O14P3. Mole weight: 589.13. EINECS: 252-847-2. SMILES: C1=NC2=C(N1[C@H]3[C@@H]([C@@H]([C@H](O3)COP(=O)([O-])OP(=O)([O-])OP(=O)(O)[O-])O)O)N=C(NC2=O)N.[Na+].[Na+].[Na+]. Appearance: White to Off-white Solid. Category: NTP.
GTP, 100mM Sodium Solution
Guanosine triphosphate (GTP) is a guanine nucleotide containing three phosphate groups esterified to the sugar moiety. GTP functions as a carrier of phosphates and pyrophosphates involved in channeling chemical energy into specific biosynthetic pathways. GTP activates the signal transducing G proteins which are involved in various cellular processes including proliferation, differentiation, and activation of several intracellular kinase cascades. Proliferation and apoptosis are regulated in part by the hydrolysis of GTP by small GTPases Ras and Rho. Another type of small GTPase, Rab, plays a role in the docking and fusion of vesicles and may also be involved in vesicle formation. In addition to its role in signal transduction, GTP also serves as an energy-rich precursor of mononucleotide units in the enzymatic biosynthesis of DNA and RNA. Synonyms: D-Guanosine 5'-triphosphate; Guanosine triphosphate; Guanosine 5'-triphosphoric acid; pppG; guanosine 5'-O-(triphosphate); [[(2R,3S,4R,5R)-5-(2-amino-6-oxo-1H-purin-9-yl)-3,4-dihydroxyoxolan-2-yl]methoxy-hydroxyphosphoryl] phosphono hydrogen phosphate. Molecular formula: C10H16N5O14P3 (free acid). Mole weight: 523.18 (free acid).
GTP 14564
GTP 14564. Group: Biochemicals. Grades: Purified. CAS No. 34823-86-4. Pack Sizes: 10mg. US Biological Life Sciences.
Worldwide
GTP-14564
GTP-14564 is a specific kinase inhibitor for ITD-FLT3. GTP-14564 inhibited the growth of interleukin-3-independent Ba/F3 expressing ITD-FLT3 at 1 microM, whereas a 30-fold higher concentration of GTP-14564 was required to inhibit FLT3 ligand-dependent growth of Ba/F3 expressing wild type FLT3 (wt-FLT3). Synonyms: GTP 14564; GTP14564; 1-Phenyl-3-H-8-oxa-2,3-diaza-cyclopenta[a]inden. CAS No. 34823-86-4. Molecular formula: C15H10N2O. Mole weight: 234.25.
GTP-14564 - CAS 34823-86-4
A cell-permeable, reversible, and ATP-competitive tricyclic benzofurano-indazolo compound that acts as a potent and specific inhibitor of class III receptor tyrosine kinases. Group: Fluorescence/luminescence spectroscopy.
GTP 3',8-cyclase
The enzyme catalyses an early step in the biosynthesis of the molybdenum cofactor (MoCo). In bacteria and plants the reaction is catalysed by MoaA and Cnx2, respectively. In mammals it is catalysed by the MOCS1A domain of the bifunctional MOCS1 protein, which also catalyses EC 4.6.1.17, cyclic pyranopterin monophosphate synthase. The enzyme belongs to the superfamily of radical S-adenosyl-L-methionine (radical SAM) enzymes, and contains two oxygen-sensitive FeS clusters. Group: Enzymes. Synonyms: MOCS1A (gene name); moaA (gene name); cnx2 (gene name). Enzyme Commission Number: EC 4.1.99.22. Storage: Store it at +4 ?C for short term. For long term storage, store it at -20 ?C?-80 ?C. Form: Liquid or lyophilized powder. EXWM-4935; GTP 3',8-cyclase; EC 4.1.99.22; MOCS1A (gene name); moaA (gene name); cnx2 (gene name). Cat No: EXWM-4935.
GTPαS (Sp isomer)
GTPαS (Sp isomer) is a non-hydrolyzable analog of GTP. It contains a sulfur atom replacing one of the non-bridging oxygen atoms in the triphosphate chain. The Sp isomer specifically refers to the stereoisomer where the sulfur atom occupies a particular spatial orientation. This compound is widely used in biochemical research to study G-protein signaling pathways, as it can activate G-proteins but is resistant to hydrolysis, thereby providing sustained signaling. Synonyms: Guanosine 5'-O-(1-thiotriphosphate), Sp-isomer; SP-GTP-αS; Guanosine, 5'→P''-ester with [P''(S)]-thiotriphosphoric acid ((HO)2P(O)OP(O)(OH)OP(O)(OH)(SH)); Guanosine, 5'→P''-ester with thiotriphosphoric acid ((HO)2P(O)OP(O)(OH)OP(S)(OH)2), (S)-. Grade: ≥95% by HPLC. CAS No. 81570-51-6. Molecular formula: C10H16N5O13P3S. Mole weight: 539.24.
GTPase KRas (7-15)
GTPase KRas (7-15) is a 9-aa peptide. The K-Ras protein is a GTPase, which means it converts a molecule called GTP into another molecule called GDP. In this way the K-Ras protein acts like a switch that is turned on and off by the GTP and GDP molecules. Synonyms: K-Ras 2 (7-15).
GTPase NRas (55-64)
GTPase NRas (55-64) is a bioactive peptide of GTPase NRas. Ras proteins bind GDP/GTP and possess intrinsic GTPase activity. Synonyms: Transforming protein N-Ras (55-64).
GTP cyclohydrolase I
The reaction involves hydrolysis of two C-N bonds and isomerization of the pentose unit; the recyclization may be non-enzymic. This enzyme is involved in the de novo synthesis of tetrahydrobiopterin from GTP, with the other enzymes involved being EC 1.1.1.153 (sepiapterin reductase) and EC 4.2.3.12 (6-pyruvoyltetrahydropterin synthase). Group: Enzymes. Synonyms: GTP cyclohydrolase; guanosine triphosphate cyclohydrolase; guanosine triphosphate 8-deformylase; dihydroneopterin triphosphate synthase; GTP 8-formylhydrolase. Enzyme Commission Number: EC 3.5.4.16. CAS No. 37289-19-3. Storage: Store it at +4 ?C for short term. For long term storage, store it at -20 ?C?-80 ?C. Form: Liquid or lyophilized powder. EXWM-4542; GTP cyclohydrolase I; EC 3.5.4.16; 37289-19-3; GTP cyclohydrolase; guanosine triphosphate cyclohydrolase; guanosine triphosphate 8-deformylase; dihydroneopterin triphosphate synthase; GTP 8-formylhydrolase. Cat No: EXWM-4542.
GTP cyclohydrolase II
Two C-N bonds are hydrolysed, releasing formate, with simultaneous removal of the terminal diphosphate. Group: Enzymes. Synonyms: guanosine triphosphate cyclohydrolase II; GTP-8-formylhydrolase. Enzyme Commission Number: EC 3.5.4.25. CAS No. 56214-35-8. Storage: Store it at +4 ?C for short term. For long term storage, store it at -20 ?C?-80 ?C. Form: Liquid or lyophilized powder. EXWM-4552; GTP cyclohydrolase II; EC 3.5.4.25; 56214-35-8; guanosine triphosphate cyclohydrolase II; GTP-8-formylhydrolase. Cat No: EXWM-4552.
GTP cyclohydrolase IIa
Requires Mg2+. This enzyme catalyses the hydrolysis of the imidazole ring of guanosine 5'-triphosphate, N7-methylguanosine 5'-triphosphate or inosine 5'-triphosphate. Xanthosine 5'-triphosphate and ATP are not substrates. It also catalyses the hydrolysis of diphosphate to form two equivalents of phosphate. Unlike GTP cyclohydrolase II (EC 3.5.4.25), this enzyme does not release formate, but does hydrolyse the diphosphate from GTP to phosphate. Group: Enzymes. Enzyme Commission Number: EC 3.5.4.29. Storage: Store it at +4 ?C for short term. For long term storage, store it at -20 ?C?-80 ?C. Form: Liquid or lyophilized powder. EXWM-4556; GTP cyclohydrolase IIa; EC 3.5.4.29. Cat No: EXWM-4556.
GTP cyclohydrolase IV
Requires Fe2+. A zinc protein. The enzyme is involved in methanopterin biosynthesis in methanogenic archaea. cf. GTP cyclohydrolase I (EC 3.5.4.16), GTP cyclohydrolase II (EC 3.5.4.25) and GTP cyclohydrolase IIa (EC 3.5.4.29). Group: Enzymes. Synonyms: MptA; GTP cyclohydrolase MptA. Enzyme Commission Number: EC 3.5.4.39. Storage: Store it at +4 ?C for short term. For long term storage, store it at -20 ?C?-80 ?C. Form: Liquid or lyophilized powder. EXWM-4567; GTP cyclohydrolase IV; EC 3.5.4.39; MptA; GTP cyclohydrolase MptA. Cat No: EXWM-4567.
GTP diphosphokinase
GDP can also act as acceptor. Group: Enzymes. Synonyms: stringent factor; guanosine 3',5'-polyphosphate synthase; GTP pyrophosphokinase; ATP-GTP 3'-diphosphotransferase; guanosine 5',3'-polyphosphate synthetase; (p)ppGpp synthetase I; (p)ppGpp synthetase II; guanosine pentaphosphate synthetase; GPSI; GPSII. Enzyme Commission Number: EC 2.7.6.5. CAS No. 63690-89-1. Storage: Store it at +4 ?C for short term. For long term storage, store it at -20 ?C?-80 ?C. Form: Liquid or lyophilized powder. EXWM-3224; GTP diphosphokinase; EC 2.7.6.5; 63690-89-1; stringent factor; guanosine 3',5'-polyphosphate synthase; GTP pyrophosphokinase; ATP-GTP 3'-diphosphotransferase; guanosine 5',3'-polyphosphate synthetase; (p)ppGpp synthetase I; (p)ppGpp synthetase II; guanosine pentaphosphate synthetase; GPSI; GPSII. Cat No: EXWM-3224.
GTP-γ-AmNS
GTP-γ-AmNS is a fluorescent analogue of GTP used for the determination of enzymes specialized to cleave α/β-phosphodiester bonds. Synonyms: Guanosine- 5'- O- triphosphoro- γ- 1- (5- sulfonic acid)naphthylamidate, sodium salt. Grade: ≥ 95% by HPLC. CAS No. 76724-84-0. Molecular formula: C20H23N6O16P3S (free acid). Mole weight: 728.4 (free acid).
GTP-γ-S
GTP-γ-S. Uses: Designed for use in research and industrial production. Additional or Alternative Names: Guanosine-5'-O-(3-thiotriphosphate). tetrasodium salt. CAS No. 37589-80-3. Molecular formula: C10H16N5O13P3S. Mole weight: 539.3 (free acid). Purity: 0.95. Product ID: ACM37589803. Alfa Chemistry ISO 9001:2015 Certified. Categories: GT PSP.
GTPγS
GTPγS is a stable G-protein-activating (GTP) analog. The physiological actions of GTPgammaS includestimulation of guanine nucleotide-binding proteins, phosphoinositide hydrolysis, cyclic AMP accumulation, and activation of specific proto-oncogenes. Synonyms: Guanosine-5'-(γ-thio)-triphosphate, Tetralithium salt; Guanosine-5'-(3-thio)-triphosphate; Guanosine-5'-(3-thiotriphosphate). Grade: ≥ 90 % by HPLC, contains < 10 % GDP. CAS No. 94825-44-2. Molecular formula: C10H16N5O13P3S (free acid). Mole weight: 539.24 (free acid).
G-TPP
G-TPP is a mitochondria-targeted Hsp90 inhibitor that increases cell death in HeLa and MCF7 cells, consistently inhibits cell death induced by oxidative stress and mitochondrial dysfunction induced by PINK1 mutation in mouse embryonic fibroblast cells and DA cell models such as SH-SY5Y and SN4741 cells. Additionally, G-TPP also suppresses the defective locomotive activity and DA neuron loss in Drosophila PINK1 null mutants. Synonyms: G-TPP; G TPP. Grade: >98%. CAS No. 1131626-46-4. Molecular formula: C52H65N3O8P. Mole weight: 890.85.
GTRI-02
GTRI-02 is produced by the strain of Micromonospora sp. SA246. Its IC50 of inhibiting lipid peroxidation was 1.89 μg/mL, which was half of that of vitamin E. Synonyms: 7-acetyl-3,6-dihydroxy-8-methyl-tetralone. Molecular formula: C13H14O4. Mole weight: 234.25.
GTRI-BB
GTRI-BB is from Micromonospora sp. SA-246 with anti-gram-positive bacteria activity and cytotoxicity. The GI50 (μg/mL) of PC-3 (prostate), A549 (lung) and K562 (leukemia) cells were 0.21, 0.25 and 0.21 respectively. Molecular formula: C33H26O13. Mole weight: 630.55.
gTS-21
gTS-21. Group: Biochemicals. Grades: Highly Purified. CAS No. 148372-04-7. Pack Sizes: 1mg, 2mg, 5mg, 10mg, 25mg. US Biological Life Sciences.
GTS-21 is a highly efficacious pharmaceutical compound used in studying the intricate afflictions of Alzheimer's disease and cognitive impairments. Uses: Nicotinic agonists. Synonyms: 3-[(2,4-Dimethoxyphenyl)methylene]-3,4,5,6-tetrahydro-2,3'-bipyridine; GTS-21; GTS21; GTS 21; DMXB-A. CAS No. 148372-04-7. Molecular formula: C19H20N2O2. Mole weight: 308.381.
GTS-21 dihydrochloride
GTS-21, also known as DMBX-A, is a derivative of the natural product anabaseine that acts as a partial agonist at neural nicotinic acetylcholine receptors. It binds to both the α4β2 and α7 subtypes, but activates only the α7 to any significant extent. Synonyms: GTS-21; GTS 21; GTS21; DMBX-A. Grade: 98%. CAS No. 156223-05-1. Molecular formula: C19H20N2O2.2HCl. Mole weight: 381.30.
GTS-21 dihydrochloride
GTS-21 dihydrochloride is a selective alpha7 nicotinic acetylcholine receptor (α7-nAChR) agonist with anti - inflammatory and cognition - enhancing activities. GTS-21 dihydrochloride is also a α4β2 ( K i =20 nM for humanα4β2) and 5-HT3A receptor ( IC 50 =3.1 μM) antagonist [1] [2]. Uses: Scientific research. Group: Signaling pathways. Alternative Names: DMXB-A; DMBX-anabaseine. CAS No. 156223-05-1. Pack Sizes: 10 mM * 1 mL; 5 mg; 10 mg; 50 mg; 100 mg. Product ID: HY-14564A.
A partial agonist selective for alpha7 nAChRs (EC50 = 10uM). Used in neuroimmunology studies, cardiovascular disease research, and Alzheimer's disease studies. Group: Biochemicals. Grades: Highly Purified. CAS No. 156223-05-1. Pack Sizes: 10mg. US Biological Life Sciences.
Worldwide
GTx-007
GTx-007 (S-4) is an orally active and selective nonsteroidal androgen receptor (AR) modulator (SARM) and a partial agonist, with Ki of 4 nM. GTx-007 (S-4) is identified as SARMs with potent and tissue-selective in vivo pharmacological activity[1][2]. Uses: Scientific research. Group: Signaling pathways. Alternative Names: S-4. CAS No. 401900-40-1. Pack Sizes: 10 mM * 1 mL; 5 mg; 10 mg; 50 mg; 100 mg. Product ID: HY-12023.