A directory of where to buy chemicals in the USA, including: distributors, industrial manufacturers, bulk supplies and wholesalers of raw ingredients & finished goods.
Search for products or services, then visit the suppliers website for prices or more information.
| Product | Description | |
|---|---|---|
| GsMTx4 TFA | GsMTx4 TFA is a spider venom peptide that selectively inhibits cationic-permeable mechanosensitive channels (MSCs) belonging to the Piezo and TRP channel families. GsMTx4 TFA also blocks cation-selective stretch-activated channels (SACs) , attenuates lysophosphatidylcholine (LPC)-induced astrocyte toxicity and microglial reactivity. GsMTx4 TFA is an important pharmacological tool for identifying the role of these excitatory MSCs in normal physiology and pathology[1][2][4]. Uses: Scientific research. Group: Peptides. Pack Sizes: 500 ?g; 1 mg; 5 mg. Product ID: HY-P1410A. |  |
| GSTO1-IN-1 | GSTO1-IN-1 is a potent glutathione S-transferase omega 1 (GSTO1) inhibitor with an IC50 of 31 nM. Uses: Scientific research. Group: Signaling pathways. CAS No. 568544-03-6. Pack Sizes: 10 mM * 1 mL; 5 mg; 10 mg; 50 mg; 100 mg. Product ID: HY-111530. | |
| GST protein, tag-free | recombinant, expressed in E. coli, ?70% (SDS-PAGE), buffered aqueous glycerol solution. Group: Fluorescence/luminescence spectroscopy. |  |
| GT1a-Oligosaccharide | GT1a-Oligosaccharide is an advanced oligosaccharide, finding applications in studying intricate neurological afflictions. Its specialized affinity towards toxins and pathogens endows it with unparalleled efficiency in studying viral invasions. Synonyms: Neu5Aca2-8Neu5Aca2-3Galb1-3GalNAcb1-4 (Neu5Aca2-3)Galb1-4Glc. Molecular formula: C59H93N4O45Na3. Mole weight: 1647.34. |  |
| GT1b-Ganglioside | GT1b-Ganglioside is demonstrated to protect mouse brain cells against L-cysteine-induced damage of mitochondrial DNA and increased lipid peroxidation, suggested to operate through scavenging of OH radicals promoted by L-cysteine. GT1b-Ganglioside is also demonstrated to suppress seizures, damage to mitochondrial DNA and lipid peroxidation induced by kainic acid. Synonyms: Trisialoganglioside-GT1b (porcine brain); Ganglioside GT1b; Ganglioside G1; GT1b. Grade: >99%. CAS No. 59247-13-1. Molecular formula: C95H174N8O47. Mole weight: 2180.42. | |
| GT1b-Oligosaccharide | GT1b-Oligosaccharide is an extraordinary compound, manifesting promising applications in studying the complexities of neurological disorders and autoimmune diseases. CAS No. 75663-36-4. Molecular formula: C59H96N4O45. Mole weight: 1581.39. | |
| GT1c-Oligosaccharide | GT1c-Oligosaccharide is a remarkable compound widely utilized in studying intricate cellular mechanisms in a spectrum of ailments, such as debilitating cancers and complex neurodegenerative disorders. Synonyms: Galb1-3GalNAcb1-4(Neu5Aca2-8Neu5Aca2-8Neu5Aca2-3)Galb1-4Glc. Molecular formula: C59H93N4O45Na3. Mole weight: 1647.34. | |
| GT 2016 | GT 2016 is a high affinity and brain-penetrant histamine H3 receptor antagonist (Ki = 43.8 nM). It displays selectivity against H1 and H2 receptors (IC50 >10 μM). GT 2016 increases the release of histamine in the cerebral cortex. GT 2016 exhibits no effect on histamine methyltransferase in vitro at concentrations up to 3 μM. Synonyms: GT-2016,GT2016, GT 2016; 5-Cyclohexyl-1-[4-(1H-imidazol-5-yl)-1-piperidinyl]-1-pentanone. Grade: ≥98% by HPLC. CAS No. 152241-24-2. Molecular formula: C19H31N3O. Mole weight: 317.47. | |
| GT 2016 | GT 2016. Group: Biochemicals. Grades: Purified. CAS No. 152241-24-2. Pack Sizes: 10mg, 50mg. US Biological Life Sciences. |  Worldwide |
| GT2-Oligosaccharide | GT2-Oligosaccharide is a multifaceted biomedical marvel, effectively aiding in the formidable research of cardiovascular diseases, cancer, and diabetes. Acting as a prowess-inducing inhibitor of α-glucosidases, this spellbinding remedy boasts unprecedented potential in orchestrating the delicate symphony of blood glucose regulation. Synonyms: GalNAcb1-4(Neu5Aca2-8Neu5Aca2-8Neu5Aca2-3)Galb1-4Glc. Molecular formula: C53H83N4O40Na3. Mole weight: 1485.20. | |
| GT3-Oligosaccharide | GT3-Oligosaccharide is an extraordinary biomedical compound emanating from pristine natural sources, acting as a potent antioxidant. It is anti-inflammatory and immunomodulatory crusader, finding applications in studying cancer, cardiovascular ailments and neurodegenerative ravages. Synonyms: Neu5Aca2-8Neu5Aca2-8Neu5Aca2-3Galb1-4Glc. Molecular formula: C45H70N3O35Na3. Mole weight: 1282.01. | |
| GT 949 | GT 949 is a potent and selective EAAT2 positive allosteric modulator (EC50 = 0.26 nM) which exhibits no significant effect on DAT, SERT and NET or NMDA receptors. Synonyms: 3-((4-Cyclohexylpiperazin-1-yl)(1-phenethyl-1H-tetrazol-5-yl)methyl)-6-methoxyquinolin-2(1H)-one. Grade: ≥98%. CAS No. 460330-27-2. Molecular formula: C30H37N7O2. Mole weight: 527.66. | |
| GT 949 | GT 949 is a selective excitatory amino acid transporter-2 (EAAT2) positive allosteric modulator with an EC50 of 0.26 nM[1]. Uses: Scientific research. Group: Signaling pathways. CAS No. 460330-27-2. Pack Sizes: 10 mM * 1 mL; 5 mg; 10 mg; 25 mg; 50 mg; 100 mg. Product ID: HY-114381. | |
| GTFTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS | It is a derivative of Exendin-4 peptide. Synonyms: Gly-Thr-Phe-Thr-Ser-Asp-Val-Ser-Lys-Gln-Met-Glu-Glu-Glu-Ala-Val-Arg-Leu-Phe-Ile-Glu-Trp-Leu-Lys-Asn-Gly-Gly-Pro-Ser-Ser-Gly-Ala-Pro-Pro-Pro-Ser. Grade: ≥95%. Molecular formula: C170H262N44O56S. Mole weight: 3850.28. | |
| GTP | Guanosine-5'-triphosphate sodium salt could be used as a phosphoryl donor in signal transduction and protein synthesis. Alternative Names: Guanosine 5'-triphosphate trisodium salt. GTP Trisodium salt. 5'-GTP trisodium salt. MFCD00077781. CAS No. 36051-31-7. Product ID: PIPB-0427. Molecular formula: C10H13N5Na3O14P3. Mole weight: 589.13. EINECS: 252-847-2. SMILES: C1=NC2=C(N1[C@H]3[C@@H]([C@@H]([C@H](O3)COP(=O)([O-])OP(=O)([O-])OP(=O)(O)[O-])O)O)N=C(NC2=O)N.[Na+].[Na+].[Na+]. Appearance: White to Off-white Solid. Category: NTP. |  |
| GTP, 100mM Sodium Solution | Guanosine triphosphate (GTP) is a guanine nucleotide containing three phosphate groups esterified to the sugar moiety. GTP functions as a carrier of phosphates and pyrophosphates involved in channeling chemical energy into specific biosynthetic pathways. GTP activates the signal transducing G proteins which are involved in various cellular processes including proliferation, differentiation, and activation of several intracellular kinase cascades. Proliferation and apoptosis are regulated in part by the hydrolysis of GTP by small GTPases Ras and Rho. Another type of small GTPase, Rab, plays a role in the docking and fusion of vesicles and may also be involved in vesicle formation. In addition to its role in signal transduction, GTP also serves as an energy-rich precursor of mononucleotide units in the enzymatic biosynthesis of DNA and RNA. Synonyms: D-Guanosine 5'-triphosphate; Guanosine triphosphate; Guanosine 5'-triphosphoric acid; pppG; guanosine 5'-O-(triphosphate); [[(2R,3S,4R,5R)-5-(2-amino-6-oxo-1H-purin-9-yl)-3,4-dihydroxyoxolan-2-yl]methoxy-hydroxyphosphoryl] phosphono hydrogen phosphate. Molecular formula: C10H16N5O14P3 (free acid). Mole weight: 523.18 (free acid). | |
| GTP 14564 | GTP 14564. Group: Biochemicals. Grades: Purified. CAS No. 34823-86-4. Pack Sizes: 10mg. US Biological Life Sciences. | Worldwide |
| GTP-14564 | GTP-14564 is a specific kinase inhibitor for ITD-FLT3. GTP-14564 inhibited the growth of interleukin-3-independent Ba/F3 expressing ITD-FLT3 at 1 microM, whereas a 30-fold higher concentration of GTP-14564 was required to inhibit FLT3 ligand-dependent growth of Ba/F3 expressing wild type FLT3 (wt-FLT3). Synonyms: GTP 14564; GTP14564; 1-Phenyl-3-H-8-oxa-2,3-diaza-cyclopenta[a]inden. CAS No. 34823-86-4. Molecular formula: C15H10N2O. Mole weight: 234.25. | |
| GTP-14564 - CAS 34823-86-4 | A cell-permeable, reversible, and ATP-competitive tricyclic benzofurano-indazolo compound that acts as a potent and specific inhibitor of class III receptor tyrosine kinases. Group: Fluorescence/luminescence spectroscopy. | |
| GTP 3',8-cyclase | The enzyme catalyses an early step in the biosynthesis of the molybdenum cofactor (MoCo). In bacteria and plants the reaction is catalysed by MoaA and Cnx2, respectively. In mammals it is catalysed by the MOCS1A domain of the bifunctional MOCS1 protein, which also catalyses EC 4.6.1.17, cyclic pyranopterin monophosphate synthase. The enzyme belongs to the superfamily of radical S-adenosyl-L-methionine (radical SAM) enzymes, and contains two oxygen-sensitive FeS clusters. Group: Enzymes. Synonyms: MOCS1A (gene name); moaA (gene name); cnx2 (gene name). Enzyme Commission Number: EC 4.1.99.22. Storage: Store it at +4 ?C for short term. For long term storage, store it at -20 ?C?-80 ?C. Form: Liquid or lyophilized powder. EXWM-4935; GTP 3',8-cyclase; EC 4.1.99.22; MOCS1A (gene name); moaA (gene name); cnx2 (gene name). Cat No: EXWM-4935. |  |
| GTPαS (Sp isomer) | GTPαS (Sp isomer) is a non-hydrolyzable analog of GTP. It contains a sulfur atom replacing one of the non-bridging oxygen atoms in the triphosphate chain. The Sp isomer specifically refers to the stereoisomer where the sulfur atom occupies a particular spatial orientation. This compound is widely used in biochemical research to study G-protein signaling pathways, as it can activate G-proteins but is resistant to hydrolysis, thereby providing sustained signaling. Synonyms: Guanosine 5'-O-(1-thiotriphosphate), Sp-isomer; SP-GTP-αS; Guanosine, 5'→P''-ester with [P''(S)]-thiotriphosphoric acid ((HO)2P(O)OP(O)(OH)OP(O)(OH)(SH)); Guanosine, 5'→P''-ester with thiotriphosphoric acid ((HO)2P(O)OP(O)(OH)OP(S)(OH)2), (S)-. Grade: ≥95% by HPLC. CAS No. 81570-51-6. Molecular formula: C10H16N5O13P3S. Mole weight: 539.24. | |
| GTPase KRas (7-15) | GTPase KRas (7-15) is a 9-aa peptide. The K-Ras protein is a GTPase, which means it converts a molecule called GTP into another molecule called GDP. In this way the K-Ras protein acts like a switch that is turned on and off by the GTP and GDP molecules. Synonyms: K-Ras 2 (7-15). | |
| GTPase NRas (55-64) | GTPase NRas (55-64) is a bioactive peptide of GTPase NRas. Ras proteins bind GDP/GTP and possess intrinsic GTPase activity. Synonyms: Transforming protein N-Ras (55-64). | |
| GTP cyclohydrolase I | The reaction involves hydrolysis of two C-N bonds and isomerization of the pentose unit; the recyclization may be non-enzymic. This enzyme is involved in the de novo synthesis of tetrahydrobiopterin from GTP, with the other enzymes involved being EC 1.1.1.153 (sepiapterin reductase) and EC 4.2.3.12 (6-pyruvoyltetrahydropterin synthase). Group: Enzymes. Synonyms: GTP cyclohydrolase; guanosine triphosphate cyclohydrolase; guanosine triphosphate 8-deformylase; dihydroneopterin triphosphate synthase; GTP 8-formylhydrolase. Enzyme Commission Number: EC 3.5.4.16. CAS No. 37289-19-3. Storage: Store it at +4 ?C for short term. For long term storage, store it at -20 ?C?-80 ?C. Form: Liquid or lyophilized powder. EXWM-4542; GTP cyclohydrolase I; EC 3.5.4.16; 37289-19-3; GTP cyclohydrolase; guanosine triphosphate cyclohydrolase; guanosine triphosphate 8-deformylase; dihydroneopterin triphosphate synthase; GTP 8-formylhydrolase. Cat No: EXWM-4542. | |
| GTP cyclohydrolase II | Two C-N bonds are hydrolysed, releasing formate, with simultaneous removal of the terminal diphosphate. Group: Enzymes. Synonyms: guanosine triphosphate cyclohydrolase II; GTP-8-formylhydrolase. Enzyme Commission Number: EC 3.5.4.25. CAS No. 56214-35-8. Storage: Store it at +4 ?C for short term. For long term storage, store it at -20 ?C?-80 ?C. Form: Liquid or lyophilized powder. EXWM-4552; GTP cyclohydrolase II; EC 3.5.4.25; 56214-35-8; guanosine triphosphate cyclohydrolase II; GTP-8-formylhydrolase. Cat No: EXWM-4552. | |
| GTP cyclohydrolase IIa | Requires Mg2+. This enzyme catalyses the hydrolysis of the imidazole ring of guanosine 5'-triphosphate, N7-methylguanosine 5'-triphosphate or inosine 5'-triphosphate. Xanthosine 5'-triphosphate and ATP are not substrates. It also catalyses the hydrolysis of diphosphate to form two equivalents of phosphate. Unlike GTP cyclohydrolase II (EC 3.5.4.25), this enzyme does not release formate, but does hydrolyse the diphosphate from GTP to phosphate. Group: Enzymes. Enzyme Commission Number: EC 3.5.4.29. Storage: Store it at +4 ?C for short term. For long term storage, store it at -20 ?C?-80 ?C. Form: Liquid or lyophilized powder. EXWM-4556; GTP cyclohydrolase IIa; EC 3.5.4.29. Cat No: EXWM-4556. | |
| GTP cyclohydrolase IV | Requires Fe2+. A zinc protein. The enzyme is involved in methanopterin biosynthesis in methanogenic archaea. cf. GTP cyclohydrolase I (EC 3.5.4.16), GTP cyclohydrolase II (EC 3.5.4.25) and GTP cyclohydrolase IIa (EC 3.5.4.29). Group: Enzymes. Synonyms: MptA; GTP cyclohydrolase MptA. Enzyme Commission Number: EC 3.5.4.39. Storage: Store it at +4 ?C for short term. For long term storage, store it at -20 ?C?-80 ?C. Form: Liquid or lyophilized powder. EXWM-4567; GTP cyclohydrolase IV; EC 3.5.4.39; MptA; GTP cyclohydrolase MptA. Cat No: EXWM-4567. | |
| GTP diphosphokinase | GDP can also act as acceptor. Group: Enzymes. Synonyms: stringent factor; guanosine 3',5'-polyphosphate synthase; GTP pyrophosphokinase; ATP-GTP 3'-diphosphotransferase; guanosine 5',3'-polyphosphate synthetase; (p)ppGpp synthetase I; (p)ppGpp synthetase II; guanosine pentaphosphate synthetase; GPSI; GPSII. Enzyme Commission Number: EC 2.7.6.5. CAS No. 63690-89-1. Storage: Store it at +4 ?C for short term. For long term storage, store it at -20 ?C?-80 ?C. Form: Liquid or lyophilized powder. EXWM-3224; GTP diphosphokinase; EC 2.7.6.5; 63690-89-1; stringent factor; guanosine 3',5'-polyphosphate synthase; GTP pyrophosphokinase; ATP-GTP 3'-diphosphotransferase; guanosine 5',3'-polyphosphate synthetase; (p)ppGpp synthetase I; (p)ppGpp synthetase II; guanosine pentaphosphate synthetase; GPSI; GPSII. Cat No: EXWM-3224. | |
| GTP-γ-AmNS | GTP-γ-AmNS is a fluorescent analogue of GTP used for the determination of enzymes specialized to cleave α/β-phosphodiester bonds. Synonyms: Guanosine- 5'- O- triphosphoro- γ- 1- (5- sulfonic acid)naphthylamidate, sodium salt. Grade: ≥ 95% by HPLC. CAS No. 76724-84-0. Molecular formula: C20H23N6O16P3S (free acid). Mole weight: 728.4 (free acid). | |
| GTP-γ-S | GTP-γ-S. Uses: Designed for use in research and industrial production. Additional or Alternative Names: Guanosine-5'-O-(3-thiotriphosphate). tetrasodium salt. CAS No. 37589-80-3. Molecular formula: C10H16N5O13P3S. Mole weight: 539.3 (free acid). Purity: 0.95. Product ID: ACM37589803. Alfa Chemistry ISO 9001:2015 Certified. Categories: GT PSP. |  |
| GTPγS | GTPγS is a stable G-protein-activating (GTP) analog. The physiological actions of GTPgammaS includestimulation of guanine nucleotide-binding proteins, phosphoinositide hydrolysis, cyclic AMP accumulation, and activation of specific proto-oncogenes. Synonyms: Guanosine-5'-(γ-thio)-triphosphate, Tetralithium salt; Guanosine-5'-(3-thio)-triphosphate; Guanosine-5'-(3-thiotriphosphate). Grade: ≥ 90 % by HPLC, contains < 10 % GDP. CAS No. 94825-44-2. Molecular formula: C10H16N5O13P3S (free acid). Mole weight: 539.24 (free acid). | |
| G-TPP | G-TPP is a mitochondria-targeted Hsp90 inhibitor that increases cell death in HeLa and MCF7 cells, consistently inhibits cell death induced by oxidative stress and mitochondrial dysfunction induced by PINK1 mutation in mouse embryonic fibroblast cells and DA cell models such as SH-SY5Y and SN4741 cells. Additionally, G-TPP also suppresses the defective locomotive activity and DA neuron loss in Drosophila PINK1 null mutants. Synonyms: G-TPP; G TPP. Grade: >98%. CAS No. 1131626-46-4. Molecular formula: C52H65N3O8P. Mole weight: 890.85. | |
| GTRI-02 | GTRI-02 is produced by the strain of Micromonospora sp. SA246. Its IC50 of inhibiting lipid peroxidation was 1.89 μg/mL, which was half of that of vitamin E. Synonyms: 7-acetyl-3,6-dihydroxy-8-methyl-tetralone. Molecular formula: C13H14O4. Mole weight: 234.25. | |
| GTRI-BB | GTRI-BB is from Micromonospora sp. SA-246 with anti-gram-positive bacteria activity and cytotoxicity. The GI50 (μg/mL) of PC-3 (prostate), A549 (lung) and K562 (leukemia) cells were 0.21, 0.25 and 0.21 respectively. Molecular formula: C33H26O13. Mole weight: 630.55. | |
| gTS-21 | gTS-21. Group: Biochemicals. Grades: Highly Purified. CAS No. 148372-04-7. Pack Sizes: 1mg, 2mg, 5mg, 10mg, 25mg. US Biological Life Sciences. | Worldwide |
| GTS-21 | GTS-21 is a highly efficacious pharmaceutical compound used in studying the intricate afflictions of Alzheimer's disease and cognitive impairments. Uses: Nicotinic agonists. Synonyms: 3-[(2,4-Dimethoxyphenyl)methylene]-3,4,5,6-tetrahydro-2,3'-bipyridine; GTS-21; GTS21; GTS 21; DMXB-A. CAS No. 148372-04-7. Molecular formula: C19H20N2O2. Mole weight: 308.381. | |
| GTS-21 | ?97% (HPLC). Group: Fluorescence/luminescence spectroscopy. | |
| GTS-21 dihydrochloride | GTS-21 dihydrochloride is a selective alpha7 nicotinic acetylcholine receptor (α7-nAChR) agonist with anti - inflammatory and cognition - enhancing activities. GTS-21 dihydrochloride is also a α4β2 ( K i =20 nM for humanα4β2) and 5-HT3A receptor ( IC 50 =3.1 μM) antagonist [1] [2]. Uses: Scientific research. Group: Signaling pathways. Alternative Names: DMXB-A; DMBX-anabaseine. CAS No. 156223-05-1. Pack Sizes: 10 mM * 1 mL; 5 mg; 10 mg; 50 mg; 100 mg. Product ID: HY-14564A. | |
| GTS-21 dihydrochloride | GTS-21, also known as DMBX-A, is a derivative of the natural product anabaseine that acts as a partial agonist at neural nicotinic acetylcholine receptors. It binds to both the α4β2 and α7 subtypes, but activates only the α7 to any significant extent. Synonyms: GTS-21; GTS 21; GTS21; DMBX-A. Grade: 98%. CAS No. 156223-05-1. Molecular formula: C19H20N2O2.2HCl. Mole weight: 381.30. | |
| GTS-21 Dihydrochloride (DMBX-A, (E)-3-(2,4-dimethoxybenzylidene)-3,4,5,6-tetrahydro-2,3'-bipyridine, DMBX-A, alpha7 nAChR Agonist, GTS-21, Alpha 7 Nicotinic Acetylcholine Receptor Agonist, GTS-21) | A partial agonist selective for alpha7 nAChRs (EC50 = 10uM). Used in neuroimmunology studies, cardiovascular disease research, and Alzheimer's disease studies. Group: Biochemicals. Grades: Highly Purified. CAS No. 156223-05-1. Pack Sizes: 10mg. US Biological Life Sciences. | Worldwide |
| GTx-007 | GTx-007 (S-4) is an orally active and selective nonsteroidal androgen receptor (AR) modulator (SARM) and a partial agonist, with Ki of 4 nM. GTx-007 (S-4) is identified as SARMs with potent and tissue-selective in vivo pharmacological activity[1][2]. Uses: Scientific research. Group: Signaling pathways. Alternative Names: S-4. CAS No. 401900-40-1. Pack Sizes: 10 mM * 1 mL; 5 mg; 10 mg; 50 mg; 100 mg. Product ID: HY-12023. | |
| GTX-758 | GTX-758 is an orally active, nonsteroidal, selective agonist of ER&alpha. GTX-758 plays an important role in castration resistant prostate cancer (CRPC) research [1]. Uses: Scientific research. Group: Signaling pathways. CAS No. 938067-78-8. Pack Sizes: 5 mg; 10 mg. Product ID: HY-111061. | |
| Guacetisal | Guacetisal is obtained from the esterification of acetylsalicylic acid with guaiacol which has the potential for chronic bronchitis treatment extracted from patent CN 106866420 A. Uses: Scientific research. Group: Signaling pathways. CAS No. 55482-89-8. Pack Sizes: 10 mM * 1 mL; 5 mg; 10 mg; 25 mg; 50 mg; 100 mg. Product ID: HY-17477. | |
| Guadecitabine sodium | Guadecitabine sodium (SGI-110 sodium) is a second-generation DNA methyltransferases ( DNMT ) inhibitor for research of acute myeloid leukemia (AML) and myelodysplastic syndromes (MDS) [1]. Uses: Scientific research. Group: Signaling pathways. Alternative Names: SGI-110 sodium; S-110 sodium. CAS No. 929904-85-8. Pack Sizes: 10 mM * 1 mL; 1 mg; 5 mg; 10 mg; 25 mg; 50 mg; 100 mg. Product ID: HY-15229. | |
| Guaiac gum | Gum guaiac is a tree resin and crude source of 2,5-di-(4-hydroxy-3-methoxyphenyl)-3,4-dimethylfuran (α-guaiaconic acid).[3] The phenolic α-guaiaconic acid acts as a colorimetric peroxidase substrate.[1][2][4] When reacted with an organic or inorganic oxidizing agent, the α-guaiaconic acid is oxidized to a blue-colored quinone. The guaiac reaction has been used to detect trace amounts of heme from hemoglobin in the presence of peroxide. The Nobles test can be performed using 67% (w/v) gum guaiac diluted in 96% ethanol to analyze the level of extracellular oxidase production [5]. Group: Biochemicals. Grades: Highly Purified. CAS No. 9000-29-7. Pack Sizes: 25g, 50g, 100g, 250g, 500g. US Biological Life Sciences. | Worldwide |
| Guaiacin | Guaiacin. Group: Biochemicals. Grades: Plant Grade. CAS No. 36531-08-5. Pack Sizes: 5mg. Molecular Formula: C20H24O4, Molecular Weight: 328.41. US Biological Life Sciences. | Worldwide |
| Guaiacin | Guaiacin is a arylnaphthalene type lignin isolated from the barks of Machilus thunbergii SIEB. et ZUCC (Lauraceae). Guaiacin significantly increases alkaline phosphatase activity and osteoblast differentiation [1]. Uses: Scientific research. Group: Natural products. CAS No. 36531-08-5. Pack Sizes: 5 mg; 10 mg. Product ID: HY-N2247. | |
| Guaiacol | Guaiacol, a phenolic compound, inhibits LPS-stimulated COX-2 expression and NF-κB activation [1]. Anti-inflammatory activity [1]. Uses: Scientific research. Group: Natural products. Alternative Names: 2-Methoxyphenol. CAS No. 90-05-1. Pack Sizes: 10 mM * 1 mL; 5 g; 25 g; 50 g. Product ID: HY-N1380. | |
| Guaiacol (2-Methoxyphenol) | 1kg Pack Size. Group: Aroma Chemicals, Biochemicals, Building Blocks, Flavours and Fragrance Materials, Phenols. Formula: C7H8O2. CAS No. 90-05-1. Prepack ID 22444940-1kg. Molecular Weight 124.14. See USA prepack pricing. |  |
| Guaiacol 98% | Guaiacol 98%. CAS No. 90-05-1. FEMA No. 2532. Kosher: Y. VIGON Item # 502649. Categories: Speciality Ingrdients Suppliers, Flavors, Fragrances, Perfumers. |  America & Internationally |
| Guaiacol Carbonate | Guaiacol Carbonate acts as an expectorant by virtue of a reflex from the stomach by way of the afferent gastric nerves to the medullary centres and thenperipherally again to the respiratory tract [1]. Uses: Scientific research. Group: Signaling pathways. CAS No. 553-17-3. Pack Sizes: 10 mM * 1 mL; 500 mg; 1 g. Product ID: HY-Y1876. | |
| Guaiacol EP Impurity G | Guaiacol EP Impurity G. Uses: For analytical and research use. Group: Impurity standards. CAS No. 150-76-5. Molecular formula: C7H8O2. Mole weight: 124.14. Catalog: APB150765. | |
| Guaiacol glyceryl ether | Guaiacol glyceryl ether. Uses: Designed for use in research and industrial production. Product Category: Ethers. CAS No. 93-14-1. Molecular formula: C10H14ClNO. Mole weight: 198.22. Product ID: ACM93141. Alfa Chemistry ISO 9001:2015 Certified. | |
| Guaiacol glycidyl ether | Guaiacol glycidyl ether. Group: Monomers. Alternative Names: GUAIACOL GLYCIDYL ETHER; [(2-methoxyphenoxy)methyl]oxirane; 3-(O-METHOXYPHENOXY)-1,2-EPOXYPROPANE; O-METHOXY PHENYL CYCLOXYPROPYL ETHER; 1,2-epoxy-3-(o-methoxyphenoxy)-propan; 1,2-epoxy-3-(o-methoxyphenoxy)propane; 3-(2-Methoxphenoxy)-1,2-epoxypropane; guajacol. CAS No. 2210-74-4. Product ID: 2-[(2-methoxyphenoxy)methyl]oxirane. Molecular formula: 180.2g/mol. Mole weight: C10H12O3. COC1=CC=CC=C1OCC2CO2. InChI=1S/C10H12O3/c1-11-9-4-2-3-5-10 (9)13-7-8-6-12-8/h2-5, 8H, 6-7H2, 1H3. RJNVSQLNEALZLC-UHFFFAOYSA-N. 98%. |  |
| Guaiacol glycidyl ether | 1-(2,3-Epoxypropoxy)-2-methoxybenzene is one of Ranolazine intermediates. Ranolazine is an anti-ischemic agent which modulates myocardial metabolism. Synonyms: 1,2-Epoxy-3-(2-methoxyphenoxy)propane; 1,2-Epoxy-3-(o-methoxyphenoxy)propane; Glycidyl 2-Methoxyphenyl Ether; 1-(2-Methoxyphenoxy)-2,3-epoxypropane; NSC 112256; NSC 133442; Guaiacol glycidyl ether; Methoxyphenyl glycidyl ether; Ranolazine Impurity 6; Ranolazine USP Related Compound A. Grade: 96%. CAS No. 2210-74-4. Molecular formula: C10H12O3. Mole weight: 180.20. | |
| Guaiacol Natural | Guaiacol Natural. CAS No. 90-05-1. FEMA No. 2532. Kosher: Y. VIGON Item # 507731. Categories: Speciality Ingrdients Suppliers, Flavors, Fragrances, Perfumers. | America & Internationally |
| Guaiacol Propionate | Guaiacol Propionate is an intermediate in the synthesis of 1-(4-Hydroxy-3-methoxyphenyl)-1-propanone (H947600), which is a derivative of Guaiacol, a precursor to various flavorants, such as eugenol and vanillin. Group: Biochemicals. Grades: Highly Purified. CAS No. 7598-60-9. Pack Sizes: 250mg, 500mg. Molecular Formula: C10H12O3. US Biological Life Sciences. | Worldwide |
| Guaiacwood Acetate | Guaiacwood Acetate. CAS No. 61789-17-1. Kosher: Y. VIGON Item # 500174. Categories: Speciality Ingrdients Suppliers, Fragrances, Perfumers. | America & Internationally |
| Guaiacwood Oil | Guaiacwood Oil. CAS No. 8016-23-7. FEMA No. 2534. Kosher: Y. VIGON Item # 500490. Categories: Speciality Ingrdients Suppliers, Flavors, Fragrances, Perfumers. | America & Internationally |
| Guaiaverin | analytical standard. Group: Herbal medicinal products standards. | |
| Guaiazulene | Guaiazulene. Group: Biochemicals. Grades: Highly Purified. CAS No. 489-84-9. Pack Sizes: 25g, 50g, 100g, 250g, 500g. Molecular Formula: C15H18. US Biological Life Sciences. | Worldwide |
| Guaiazulene | 25g Pack Size. Group: Aroma Chemicals, Biochemicals, Flavours and Fragrance Materials. Formula: C15H18. CAS No. 489-84-9. Prepack ID 21265582-25g. Molecular Weight 198.31. See USA prepack pricing. | |
| Guaiazulene | Guaiazulene is present in several essential oils of medicinal and aromatic plants, with antioxidant activity. Guaiazulene has in vitro cytotoxic activity against neuron and N2a neuroblastom (N2a-NB) cells [1] [2]. Uses: Scientific research. Group: Natural products. CAS No. 489-84-9. Pack Sizes: 10 mM * 1 mL; 100 mg; 500 mg. Product ID: HY-N6951. | |
| Guaiazulene | Guaiazulene. Uses: Designed for use in research and industrial production. Additional or Alternative Names: 1,4-Dimethyl-7-(1-methylethyl)-azulen. Product Category: Arenes. Appearance: Solid. CAS No. 489-84-9. Molecular formula: C15H18. Mole weight: 198.3. Purity: 0.98. IUPACName: 1,4-Dimethyl-7-propan-2-ylazulene. Canonical SMILES: CC1=C2C=CC(=C2C=C(C=C1)C(C)C)C. Density: 0.976 g/mL at 25 °C(lit.). Product ID: ACM489849. Alfa Chemistry ISO 9001:2015 Certified. | |
| Guaiazulene | Guaiazulene - Product ID: NST-10-94. Category: Terpenes. Alternative Names: 1,4-Dimethyl-7-isopropylazulene. Purity: 98%. Test method: HPLC. CAS No. 489-84-9. Pack Sizes: 5g, 10g, 25g, 50g. Appearance: Blue Solid. Molecular formula: C15H18. Mole weight: 198.3. Storage: +2 +8 °C. |  |
| Guaiazulene | Guaiazulene. Synonyms: 1,4-Dimethyl-7-isopropylazulene. CAS No. 489-84-9. Pack Sizes: 10, 25 g in glass bottle. Product ID: CDC10-0156. Molecular formula: C15H18. Category: Cosmetic Color Additives. Product Keywords: Cosmetic Ingredients; Cosmetic Color Additives; Guaiazulene; CDC10-0156; 489-84-9; C15H18; 1,4-Dimethyl-7-isopropylazulene; 207-701-2; MFCD00003811; 489-84-9. Purity: 0.99. Color: Dark blue. EC Number: 207-701-2. Physical State: Low Melting Crystalline Solid. Solubility: Chloroform (Slightly), Methanol (Sparingly). Quality Level: 100. Storage: Sealed in dry,2-8°C. Boiling Point: 153 °C/7 mmHg (lit.). Melting Point: 27-29 °C (lit.). Density: 0.976 g/mL at 25 °C (lit.). |  |
| Guaiene Natural | Guaiene Natural. CAS No. 88-84-6. Kosher: Y. VIGON Item # 500954. Categories: Speciality Ingrdients Suppliers, Flavors, Fragrances, Perfumers, Aromatherapy, Essetial Oils. | America & Internationally |
| Guaifenesin | 25g Pack Size. Group: Bioactive Small Molecules, Research Organics & Inorganics. Formula: C10H14O4. CAS No. 93-14-1. Prepack ID 44749496-25g. Molecular Weight 198.22. See USA prepack pricing. | |
| Guaifenesin | Guaifenesin (Guaiacol glyceryl ether), a constituent of guaiac resin from the wood of Guajacum officinale Linné, is an expectorant. Guaifenesin can alleviate cough discomfortby increasing sputum volume and decreasing its viscosity, thereby promoting effective cough [1] [2]. Uses: Scientific research. Group: Natural products. Alternative Names: Guaiacol glyceryl ether; Guaiphenesin; Glycerol guaiacolate. CAS No. 93-14-1. Pack Sizes: 10 mM * 1 mL; 500 mg; 1 g; 5 g. Product ID: HY-B0264. | |
| Guaifenesin | Pharmaceutical Secondary Standard; Certified Reference Material. Group: Pharmacopeia & metrological institutes standards. | |
Our database is helping our users find suppliers everyday.
