A directory of where to buy chemicals in the USA, including: distributors, industrial manufacturers, bulk supplies and wholesalers of raw ingredients & finished goods.
Pancreatic Microvascular Endothelial Cells, Human (Frozen)
Passage 3 cells are shipped in proliferating culture with a confluence of >90%. ENDO-Growth medium containing 5% serum and growth supplement is recommended for culture. Cells have an average population doubling level of >16 when cultured. Group: Biologicals. Grades: Cell Culture Grade. Pack Sizes: 1ml. US Biological Life Sciences.
Worldwide
Pancreatic Microvascular Endothelial Cells, Human (T-25 flask)
Passage 3 cells are shipped in proliferating culture with a confluence of >90%. ENDO-Growth medium containing 5% serum and growth supplement is recommended for culture. Cells have an average population doubling level of >16 when cultured. Group: Biologicals. Grades: Cell Culture Grade. Pack Sizes: T-25 flask. US Biological Life Sciences.
Worldwide
Pancreatic polypeptide
Pancreatic polypeptide is a peptide secreted by the endocrine PP cells of the pancreas that regulates pancreatic secretory activity and also affects hepatic glycogen stores and gastrointestinal secretion [1]. Uses: Scientific research. Group: Peptides. CAS No. 59763-91-6. Pack Sizes: 1 mg; 5 mg; 10 mg. Product ID: HY-P4060.
Pancreatic Polypeptide, bovine
Pancreatic Polypeptide, bovine, a straight chain polypeptide containing 36 amino acids, derived primarily from the pancreas, and stimulates pancreatic secretion by inhibiting secretin and cholecystokinin. As the NPY receptor agonist, it has a high affinity at NPYR4. Synonyms: Ala-Pro-Leu-Glu-Pro-Glu-Tyr-Pro-Gly-Asp-Asn-Ala-Thr-Pro-Glu-Gln-Met-Ala-Gln-Tyr-Ala-Ala-Glu-Leu-Arg-Arg-Tyr-Ile-Asn-Met-Leu-Thr-Arg-Pro-Arg-Tyr-NH2; Pancreatic polypeptide (pig), 6-L-glutamic acid-; Bovine pancreatic polypeptide. Grade: ≥95%. CAS No. 179986-89-1. Molecular formula: C186H287N53O56S2. Mole weight: 4225.78.
Pancreatic polypeptide(human)
Pancreatic polypeptide(human). Uses: Designed for use in research and industrial production. Additional or Alternative Names: PANCREATIC POLYPEPTIDE;PANCREATIC POLYPEPTIDE, HUMAN;PP, HUMAN;APLEPVYPGDNATPEQMAQYAADLRRYINMLTRPRY-NH2;H-ALA-PRO-LEU-GLU-PRO-VAL-TYR-PRO-GLY-ASP-ASN-ALA-THR-PRO-GLU-GLN-MET-ALA-GLN-TYR-ALA-ALA-ASP-LEU-ARG-ARG-TYR-ILE-ASN-MET-LEU-THR-ARG-PRO-ARG-TYR-NH2. Product Category: Heterocyclic Organic Compound. CAS No. 59763-91-6. Molecular formula: C185H287N53O54S2. Product ID: ACM59763916. Alfa Chemistry ISO 9001:2015 Certified.
Pancreatic Polypeptide (human)
Pancreatic Polypeptide (human). Group: Biochemicals. Grades: Purified. CAS No. 75976-10-2. Pack Sizes: 200ug. US Biological Life Sciences.
Worldwide
Pancreatic Polypeptide, human
Pancreatic Polypeptide, human is a C-terminally amidated 36 amino acid peptide, which acts as a neuropeptide Y ( NPY ) Y4 / Y5 receptor agonist. Uses: Scientific research. Group: Peptides. Alternative Names: Human pancreatic polypeptide. CAS No. 75976-10-2. Pack Sizes: 500 μg; 1 mg; 5 mg. Product ID: HY-P0199.
Pancreatic Polypeptide, human
Pancreatic polypeptide is an agonist of neuropeptide Y (NPY) receptors that reduces forskolin-induced cAMP accumulation in L-M(TK-) cells recombinantly expressing human and rat Y4 receptors (EC50s = 87.1 and 36.3 pM, respectively). It is believed to play an important role in the function of the gastrointestinal tract. Uses: Gastrointestinal agents. Synonyms: Human pancreatic polypeptide; L-alanyl-L-prolyl-L-leucyl-L-alpha-glutamyl-L-prolyl-L-valyl-L-tyrosyl-L-prolyl-glycyl-L-alpha-aspartyl-L-asparagyl-L-alanyl-L-threonyl-L-prolyl-L-alpha-glutamyl-L-glutaminyl-L-methionyl-L-alanyl-L-glutaminyl-L-tyrosyl-L-alanyl-L-alanyl-L-alpha-aspartyl-L-leucyl-L-arginyl-L-arginyl-L-tyrosyl-L-isoleucyl-L-asparagyl-L-methionyl-L-leucyl-L-threonyl-L-arginyl-L-prolyl-L-arginyl-L-tyrosinamide; Ala-Pro-Leu-Glu-Pro-Val-Tyr-Pro-Gly-Asp-Asn-Ala-Thr-Pro-Glu-Gln-Met-Ala-Gln-Tyr-Ala-Ala-Asp-Leu-Arg-Arg-Tyr-Ile-Asn-Met-Leu-Thr-Arg-Pro-Arg-Tyr-NH2. Grade: ≥95%. CAS No. 75976-10-2. Molecular formula: C185H287N53O54S2. Mole weight: 4181.71.
Pancreatic Polypeptide, rat
Pancreatic Polypeptide, rat is an agonist of NPY receptor with high affinity at NPYR4. Synonyms: Rat pancreatic polypeptide; Ala-Pro-Leu-Glu-Pro-Met-Tyr-Pro-Gly-Asp-Tyr-Ala-Thr-His-Glu-Gln-Arg-Ala-Gln-Tyr-Glu-Thr-Gln-Leu-Arg-Arg-Tyr-Ile-Asn-Thr-Leu-Thr-Arg-Pro-Arg-Tyr-NH2; L-alanyl-L-prolyl-L-leucyl-L-alpha-glutamyl-L-prolyl-L-methionyl-L-tyrosyl-L-prolyl-glycyl-L-alpha-aspartyl-L-tyrosyl-L-alanyl-L-threonyl-L-histidyl-L-alpha-glutamyl-L-glutaminyl-L-arginyl-L-alanyl-L-glutaminyl-L-tyrosyl-L-alpha-glutamyl-L-threonyl-L-glutaminyl-L-leucyl-L-arginyl-L-arginyl-L-tyrosyl-L-isoleucyl-L-asparagyl-L-threonyl-L-leucyl-L-threonyl-L-arginyl-L-prolyl-L-arginyl-L-tyrosinamide. Grade: ≥95%. CAS No. 90419-12-8. Molecular formula: C195H298N58O57S. Mole weight: 4398.87.
pancreatic ribonuclease
Specifically, the enzymes are involved in endonucleolytic cleavage of 3'-phosphomononucleotides and 3'-phosphooligonucleotides ending in C-P or U-P with 2',3'-cyclic phosphate intermediates. Ribonuclease can unwind the RNA helix by complexing with single-stranded RNA; the complex arises by an extended multi-site cation-anion interaction between lysine and arginine residues of the enzyme and phosphate groups of the nucleotides. Group: Enzymes. Synonyms: RNase; RNase I; RNase A; pancreatic RNase; ribonuclease I; endoribonuclease I; ribonucleic phosphatase; alkaline ribonuclease; ribonuclease; gene S glycoproteins; Ceratitis capitata alkaline ribonuclease; SLSG glycoproteins; gen. glycoproteins; ribonucleate 3'-pyrimidino-oligonucleotidohydrolase. Enzyme Commission Number: EC 3.1.27.5. CAS No. 9001-99-4. Rnase. Storage: Store it at +4 ?C for short term. For long term storage, store it at -20 ?C?-80 ?C. Form: Liquid or lyophilized powder. EXWM-3603; pancreatic ribonuclease; EC 3.1.27.5; 9001-99-4; RNase; RNase I; RNase A; pancreatic RNase; ribonuclease I; endoribonuclease I; ribonucleic phosphatase; alkaline ribonuclease; ribonuclease; gene S glycoproteins; Ceratitis capitata alkaline ribonuclease; SLSG glycoproteins; gene S locus-specific glycoproteins; S-genotype-asssocd. glycoproteins; ribonucleate 3'-pyrimidino-oligonucleotidohydrolase. Cat No: EXWM-3603.
Pancreatin
Pancreatin is the porcine pancreas extract (PPE) which contains the main pancreatic digestive enzymes. Uses: Scientific research. Group: Signaling pathways. CAS No. 8049-47-6. Pack Sizes: 500 mg; 1 g. Product ID: HY-B2118.
100g Pack Size. Group: Analytical Reagents, Biochemicals, Research Organics & Inorganics. CAS No. 8049-47-6. Prepack ID 90029842-100g. See USA prepack pricing.
PANCREATIN
PANCREATIN. Uses: Designed for use in research and industrial production. Additional or Alternative Names: PANCREATIN, 3X. Product Category: Heterocyclic Organic Compound. CAS No. 9046-39-3. Purity: 0.96. Product ID: ACM9046393. Alfa Chemistry ISO 9001:2015 Certified.
Pancreatin, 5% Aqueous, Laboratory Grade, 500 mL
Notes: Keep refrigerated. Health Risk: 1. Flammability: 1. Reactivity: 1. Grades: chem-grade laboratory. CAS No. 8049-47-6. Product ID: 878953. -- SOLD FOR EDUCATIONAL USE ONLY --
Pancreatin amylase and protease
United States Pharmacopeia (USP) Reference Standard. Group: Pharmacopeia & metrological institutes standards.
United States Pharmacopeia (USP) Reference Standard. Group: Pharmacopeia & metrological institutes standards.
Pancreatin, Powder, Laboratory Grade, 100 g
Notes: Keep refrigerated. Health Risk: 1. Flammability: 1. Reactivity: 0. Grades: chem-grade laboratory. CAS No. 8049-47-6. Product ID: 878929. -- SOLD FOR EDUCATIONAL USE ONLY --
Pancuronium bromide
United States Pharmacopeia (USP) Reference Standard. Group: Pharmacopeia & metrological institutes standards.
Pancuronium bromide Related Compound A
United States Pharmacopeia (USP) Reference Standard. Group: Pharmacopeia & metrological institutes standards.
Pancuronium bromide Related Compound B
United States Pharmacopeia (USP) Reference Standard. Group: Pharmacopeia & metrological institutes standards.
Pancuronium bromide Related Compound C
United States Pharmacopeia (USP) Reference Standard. Group: Pharmacopeia & metrological institutes standards.
Pancuronium dibromide
Pancuronium dibromide. Group: Biochemicals. Grades: Purified. CAS No. 15500-66-0. Pack Sizes: 10mg, 50mg. US Biological Life Sciences.
Worldwide
Pancuronium dibromide
Pancuronium dibromide, a bis-quaternary steroid, is a neuromuscular relaxant. Pancuronium dibromide inhibits neuromuscular transmission by competing with acetylcholine for binding sites on nACh receptors. Pancuronium dibromide also inhibits cardiac muscarinic receptors and has a sympathomimetic action [1] [2] [3]. Uses: Scientific research. Group: Signaling pathways. CAS No. 15500-66-0. Pack Sizes: 10 mM * 1 mL; 5 mg; 10 mg; 50 mg; 100 mg. Product ID: HY-B0429.
A highly potent competitive antagonist selective for nAChRs (IC50 = 5.5nM). A very potent non-depolarizing skeletal muscle relaxant but no sedative or analgesic effects. Group: Biochemicals. Grades: Highly Purified. CAS No. 15500-66-0. Pack Sizes: 10mg. Molecular Formula: C??H??N?O? Br?. US Biological Life Sciences.
Worldwide
Pandan Leaf Powder
Pandan Leaf Powder is made of pandan leaf as raw material and processed by spray drying technology. Product ID: CDF4-0227. Category: Flavour. Product Keywords: Flavor Enhancers; Pandan Leaf Powder; CDF4-0227; Flavour;. Grade: Food Grade. Color: Green powder. Physical State: powder. Storage: Room Temperature. Applications: Widely used in baking, pastry, meal replacement powder.
Pandinin-1
Pandinin-1 is an antimicrobial peptide found in Pandinus imperator (Emperor scorpion), and has antibacterial activity. Synonyms: pandinin 1; pin 1; Recombinant Pandinus imperator Pandinin-1. Grade: >85%. Molecular formula: C220H350N58O62. Mole weight: 4799.55.
Pandinin-2
Pandinin-2 is an antimicrobial peptide found in Pandinus imperator (Emperor scorpion), and has antibacterial activity. Synonyms: pandinin 2; pin 2; Recombinant Pandinus imperator Pandinin-2; Phe-Trp-Gly-Ala-Leu-Ala-Lys-Gly-Ala-Leu-Lys-Leu-Ile-Pro-Ser-Leu-Phe-Ser-Ser-Phe-Ser-Lys-Lys-Asp. Grade: ≥97%. Molecular formula: C126H195N29O31. Mole weight: 2612.11.
Panduratin. Uses: Designed for use in research and industrial production. Additional or Alternative Names: Panduratin;Panduratin A;rel-(2,6-Dihydroxy-4-methoxyphenyl)[(1R,2S,6R)-3-methyl-2-(3-methyl-2-buten-1-yl)-6-phenyl-3-cyclohexen-1-yl]methanone. Product Category: Heterocyclic Organic Compound. CAS No. 89837-52-5. Molecular formula: C26H30O4. Mole weight: 0. Density: 1.128. Product ID: ACM89837525. Alfa Chemistry ISO 9001:2015 Certified.
Panepoxydone
from Lentinus conatus, ?95% (HPLC). Group: Fluorescence/luminescence spectroscopy.
Pangelin
Pangelin is a coumarin that can be found in Ducrosia anethifolia. Pangelin exhibits anti-mycobacterial and anti-tumor activities [1] [2]. Uses: Scientific research. Group: Natural products. CAS No. 33783-80-1. Pack Sizes: 1 mg; 5 mg. Product ID: HY-N8131.
Pangelin
Pangelin is a coumarin that can be found in Ducrosia anethifolia. Pangelin exhibits anti-mycobacterial and anti-tumor activities. Uses: Designed for use in research and industrial production. Product Category: Inhibitors. Appearance: Solid. CAS No. 33783-80-1. Molecular formula: C16H14O5. Mole weight: 286.28. Purity: ≥99.0%. Canonical SMILES: O=C1C=CC2=C(OC[C@H](O)C(C)=C)C3=C(OC=C3)C=C2O1. Product ID: ACM33783801. Alfa Chemistry ISO 9001:2015 Certified. Categories: Pangelinan.
Paniculal
Paniculal. Uses: Designed for use in research and industrial production. Additional or Alternative Names: 7-methoxy-8-formylcoumarine; 7-methoxy-8-formylcoumarin; 8-formyl-7-methoxycoumarin; paniculal; 7-methoxy-2-oxo-2H-chromene-8-carbaldehyde. Product Category: Heterocyclic Organic Compound. CAS No. 6724-42-1. Molecular formula: C11H8O4. Mole weight: 204.179. Purity: 0.96. IUPACName: 7-methoxy-2-oxo-2H-chromene-8-carbaldehyde. Product ID: ACM6724421. Alfa Chemistry ISO 9001:2015 Certified. Categories: Panicularia.
Paniculidine A
Paniculidine A is isolated from the herbs of Murraya exotica L. Synonyms: 1H-Indole-3-butanoic acid,R-methyl-,methyl ester,(RR)-; 1H-Indole-3-butanoic acid, α-methyl-, methyl ester, (αR)-. Grade: 97%. CAS No. 97399-93-4. Molecular formula: C14H17NO2. Mole weight: 231.3.
Paniculidine B
Paniculidine B is isolated from the herbs of Murraya exotica L. Synonyms: (2R)-4-(1-Methoxy-1H-indol-3-yl)-2-methyl-1-butanol. Grade: > 95%. CAS No. 97399-94-5. Molecular formula: C14H19NO2. Mole weight: 233.3.
Paniculidine C
Paniculidine C is isolated from the herbs of Murraya exotica L. Synonyms: (R)-2-Methyl-4-(1H-indole-3-yl)-1-butanol. CAS No. 97399-95-6. Molecular formula: C13H17NO. Mole weight: 203.3.
Paniculoside I
Paniculoside I is isolated from the herbs of Stevia rebaudiana. Synonyms: (4alpha,15beta)-15-Hydroxykaur-16-en-18-oic acid beta-D-glucopyranosyl ester; 1-O-[(5β,8α,9β,10α,13α,15β)-15-Hydroxy-18-oxokaur-16-en-18-yl]-β- D-glucopyranose. Grade: > 95%. CAS No. 60129-63-7. Molecular formula: C26H40O8. Mole weight: 480.6.
Paniculoside II
Paniculoside II is a natural diterpenoid found in the herbs of Stevia rebaudiana. Synonyms: (4R,15R)-11β,15-Dihydroxykaur-16-en-18-oic acid [β-D-glucopyranosyl] ester; Kaur-16-en-18-oic acid, 11,15-dihydroxy-, β-D-glucopyranosyl ester, (4α,11β,15β)-. Grade: >97%. CAS No. 60129-64-8. Molecular formula: C26H40O9. Mole weight: 496.59.
Paniculoside III
Paniculoside III is a natural diterpenoid compound found in several plants. . Synonyms: (4R)-11β-Hydroxy-15-oxokaur-16-en-18-oic acid β-D-glucopyranosyl ester. Grade: >95%. CAS No. 60129-65-9. Molecular formula: C26H38O9. Mole weight: 494.57.
Panipenem-betamipron
Panipenem-betamipron. Uses: Designed for use in research and industrial production. Additional or Alternative Names: Carbenin, Panipenem-betamipron, Papm-BP, Carbenin (TN), PAPM/BP, Panipenem mixture with betamipron, CID115235, LS-186953, D02509, 138240-65-0, 3-(1-(Acetimidoylpyrrolidin-3-yl)thio)-6-(1-hydroxyethyl)-7-oxo-1-azabicyclo(3.2.0)hept-2-ene-2-carboxylic acid combination with N-benzoyl-beta-alanine, beta-Alanine, N-benzoyl-, mixt. with (5R,6S)-6-((1R)-1-hydroxyethyl)-3-(((3S)-1-(1-iminoethyl)-3-pyrrolidinyl)thio)-7-oxo-1-azabicyclo(3.2.o)hept-2-ene-2-carboxylic acid, beta-Alanine, N-benzoyl-, mixt. with (5R-(3(S*),5alpha,6alpha(R*)))-6-(1-hydroxyethyl)-3-((1-(1-iminoethyl)-3-pyrrolidinyl)thio)-7-oxo-1-azabicyclo(3.2.o)hept-2-ene-2-carboxylic acid. Product Category: Heterocyclic Organic Compound. CAS No. 138240-65-0. Molecular formula: C25H32N4O7S. Mole weight: 532.609180 [g/mol]. Purity: 0.96. IUPACName: 3-benzamidopropanoic acid; (5R,6S)-3-[(3S)-1-ethanimidoylpyrrolidin-3-yl]sulfanyl-6-[(1R)-1-hydroxyethyl]-7-oxo-1-azabicyclo[3.2.0]hept-2-ene-2-carboxylic acid. Canonical SMILES: CC(C1C2CC(=C(N2C1=O)C(=O)O)SC3CCN(C3)C(=N)C)O.C1=CC=C(C=C1)C(=O)NCCC(=O)O. Product ID: ACM138240650. Alfa Chemistry ISO 9001:2015 Certified. Categories: Panipenem/betamipron.
p-Anisaldehyde. Group: Biochemicals. Alternative Names: Aubepine. Grades: Plant Grade. CAS No. 123-11-5. Pack Sizes: 100mg. Molecular Formula: C8H8O2, Molecular Weight: 136.148. US Biological Life Sciences.
Worldwide
P-Anisaldehyde
Liquid;Liquid;Liquid;colourless to slightly yellow liquid with a Intensely sweet, floral odour. Group: Liquid crystal (lc) building blocks. Alternative Names: Anisaldehyde; Benzaldehyde, 4-methoxy-; FEMA No. 2670. CAS No. 123-11-5. Product ID: 4-Methoxybenzaldehyde. Molecular formula: 136.15. Mole weight: C8H8O2. COC1=CC=C(C=C1)C=O. ZRSNZINYAWTAHE-UHFFFAOYSA-N. InChI=1S/C8H8O2/c1-10-8-4-2-7 (6-9)3-5-8/h2-6H, 1H3. 98%.
p-Anisaldehyde (4-Methoxybenzaldehyde)
100g Pack Size. Group: Analytical Reagents, Aroma Chemicals, Biochemicals, Building Blocks, Flavours and Fragrance Materials. Formula: C8H8O2. CAS No. 123-11-5. Prepack ID 51572749-100g. Molecular Weight 136.15. See USA prepack pricing.
p-Anisaldehyde (4-Methoxybenzaldehyde)
500g Pack Size. Group: Analytical Reagents, Aroma Chemicals, Biochemicals, Building Blocks, Flavours and Fragrance Materials. Formula: C8H8O2. CAS No. 123-11-5. Prepack ID 51572749-500g. Molecular Weight 136.15. See USA prepack pricing.
p-Anisaldehyde dimethyl acetal
p-Anisaldehyde dimethyl acetal. Group: Biochemicals. Alternative Names: 4-Methoxybenzaldehyde dimethyl acetal. Grades: Highly Purified. CAS No. 2186-92-7. Pack Sizes: 50g, 100g. US Biological Life Sciences.
Worldwide
p-Anisaldehyde dimethyl acetal 98+% (GC)
p-Anisaldehyde dimethyl acetal 98+% (GC). Group: Biochemicals. Grades: GC. Pack Sizes: 5g, 25g, 100g. US Biological Life Sciences.
Worldwide
p-Anisaldehyde, Reagent
Liquid;Liquid;Liquid;colourless to slightly yellow liquid with a Intensely sweet, floral odour. Group: Liquid crystal (lc) building blocks. CAS No. 123-11-5. Product ID: 4-methoxybenzaldehyde. Molecular formula: 136.15g/mol. Mole weight: C8H8O2. COC1=CC=C(C=C1)C=O. InChI=1S/C8H8O2/c1-10-8-4-2-7 (6-9)3-5-8/h2-6H, 1H3. ZRSNZINYAWTAHE-UHFFFAOYSA-N.
p-Anisic acid
p-Anisic acid (4-Methoxybenzoic acid) is an orally available tyrosinase inhibitor that has antioxidant, anti-anxiety, anti-inflammatory, anti-tumor, anti-diabetic, and preservative properties. p-Anisic acid can be used as a preservative in the cosmetics field [1] [2] [3] [4]. Uses: Scientific research. Group: Natural products. Alternative Names: 4-Methoxybenzoic acid; Draconic acid. CAS No. 100-09-4. Pack Sizes: 10 mM * 1 mL; 5 g; 10 g. Product ID: HY-N1394.
p-Anisic acid
500g Pack Size. Group: Building Blocks, Organics. Formula: CH3OC6H4COOH. CAS No. 100-09-4. Prepack ID 13899923-500g. Molecular Weight 152.15. See USA prepack pricing.
p-Anisic acid
analytical standard. Group: Flavor and fragrance standardspharma & vet compounds & metabolitespharma & vet compounds & metabolites.
p-Anisic acid
100g Pack Size. Group: Building Blocks, Organics. Formula: CH3OC6H4COOH. CAS No. 100-09-4. Prepack ID 13899923-100g. Molecular Weight 152.15. See USA prepack pricing.
P-Anisic Acid
Solid;Solid;white crystals with practically no odour. Group: Liquid crystal (lc) building blocks. Alternative Names: Draconic acid. CAS No. 100-09-4. Product ID: 4-Methoxybenzoic acid. Molecular formula: 152.15. Mole weight: C8H8O3. COC1=CC=C(C=C1)C(=O)O. InChI=1S/C8H8O3/c1-11-7-4-2-6 (3-5-7)8 (9)10/h2-5H, 1H3, (H, 9, 10). ZEYHEAKUIGZSGI-UHFFFAOYSA-N. 95%+.
p-Anisic acid (Standard)
p-Anisic acid (Standard) is the analytical standard of p-Anisic acid. This product is intended for research and analytical applications. p-Anisic acid (4-Methoxybenzoic acid) is one of the isomers of anisic acid, with anti-bacterial and antiseptic properties [1]. Uses: Scientific research. Group: Natural products. Alternative Names: 4-Methoxybenzoic acid (Standard); Draconic acid (Standard). CAS No. 100-09-4. Pack Sizes: 100 mg; 250 mg; 500 mg. Product ID: HY-N1394R.
p-Anisidine
p-Anisidine. Group: Biochemicals. Grades: Highly Purified. CAS No. 104-94-9. Pack Sizes: 10g. Molecular Formula: C7H9NO, Molecular Weight: 123.15. US Biological Life Sciences.
Worldwide
p-Anisil
p-Anisil is a reagent used in the preparation of novel quinoxaline derivatives with anti-HIV activity. Synonyms: 4,4'-Dimethoxybenzil; Anisil. Grade: 95 %. CAS No. 1226-42-2. Molecular formula: C16H14O4. Mole weight: 270.28.
p-Anisoyl chloride. Group: Biochemicals. Grades: Highly Purified. CAS No. 100-07-2. Pack Sizes: 50g, 100g, 250g, 500g, 1kg. US Biological Life Sciences.
Worldwide
p-Anisylidenephthalide
Potential antianxiety agent. Group: Biochemicals. Alternative Names: 3- (4-Methoxybenzylidene) phthalide; 3- (4-Methoxybenzal) phthalide; 3-[ (4-Methoxyphenyl) methylene]-1 (3H) -isobenzofuranone. Grades: Highly Purified. CAS No. 4767-61-7. Pack Sizes: 500mg. US Biological Life Sciences.
Worldwide
p-Anisylpyridazone
An Intermediate for the synthesis of the drug Gabazine, as well as several analgesic pharmaceuticals. Group: Biochemicals. Alternative Names: 6-(4-Methoxyphenyl)-3(2H)-pyridazinone; 6-(p-Methoxyphenyl)-3(2H)-pyridazinone. Grades: Highly Purified. CAS No. 2166-33-8. Pack Sizes: 500mg. US Biological Life Sciences.
Worldwide
Panitide L2
Panitide L2 is an antimicrobial peptide found in Panicum laxum, and has antimicrobial activity against gram-negative bacterium Escherichia coli. There are three disulfide bonds in the peptide structure. Grade: >98%. Molecular formula: C130H203N37O38S6. Mole weight: 3084.67.
Panitumumab
Panitumumab (ABX-EGF) is a fully human IgG2 anti- EGFR monoclonal antibody with anti-tumor activity. Panitumumab inhibits tumor cell proliferation, survival and angiogenesis. Panitumumab can be used in the research of cancers, such as colon cancer [1] [2] [4]. Uses: Scientific research. Group: Inhibitory antibodies. Alternative Names: ABX-EGF. CAS No. 339177-26-3. Pack Sizes: 1 mg; 5 mg. Product ID: HY-P99041.
Panitumumab (anti-EGFR)
Panitumumab (anti-EGFR) is a fully human IgG2 anti-EGFR monoclonal antibody with anti-tumor activity. Panitumumab (anti-EGFR) inhibits tumor cell proliferation, survival and angiogenesis. Panitumumab (anti-EGFR) can be used in the research of cancers, such as colon cancer[1][2][4]. Uses: Scientific research. Group: Inhibitory antibodies. Pack Sizes: 1 mg; 5 mg; 10 mg; 25 mg. Product ID: HY-P99041A.
Pannaric acid 6-methyl ester is a metabolite from the lichen leproloma diffusum. Molecular formula: C17H14O7. Mole weight: 330.29.
Pannarin
It is a lichen metabolite isolated from several Psoroma species. Synonyms: 8-chloro-9-hydroxy-3-methoxy-1,4,7-trimethyl-6-oxobenzo[b][1,4]benzodioxepine-10-carbaldehyde; Pannarine; NSC 646008; 11H-Dibenzo(b,e)(1,4)dioxepin-4-carboxaldehyde, 2-chloro-3-hydroxy-8-methoxy-1,6,9-trimethyl-11-oxo-. CAS No. 55609-84-2. Molecular formula: C18H15ClO6. Mole weight: 362.76.
Pannorin
Pannorin. Uses: Designed for use in research and industrial production. Additional or Alternative Names: pannorin;4,8,10-Trihydroxy-5-methyl-2H-naphtho[1,2-b]pyran-2-one. Product Category: Heterocyclic Organic Compound. CAS No. 137023-81-5. Molecular formula: C14H10O5. Product ID: ACM137023815. Alfa Chemistry ISO 9001:2015 Certified. Categories: Pandorina kutija.
Panobacumab
Panobacumab (KBPA101) is a fully human IgM/κ monoclonal antibody generated by immortalizing human B lymphocytes against the LPS O polysaccharide of serotype O11 of P. aeruginosa [1]. Uses: Scientific research. Group: Inhibitory antibodies. Alternative Names: KBPA101. CAS No. 885053-97-4. Pack Sizes: 1 mg; 5 mg; 10 mg. Product ID: HY-P99214.