A directory of where to buy chemicals in the USA, including: distributors, industrial manufacturers, bulk supplies and wholesalers of raw ingredients & finished goods.
Search for products or services, then visit the suppliers website for prices or more information.
| Product | Description | |
|---|---|---|
| p-Amyl acetophenone | p-Amyl acetophenone. Group: Liquid crystal (lc) building blocks. CAS No. 37593-02-5. Product ID: 1-(4-pentylphenyl)ethanone. Molecular formula: 190.28g/mol. Mole weight: C13H18O. CCCCCC1=CC=C(C=C1)C(=O)C. InChI=1S / C13H18O / c1-3-4-5-6-12-7-9-13 (10-8-12) 11 (2) 14 / h7-10H, 3-6H2, 1-2H3. KBKGPMDADJLBEM-UHFFFAOYSA-N. 96.0%(GC). |  |
| p-Amylpyridine | p-Amylpyridine. Uses: Designed for use in research and industrial production. Additional or Alternative Names: 4-n-Amylpyridine;4-Pentyl-pyridine. Product Category: Heterocyclic Organic Compound. CAS No. 2961-50-4. Molecular formula: C10H15N. Mole weight: 149.23. Purity: 0.96. IUPACName: 4-pentylpyridine. Canonical SMILES: CCCCCC1=CC=NC=C1. Density: 0.904g/cm³. ECNumber: 220-994-1. Product ID: ACM2961504. Alfa Chemistry ISO 9001:2015 Certified. |  |
| PAN | Metal indicator and spectrophotometric reagent for transition metals. Group: Uv/visible (uv/vis) spectroscopy. Alternative Names: 1-(2-Pyridylazo)-2-naphthol. |  |
| Panamine diperchlorate | It comes from the seeds of the ormosia species. Synonyms: (1S,5R,5a1R,8aS,10S,10aR,15aR)-tetradecahydro-1H,6H,9H,15H-5a,14a,17-triaza-1,5:10,15a-dimethanodibenzo[b,fg]octalene diperchloric acid; (6ξ,18S,20R)-12,20-Cycloormosanine perchlorate (1:2); 15H-1,5-Imino-10,15a-methano-1H,6H,9H-5a,14a-diazadibenz[b,fg]octalene, tetradecahydro-, (1S,5R,8aS,10S,15aR,15bR)-, perchlorate (1:2). CAS No. 6011-96-7. Molecular formula: C20H33N3.2ClHO4. Mole weight: 516.41. |  |
| Panaxadiol | Panaxadiol (20(R)-Panaxadiol) is an orally active HIF-1α/STAT3 inhibitor. Panaxadiol can suppress HIF-1α and STAT3 then lead to downregulation of programmed cell death-ligand 1 (PD-L1) expression. Panaxadiol shows anticancer, cardioprotective, anti-arrhythmic, and antioxidative activities [1] [2]. Uses: Scientific research. Group: Natural products. Alternative Names: 20(R)-Panaxadiol. CAS No. 19666-76-3. Pack Sizes: 10 mM * 1 mL; 5 mg; 10 mg. Product ID: HY-N0596. |  |
| Panaxadiol | Panaxadiol. Group: Biochemicals. Alternative Names: NSC 308879; (20R)-20,25-Epoxydammarane-3 β,12 β-diol; (3 β,12 β,20R)-20,25-Epoxydammarane-3,12-diol. Grades: Highly Purified. CAS No. 19666-76-3. Pack Sizes: 10mg. Molecular Formula: C30H52O3, Molecular Weight: 460.73. US Biological Life Sciences. |  Worldwide |
| Panaxatriol | Panaxatriol. Group: Biochemicals. Grades: Highly Purified. CAS No. 32791-84-7. Pack Sizes: 50mg, 100mg, 250mg, 500mg, 1g. Molecular Formula: C30H52O4. US Biological Life Sciences. | Worldwide |
| Panaxcerol C | Monogalactosyldiacylglycerol (MGDG) and digalactosyldiacylglycerol (DGDG) are the two nonionic lipid constituents of the thylakoid membrane of higher plant chloroplasts. MGDG and DGDG are present in the membrane at 56% and 29%, respectively, of the total lipid content. DGDG is a bilayer-forming lipid, while MGDG alone will only form hexagonal-II structures. Synonyms: Monogalactosyldiacylglycerol (Plant); 1,2-diacyl-3-O-β-D-galactosyl-sn-glycerol; MGDG; 1-18:3-2-18:3-Monogalactosyldiacylglycerol; 18:3-18:3-MGDG; 1,2-Di-O-alpha-linolenoyl-3-O-beta-galactopyranosyl-sn-glycerol; 1,2-(9Z,12Z,15Z-octadecatrienoyl)-3-O-beta-D-galactosyl-sn-glycerol; (9Z,9'Z,12Z,12'Z,15Z,15'Z)-(S)-3-(((2R,3R,4S,5R,6R)-3,4,5-Trihydroxy-6-(hydroxymethyl)tetrahydro-2H-pyran-2-yl)oxy)propane-1,2-diyl bis(octadeca-9,12,15-trienoate); β-D-Galactopyranoside, (2S)-2,3-bis[[(9Z,12Z,15Z)-1-oxo-9,12,15-octadecatrien-1-yl]oxy]propyl. Grades: >95%. CAS No. 63180-02-9. Molecular formula: C45H74O10. Mole weight: 775.06. | |
| Panax ginseng extract | Powder, tablets, granules. Health care cosmetics raw materials. Uses: Designed for use in research and industrial production. Product Category: Material of health food. Appearance: Off white powder. CAS No. 22427-39-0. Molecular formula: C42H72O14. Mole weight: 801.01. Product ID: ACM22427390. Alfa Chemistry ISO 9001:2015 Certified. | |
| Panax Ginseng Extract | Ginseng extract powder is prepared from the root of the slow-growing perennial plants Panax ginseng C. A. Mey. a plant of the family Araliaceae. Panax ginseng extract is rich in 18 kinds of ginsenosides, have effect on heart and blood vessel, and many tonic functions. Group: Others. Panax Ginseng Extract; Panax ginseng C. A. Mey. Cat No: EXTC-061. |  |
| Panax Ginseng P.E. 20% & 80% Ginsenosides UV | Panax Ginseng P.E. 20% & 80% Ginsenosides UV. |  CA, FL & NJ |
| Panax Ginseng P.E. 4:1 | Panax Ginseng P.E. 4:1. | CA, FL & NJ |
| Panax Notoginseng Extract | Panax notoginseng extract is prepared from the species of the genus Panax, also known as sanqi extract powder. Panax notoginseng extract powder contain high potency notoginsenoside, Ginsenoside Rb1, Ginsenoside Rg1, Ginsenoside Rd, Ginsenoside Re, and Ginsenoside Rb2, which are most active ingredients impacting on your overall health and nutritionally support healthy heart function, blood circulation, and performance. Group: Others. Mole weight: 933.14. Panax Notoginseng Extract; Panax Pseudo-Ginseng Wall. Var. Cat No: EXTC-016. | |
| Panax Notoginseng Root and Rhizome Dry Extract | United States Pharmacopeia (USP) Reference Standard. Group: Pharmacopeia & metrological institutes standards. | |
| Panaxydol | Panaxydol, extracted from the roots of Panax ginseng C. A. Mey, inhibits the growth of cancer cells through EGFR activation and ER stress. Synonyms: (3R)-8-[(2R,3S)-3-heptyloxiran-2-yl]oct-1-en-4,6-diyn-3-ol. Grades: > 95%. CAS No. 72800-72-7. Molecular formula: C17H24O2. Mole weight: 260.38. | |
| Panaxydol | Panaxydol. Group: Biochemicals. Alternative Names: 9,10-Epoxy-1-heptadecene-4,6-diyn-3-ol. Grades: Plant Grade. CAS No. 72800-72-7. Pack Sizes: 20mg. Molecular Formula: C17H24O2, Molecular Weight: 260.370999999999. US Biological Life Sciences. | Worldwide |
| Panaxynol | Panaxynol. Group: Biochemicals. Alternative Names: Falcarinol; (R)-(-)-Falcarinol; Carotatoxin; (3R,9Z)-1,9-Heptadecadiene-4,6-diyn-3-ol; 21852-80-2. Grades: Plant Grade. CAS No. 81203-57-8. Pack Sizes: 10mg. Molecular Formula: C17H24O, Molecular Weight: 244.372. US Biological Life Sciences. | Worldwide |
| PANC-1 Transfection Reagent | Transfection Reagent for PANC1 Non-endocrine Pancreatic Cancer Cells. Optimized transfection protocol provided for transfection of siRNA, DNA, mRNA, and microRNA. Transfection Reagents. Transfection Enhancer. Complex Condenser. Uses: Transfection of DNA, RNA, protein and small molecules. Product ID: 3226. |  Nevada, Texas, USA |
| Panclicin A | It is produced by the strain of Str. sp. NR 0619. It's an enzyme inhibitor. Synonyms: L-Alanine, N-formyl-, (1S)-1-[[(2S,3S)-3-(8-methylnonyl)-4-oxo-2-oxetanyl]methyl]octyl ester; L-Alanine, N-formyl-, 1-[[3-(8-methylnonyl)-4-oxo-2-oxetanyl]methyl]octyl ester, [2S-[2a[R*(R*)],3b]]-; (-)-Panclicin A. CAS No. 160669-37-4. Molecular formula: C26H47NO5. Mole weight: 453.65. | |
| Panclicin B | It is produced by the strain of Str. sp. NR 0619. It's an enzyme inhibitor. Synonyms: L-Alanine, N-formyl-,(1S)-1-[[(2S,3S)-3-decyl-4-oxo-2-oxetanyl]methyl]octyl ester; L-Alanine, N-formyl-, 1-[(3-decyl-4-oxo-2-oxetanyl)methyl]octyl ester, [2S-[2a[R*(R*)],3b]]-; (-)-Panclicin B. CAS No. 160700-42-5. Molecular formula: C26H47NO5. Mole weight: 453.65. | |
| Panclicin C | It is produced by the strain of Str. sp. NR 0619. It's an enzyme inhibitor. Synonyms: Glycine, N-formyl-, (1S)-1-[[(2S,3S)-3-(8-methylnonyl)-4-oxo-2-oxetanyl]methyl]octyl ester; Glycine, N-formyl-, 1-[[3-(8-methylnonyl)-4-oxo-2-oxetanyl]methyl]octyl ester, [2S-[2a(R*),3b]]-; (-)-Panclicin C. CAS No. 160669-43-2. Molecular formula: C25H45NO5. Mole weight: 439.63. | |
| Panclicin D | It is produced by the strain of Str. sp. NR 0619. It's an enzyme inhibitor. Synonyms: (-)-Panclicin D. CAS No. 160669-44-3. Molecular formula: C25H45NO5. Mole weight: 439.63. | |
| Panclicin E | It is produced by the strain of Str. sp. NR 0619. It's an enzyme inhibitor. Synonyms: Glycine, N-formyl-, (1S)-1-[[(2S,3S)-3-dodecyl-4-oxo-2-oxetanyl]methyl]octyl ester; Glycine, N-formyl-, 1-[(3-dodecyl-4-oxo-2-oxetanyl)methyl]octyl ester, [2S-[2a(R*),3b]]-; (-)-Panclicin E. CAS No. 160669-45-4. Molecular formula: C27H49NO5. Mole weight: 467.68. | |
| Pancreas, Rabbit | Pancreas, Rabbit. Group: Biologicals. Grades: Tissue. Pack Sizes: 25Ea. US Biological Life Sciences. | Worldwide |
| Pancreas-targeted In Vivo Kit | Pancreas-targeted in vivo transfection kit. Functionally tested in mice tissue-targeted delivery of siRNA and pDNA via IV,IP,IT administrations. Kit includes: Transfection Reagents. Transfection Enhancer reagent. Protocol for mice and rats. Uses: Transfection of DNA, RNA, protein and small molecules. Product ID: 5051. | Nevada, Texas, USA |
| Pancreatic Cancer Antibody Drug Conjugate | Pancreatic Cancer Antibody Drug Conjugate. Group: Single wall cnt. >95% (SWNT). | |
| pancreatic elastase | Formed by activation of proelastase from mammalian pancreas by trypsin. In peptidase family S1 (trypsin family). Formerly included in EC 3.4.21.11. Group: Enzymes. Synonyms: pancreatopeptidase E; pancreatic elastase I; elastase; elaszym; serine elastase. Enzyme Commission Number: EC 3.4.21.36. CAS No. 9004-6-2. ELA1. Storage: Store it at +4 ?C for short term. For long term storage, store it at -20 ?C?-80 ?C. Form: Liquid or lyophilized powder. EXWM-4130; pancreatic elastase; EC 3.4.21.36; 9004-06-2; pancreatopeptidase E; pancreatic elastase I; elastase; elaszym; serine elastase. Cat No: EXWM-4130. | |
| pancreatic elastase II | A peptidase of family S1 (trypsin family) formed by activation of proelastase II from mammalian pancreas by trypsin. Usually, only one of the pancreatic elastases (see also EC 3.4.21.36) is expressed in a given species; human pancreatic elastase is of type II. Group: Enzymes. Synonyms: pancreatic elastase 2. Enzyme Commission Number: EC 3.4.21.71. CAS No. 75603-19-9. Storage: Store it at +4 ?C for short term. For long term storage, store it at -20 ?C?-80 ?C. Form: Liquid or lyophilized powder. EXWM-4163; pancreatic elastase II; EC 3.4.21.71; 75603-19-9; pancreatic elastase 2. Cat No: EXWM-4163. | |
| pancreatic endopeptidase E | A peptidase of family S1 (trypsin family) from pancreatic juice. Unlike elastases, has an acidic pI. Binds cholesterol. Group: Enzymes. Synonyms: cholesterol-binding proteinase; proteinase E; cholesterol-binding serine proteinase; pancreatic protease E; pancreatic proteinase E; cholesterol-binding pancreatic proteinase; CBPP; pancreas E proteinase. Enzyme Commission Number: EC 3.4.21.70. CAS No. 68073-27-8. Storage: Store it at +4 ?C for short term. For long term storage, store it at -20 ?C?-80 ?C. Form: Liquid or lyophilized powder. EXWM-4162; pancreatic endopeptidase E; EC 3.4.21.70; 68073-27-8; cholesterol-binding proteinase; proteinase E; cholesterol-binding serine proteinase; pancreatic protease E; pancreatic proteinase E; cholesterol-binding pancreatic proteinase; CBPP; pancreas E proteinase. Cat No: EXWM-4162. | |
| Pancreatic Microvascular Endothelial Cells, Human (Frozen) | Passage 3 cells are shipped in proliferating culture with a confluence of >90%. ENDO-Growth medium containing 5% serum and growth supplement is recommended for culture. Cells have an average population doubling level of >16 when cultured. Group: Biologicals. Grades: Cell Culture Grade. Pack Sizes: 1ml. US Biological Life Sciences. | Worldwide |
| Pancreatic Microvascular Endothelial Cells, Human (T-25 flask) | Passage 3 cells are shipped in proliferating culture with a confluence of >90%. ENDO-Growth medium containing 5% serum and growth supplement is recommended for culture. Cells have an average population doubling level of >16 when cultured. Group: Biologicals. Grades: Cell Culture Grade. Pack Sizes: T-25 flask. US Biological Life Sciences. | Worldwide |
| Pancreatic polypeptide | Pancreatic polypeptide is a peptide secreted by the endocrine PP cells of the pancreas that regulates pancreatic secretory activity and also affects hepatic glycogen stores and gastrointestinal secretion [1]. Uses: Scientific research. Group: Peptides. CAS No. 59763-91-6. Pack Sizes: 1 mg; 5 mg; 10 mg. Product ID: HY-P4060. | |
| Pancreatic Polypeptide, bovine | Pancreatic Polypeptide, bovine, a straight chain polypeptide containing 36 amino acids, derived primarily from the pancreas, and stimulates pancreatic secretion by inhibiting secretin and cholecystokinin. As the NPY receptor agonist, it has a high affinity at NPYR4. Synonyms: Ala-Pro-Leu-Glu-Pro-Glu-Tyr-Pro-Gly-Asp-Asn-Ala-Thr-Pro-Glu-Gln-Met-Ala-Gln-Tyr-Ala-Ala-Glu-Leu-Arg-Arg-Tyr-Ile-Asn-Met-Leu-Thr-Arg-Pro-Arg-Tyr-NH2; Pancreatic polypeptide (pig), 6-L-glutamic acid-; Bovine pancreatic polypeptide. Grades: ≥95%. CAS No. 179986-89-1. Molecular formula: C186H287N53O56S2. Mole weight: 4225.78. | |
| Pancreatic polypeptide(human) | Pancreatic polypeptide(human). Uses: Designed for use in research and industrial production. Additional or Alternative Names: PANCREATIC POLYPEPTIDE;PANCREATIC POLYPEPTIDE, HUMAN;PP, HUMAN;APLEPVYPGDNATPEQMAQYAADLRRYINMLTRPRY-NH2;H-ALA-PRO-LEU-GLU-PRO-VAL-TYR-PRO-GLY-ASP-ASN-ALA-THR-PRO-GLU-GLN-MET-ALA-GLN-TYR-ALA-ALA-ASP-LEU-ARG-ARG-TYR-ILE-ASN-MET-LEU-THR-ARG-PRO-ARG-TYR-NH2. Product Category: Heterocyclic Organic Compound. CAS No. 59763-91-6. Molecular formula: C185H287N53O54S2. Product ID: ACM59763916. Alfa Chemistry ISO 9001:2015 Certified. | |
| Pancreatic Polypeptide (human) | Pancreatic Polypeptide (human). Group: Biochemicals. Grades: Purified. CAS No. 75976-10-2. Pack Sizes: 200ug. US Biological Life Sciences. | Worldwide |
| Pancreatic Polypeptide, human | Pancreatic Polypeptide, human is a C-terminally amidated 36 amino acid peptide, which acts as a neuropeptide Y ( NPY ) Y4 / Y5 receptor agonist. Uses: Scientific research. Group: Peptides. Alternative Names: Human pancreatic polypeptide. CAS No. 75976-10-2. Pack Sizes: 500 μg; 1 mg; 5 mg. Product ID: HY-P0199. | |
| Pancreatic Polypeptide, human | Pancreatic polypeptide is an agonist of neuropeptide Y (NPY) receptors that reduces forskolin-induced cAMP accumulation in L-M(TK-) cells recombinantly expressing human and rat Y4 receptors (EC50s = 87.1 and 36.3 pM, respectively). It is believed to play an important role in the function of the gastrointestinal tract. Uses: Gastrointestinal agents. Synonyms: Human pancreatic polypeptide; L-alanyl-L-prolyl-L-leucyl-L-alpha-glutamyl-L-prolyl-L-valyl-L-tyrosyl-L-prolyl-glycyl-L-alpha-aspartyl-L-asparagyl-L-alanyl-L-threonyl-L-prolyl-L-alpha-glutamyl-L-glutaminyl-L-methionyl-L-alanyl-L-glutaminyl-L-tyrosyl-L-alanyl-L-alanyl-L-alpha-aspartyl-L-leucyl-L-arginyl-L-arginyl-L-tyrosyl-L-isoleucyl-L-asparagyl-L-methionyl-L-leucyl-L-threonyl-L-arginyl-L-prolyl-L-arginyl-L-tyrosinamide; Ala-Pro-Leu-Glu-Pro-Val-Tyr-Pro-Gly-Asp-Asn-Ala-Thr-Pro-Glu-Gln-Met-Ala-Gln-Tyr-Ala-Ala-Asp-Leu-Arg-Arg-Tyr-Ile-Asn-Met-Leu-Thr-Arg-Pro-Arg-Tyr-NH2. Grades: ≥95%. CAS No. 75976-10-2. Molecular formula: C185H287N53O54S2. Mole weight: 4181.71. | |
| Pancreatic Polypeptide, rat | Pancreatic Polypeptide, rat is an agonist of NPY receptor with high affinity at NPYR4. Synonyms: Rat pancreatic polypeptide; Ala-Pro-Leu-Glu-Pro-Met-Tyr-Pro-Gly-Asp-Tyr-Ala-Thr-His-Glu-Gln-Arg-Ala-Gln-Tyr-Glu-Thr-Gln-Leu-Arg-Arg-Tyr-Ile-Asn-Thr-Leu-Thr-Arg-Pro-Arg-Tyr-NH2; L-alanyl-L-prolyl-L-leucyl-L-alpha-glutamyl-L-prolyl-L-methionyl-L-tyrosyl-L-prolyl-glycyl-L-alpha-aspartyl-L-tyrosyl-L-alanyl-L-threonyl-L-histidyl-L-alpha-glutamyl-L-glutaminyl-L-arginyl-L-alanyl-L-glutaminyl-L-tyrosyl-L-alpha-glutamyl-L-threonyl-L-glutaminyl-L-leucyl-L-arginyl-L-arginyl-L-tyrosyl-L-isoleucyl-L-asparagyl-L-threonyl-L-leucyl-L-threonyl-L-arginyl-L-prolyl-L-arginyl-L-tyrosinamide. Grades: ≥95%. CAS No. 90419-12-8. Molecular formula: C195H298N58O57S. Mole weight: 4398.87. | |
| pancreatic ribonuclease | Specifically, the enzymes are involved in endonucleolytic cleavage of 3'-phosphomononucleotides and 3'-phosphooligonucleotides ending in C-P or U-P with 2',3'-cyclic phosphate intermediates. Ribonuclease can unwind the RNA helix by complexing with single-stranded RNA; the complex arises by an extended multi-site cation-anion interaction between lysine and arginine residues of the enzyme and phosphate groups of the nucleotides. Group: Enzymes. Synonyms: RNase; RNase I; RNase A; pancreatic RNase; ribonuclease I; endoribonuclease I; ribonucleic phosphatase; alkaline ribonuclease; ribonuclease; gene S glycoproteins; Ceratitis capitata alkaline ribonuclease; SLSG glycoproteins; gen. glycoproteins; ribonucleate 3'-pyrimidino-oligonucleotidohydrolase. Enzyme Commission Number: EC 3.1.27.5. CAS No. 9001-99-4. Rnase. Storage: Store it at +4 ?C for short term. For long term storage, store it at -20 ?C?-80 ?C. Form: Liquid or lyophilized powder. EXWM-3603; pancreatic ribonuclease; EC 3.1.27.5; 9001-99-4; RNase; RNase I; RNase A; pancreatic RNase; ribonuclease I; endoribonuclease I; ribonucleic phosphatase; alkaline ribonuclease; ribonuclease; gene S glycoproteins; Ceratitis capitata alkaline ribonuclease; SLSG glycoproteins; gene S locus-specific glycoproteins; S-genotype-asssocd. glycoproteins; ribonucleate 3'-pyrimidino-oligonucleotidohydrolase. Cat No: EXWM-3603. | |
| Pancreatin | 100g Pack Size. Group: Analytical Reagents, Biochemicals, Research Organics & Inorganics. CAS No. 8049-47-6. Prepack ID 90029842-100g. See USA prepack pricing. |  |
| Pancreatin | Pancreatin is the porcine pancreas extract (PPE) which contains the main pancreatic digestive enzymes. Uses: Scientific research. Group: Signaling pathways. CAS No. 8049-47-6. Pack Sizes: 500 mg; 1 g. Product ID: HY-B2118. | |
| PANCREATIN | PANCREATIN. Uses: Designed for use in research and industrial production. Additional or Alternative Names: PANCREATIN, 3X. Product Category: Heterocyclic Organic Compound. CAS No. 9046-39-3. Purity: 0.96. Product ID: ACM9046393. Alfa Chemistry ISO 9001:2015 Certified. | |
| Pancreatin, 5% Aqueous, Laboratory Grade, 500 mL | Notes: Keep refrigerated. Health Risk: 1. Flammability: 1. Reactivity: 1. Grades: chem-grade laboratory. CAS No. 8049-47-6. Product ID: 878953. -- SOLD FOR EDUCATIONAL USE ONLY -- |  |
| Pancreatin amylase and protease | United States Pharmacopeia (USP) Reference Standard. Group: Pharmacopeia & metrological institutes standards. | |
| Pancreatin from porcine pancreas | ?3 × USP specifications. Group: Fluorescence/luminescence spectroscopy. | |
| Pancreatin lipase | United States Pharmacopeia (USP) Reference Standard. Group: Pharmacopeia & metrological institutes standards. | |
| Pancreatin, Powder, Laboratory Grade, 100 g | Notes: Keep refrigerated. Health Risk: 1. Flammability: 1. Reactivity: 0. Grades: chem-grade laboratory. CAS No. 8049-47-6. Product ID: 878929. -- SOLD FOR EDUCATIONAL USE ONLY -- | |
| Pancreatin, USP | Pancreatin, USP. Grades: USP. CAS No. 8049-47-6. Product ID: 2-08568. |  |
| Pancuronium bromide | United States Pharmacopeia (USP) Reference Standard. Group: Pharmacopeia & metrological institutes standards. | |
| Pancuronium bromide | Pancuronium results in open channel block of embryonic-type nicotinic acetylcholine receptor channels after coapplication of blocker and acetylcholine. Uses: Neuromuscular nondepolarizing agents; nicotinic antagonists. Synonyms: PANCURONIUM BROMIDE; 15500-66-0; Pancuronium dibromide; PavulonMioblock. Grades: >98%. CAS No. 15500-66-0. Molecular formula: C35H60N2O4.2Br. Mole weight: 732.67. | |
| Pancuronium bromide Related Compound A | United States Pharmacopeia (USP) Reference Standard. Group: Pharmacopeia & metrological institutes standards. | |
| Pancuronium bromide Related Compound B | United States Pharmacopeia (USP) Reference Standard. Group: Pharmacopeia & metrological institutes standards. | |
| Pancuronium bromide Related Compound C | United States Pharmacopeia (USP) Reference Standard. Group: Pharmacopeia & metrological institutes standards. | |
| Pancuronium dibromide | Pancuronium dibromide, a bis-quaternary steroid, is a neuromuscular relaxant. Pancuronium dibromide inhibits neuromuscular transmission by competing with acetylcholine for binding sites on nACh receptors. Pancuronium dibromide also inhibits cardiac muscarinic receptors and has a sympathomimetic action [1] [2] [3]. Uses: Scientific research. Group: Signaling pathways. CAS No. 15500-66-0. Pack Sizes: 10 mM * 1 mL; 5 mg; 10 mg; 50 mg; 100 mg. Product ID: HY-B0429. | |
| Pancuronium dibromide | 1,1-(3a,17b-Dihydroxy-2b,5a-androstan-2b,16b-ylene) bis[1-methylpiperidinium] diacetate dibromide. Grades: USP. CAS No. 15500-66-0. Product ID: 8-01741. Molecular formula: C35H60Br2N2O4. Mole weight: 732.68. | |
| Pancuronium dibromide | Pancuronium dibromide. Group: Biochemicals. Grades: Purified. CAS No. 15500-66-0. Pack Sizes: 10mg, 50mg. US Biological Life Sciences. | Worldwide |
| Pancuronium Dibromide (1,1'-(3alpha,17beta-Dihydroxy-2alpha,5beta-androstan-2-beta,16beta-ylene) bis[1-methylpiperidinium] Diacetate Dibromide, Nicotinic Acetylchorine Receptor Antagonist, Pancuronium Dibromide, nAChR Antagonist, Pancuronium Dibromide) | A highly potent competitive antagonist selective for nAChRs (IC50 = 5.5nM). A very potent non-depolarizing skeletal muscle relaxant but no sedative or analgesic effects. Group: Biochemicals. Grades: Highly Purified. CAS No. 15500-66-0. Pack Sizes: 10mg. Molecular Formula: C??H??N?O? Br?. US Biological Life Sciences. | Worldwide |
| Pandan Leaf Powder | Pandan Leaf Powder is made of pandan leaf as raw material and processed by spray drying technology. Product ID: CDF4-0227. Category: Flavour. Product Keywords: Flavor Enhancers; Pandan Leaf Powder; CDF4-0227; Flavour;. Grade: Food Grade. Color: Green powder. Physical State: powder. Storage: Room Temperature. Applications: Widely used in baking, pastry, meal replacement powder. |  |
| Pandinin-1 | Pandinin-1 is an antimicrobial peptide found in Pandinus imperator (Emperor scorpion), and has antibacterial activity. Synonyms: pandinin 1; pin 1; Recombinant Pandinus imperator Pandinin-1. Grades: >85%. Molecular formula: C220H350N58O62. Mole weight: 4799.55. | |
| Pandinotoxin-K? | >99%, powder. Group: Fluorescence/luminescence spectroscopy. | |
| Panduratin | Panduratin. Uses: Designed for use in research and industrial production. Additional or Alternative Names: Panduratin;Panduratin A;rel-(2,6-Dihydroxy-4-methoxyphenyl)[(1R,2S,6R)-3-methyl-2-(3-methyl-2-buten-1-yl)-6-phenyl-3-cyclohexen-1-yl]methanone. Product Category: Heterocyclic Organic Compound. CAS No. 89837-52-5. Molecular formula: C26H30O4. Mole weight: 0. Density: 1.128. Product ID: ACM89837525. Alfa Chemistry ISO 9001:2015 Certified. | |
| Panepoxydone | from Lentinus conatus, ?95% (HPLC). Group: Fluorescence/luminescence spectroscopy. | |
| Pangamic Acid Sodium Salt | 6-(2-Dimethylamino-acetoxy)-2,3,4,5-tetrahydroxy-hexanoic acid, Vitamin B15; Gluconodimethylaminoacetic acid. CAS No. 77700-02-8. Product ID: 2-08330. Molecular formula: C10H8NNaO8. Mole weight: 303.28. | |
| Pangelin | Pangelin is a coumarin that can be found in Ducrosia anethifolia. Pangelin exhibits anti-mycobacterial and anti-tumor activities [1] [2]. Uses: Scientific research. Group: Natural products. CAS No. 33783-80-1. Pack Sizes: 1 mg; 5 mg. Product ID: HY-N8131. | |
| Pangelin | Pangelin is found in the roots of Angelica dahurica. Synonyms: R-(+)-Pangelin. Grades: > 95%. CAS No. 33783-80-1. Molecular formula: C16H14O5. Mole weight: 286.28. | |
| Pangelin | Pangelin is a coumarin that can be found in Ducrosia anethifolia. Pangelin exhibits anti-mycobacterial and anti-tumor activities. Uses: Designed for use in research and industrial production. Product Category: Inhibitors. Appearance: Solid. CAS No. 33783-80-1. Molecular formula: C16H14O5. Mole weight: 286.28. Purity: ≥99.0%. Canonical SMILES: O=C1C=CC2=C(OC[C@H](O)C(C)=C)C3=C(OC=C3)C=C2O1. Product ID: ACM33783801. Alfa Chemistry ISO 9001:2015 Certified. Categories: Pangelinan. | |
| Paniculal | Paniculal. Uses: Designed for use in research and industrial production. Additional or Alternative Names: 7-methoxy-8-formylcoumarine; 7-methoxy-8-formylcoumarin; 8-formyl-7-methoxycoumarin; paniculal; 7-methoxy-2-oxo-2H-chromene-8-carbaldehyde. Product Category: Heterocyclic Organic Compound. CAS No. 6724-42-1. Molecular formula: C11H8O4. Mole weight: 204.179. Purity: 0.96. IUPACName: 7-methoxy-2-oxo-2H-chromene-8-carbaldehyde. Product ID: ACM6724421. Alfa Chemistry ISO 9001:2015 Certified. Categories: Panicularia. | |
| Panipenem-betamipron | Panipenem-betamipron. Uses: Designed for use in research and industrial production. Additional or Alternative Names: Carbenin, Panipenem-betamipron, Papm-BP, Carbenin (TN), PAPM/BP, Panipenem mixture with betamipron, CID115235, LS-186953, D02509, 138240-65-0, 3-(1-(Acetimidoylpyrrolidin-3-yl)thio)-6-(1-hydroxyethyl)-7-oxo-1-azabicyclo(3.2.0)hept-2-ene-2-carboxylic acid combination with N-benzoyl-beta-alanine, beta-Alanine, N-benzoyl-, mixt. with (5R,6S)-6-((1R)-1-hydroxyethyl)-3-(((3S)-1-(1-iminoethyl)-3-pyrrolidinyl)thio)-7-oxo-1-azabicyclo(3.2.o)hept-2-ene-2-carboxylic acid, beta-Alanine, N-benzoyl-, mixt. with (5R-(3(S*),5alpha,6alpha(R*)))-6-(1-hydroxyethyl)-3-((1-(1-iminoethyl)-3-pyrrolidinyl)thio)-7-oxo-1-azabicyclo(3.2.o)hept-2-ene-2-carboxylic acid. Product Category: Heterocyclic Organic Compound. CAS No. 138240-65-0. Molecular formula: C25H32N4O7S. Mole weight: 532.609180 [g/mol]. Purity: 0.96. IUPACName: 3-benzamidopropanoic acid; (5R,6S)-3-[(3S)-1-ethanimidoylpyrrolidin-3-yl]sulfanyl-6-[(1R)-1-hydroxyethyl]-7-oxo-1-azabicyclo[3.2.0]hept-2-ene-2-carboxylic acid. Canonical SMILES: CC(C1C2CC(=C(N2C1=O)C(=O)O)SC3CCN(C3)C(=N)C)O.C1=CC=C(C=C1)C(=O)NCCC(=O)O. Product ID: ACM138240650. Alfa Chemistry ISO 9001:2015 Certified. Categories: Panipenem/betamipron. | |
| p-Anisaldehyde | p-Anisaldehyde. Group: Biochemicals. Alternative Names: Aubepine. Grades: Plant Grade. CAS No. 123-11-5. Pack Sizes: 100mg. Molecular Formula: C8H8O2, Molecular Weight: 136.148. US Biological Life Sciences. | Worldwide |
| p-Anisaldehyde | primary reference standard. Group: Herbal medicinal products standards. | |
Our database is helping our users find suppliers everyday.
