Find where to buy products from suppliers in the USA, including: distributors, industrial manufacturers in America, bulk supplies and wholesalers of raw ingredients & finished goods.
Search for products or services, then visit the American suppliers website for prices, SDS or more information. You can also view suppliers in Australia, NZ or the UK.
| Product | Description | |
|---|---|---|
| Porcine Brain/Heart Infusion Powder | Porcine Brain/Heart Infusion Powder. |  CA, FL & NJ |
| Porcine Collagen | Porcine Collagen. | CA, FL & NJ |
| Porcine dynorphin A(1-13) | Porcine dynorphin A (1-13) is a potent, endogenous κ opioid receptor agonist and is antinociceptive at physiological concentrations. Uses: Scientific research. Group: Peptides. Alternative Names: Dynorphin A Porcine Fragment 1-13. CAS No. 72957-38-1. Pack Sizes: 1 mg; 5 mg; 10 mg; 25 mg. Product ID: HY-P0088. |  |
| Porcine dynorphin A (1-13) acetate | Porcine dynorphin A(1-13) acetate is an endogenous opioid peptide that preferentially activates κ opioid receptors. Synonyms: Dynorphin A Porcine Fragment 1-13 acetate; Dynorphin A (1-13) acetate; H-Tyr-Gly-Gly-Phe-Leu-Arg-Arg-Ile-Arg-Pro-Lys-Leu-Lys-OH.CH3CO2H; L-tyrosyl-glycyl-glycyl-L-phenylalanyl-L-leucyl-L-arginyl-L-arginyl-L-isoleucyl-L-arginyl-L-prolyl-L-lysyl-L-leucyl-L-lysine acetic acid; Dynorphin A (swine), 14-de-L-tryptophan-15-de-L-aspartic acid-16-de-L-asparagine-17-de-L-glutamine-, acetate (salt); Dynorphin A (pig), 14-de-L-tryptophan-15-de-L-aspartic acid-16-de-L-asparagine-17-de-L-glutamine-, acetate (salt); 1-13-Dynorphin A (swine) acetate. Grades: ≥95%. Molecular formula: C77H130N24O17. Mole weight: 1664.00. |  |
| Porcine Hypothalamus Powder | Porcine Hypothalamus Powder. | CA, FL & NJ |
| Porcine insulin | Porcine insulin. Uses: For analytical and research use. Group: Impurity standards. CAS No. 12584-58-6. Molecular Formula: C256H381N65O76S6. Mole Weight: 5777.54. Catalog: APB12584586. |  |
| Porcine Liver Powder | Porcine Liver Powder. | CA, FL & NJ |
| Porcine Lymph | Porcine Lymph. | CA, FL & NJ |
| Porcine Pituitary (Whole) | Porcine Pituitary (Whole). | CA, FL & NJ |
| Acetyl Angiotensinogen (1-14), porcine | Acetyl-angiotensinogen (1-14), porcine is encoded by the angiotensinogen gene and is known as a pre-angiotensinogen or angiotensinogen precursor. Synonyms: Angiotensinogen (tetradecapeptide renin substrate), N-acetyl-5-L-isoleucine-; Ac-Asp-Arg-Val-Tyr-Ile-His-Pro-Phe-His-Leu-Leu-Val-Tyr-Ser-OH; N-acetyl-L-alpha-aspartyl-L-arginyl-L-valyl-L-tyrosyl-L-isoleucyl-L-histidyl-L-prolyl-L-phenylalanyl-L-histidyl-L-leucyl-L-leucyl-L-valyl-L-tyrosyl-L-serine. Grades: 95%. CAS No. 66641-26-7. Molecular formula: C87H125N21O21. Mole weight: 1801.05. | |
| Acetyl Angiotensinogen (1-14), porcine acetate | Acetyl-angiotensinogen (1-14), porcine acetate is encoded by the angiotensinogen gene and is known as a pre-angiotensinogen or angiotensinogen precursor. Synonyms: Ac-Asp-Arg-Val-Tyr-Ile-His-Pro-Phe-His-Leu-Leu-Val-Tyr-Ser-OH.CH3CO2H; N-acetyl-L-alpha-aspartyl-L-arginyl-L-valyl-L-tyrosyl-L-isoleucyl-L-histidyl-L-prolyl-L-phenylalanyl-L-histidyl-L-leucyl-L-leucyl-L-valyl-L-tyrosyl-L-serine acetic acid. Grades: ≥95%. CAS No. 2918768-06-4. Molecular formula: C87H125N21O21.C2H4O2. Mole weight: 1861.11. | |
| Acetyl PACAP (1-38) (human, mouse, ovine, porcine, rat) trifluoroacetate salt | Acetyl pituitary adenylate cyclase-activating peptide (PACAP) (1-38) is an N-terminally acetylated form of PACAP (1-38). Synonyms: Acetyl pituitary adenylate cyclase-activating peptide (1-38). Grades: ≥95%. Molecular formula: C205H333N63O54S·xCF3COOH. Mole weight: 4576.29. | |
| ACTH (1-13) (human, mouse, rat, porcine, bovine, ovine) trifluoroacetate salt | ACTH (1-13) is a peptide fragment of adrenocorticotropic hormone, a peptide hormone found in the brain that is involved in the biological stress response. Synonyms: SYSMEHFRWGKPV-OH. Grades: ≥98%. Molecular formula: C75H106N20O19S·xCF3COOH. Mole weight: 1623.83. | |
| ACTH (1-17) (human, mouse, rat, porcine, bovine, ovine) trifluoroacetate salt | ACTH (1-17) is a peptide fragment of adrenocorticotropic hormone, a peptide hormone found in the brain that is involved in the biological stress response. Synonyms: Adrenocorticotropic hormone (1-17); SYSMEHFRWGKPVGKKR-OH; Cortrophin; Corticotrophin. Grades: ≥98%. Molecular formula: C95H145N29O23S·xCF3COOH. Mole weight: 2093.42. | |
| ACTH (1-39), Porcine | ACTH (1-39) is a potent agonist of melanocortin receptor 2 (MC2R) with an EC50 value of 57 pM in HeLa cells expressing the mouse receptor. Synonyms: Adrenocorticotropic Hormone from porcine pituitary; Adrenocorticotropic Hormone Fragment 1-39; Corticotropin A. Grades: 95%. CAS No. 9061-27-2. Molecular formula: C210H314N56O57S. Mole weight: 4567.15. | |
| ACTH (4-10) (human, mouse, rat, porcine, bovine, ovine) trifluoroacetate salt | Adrenocorticotropic hormone (ACTH) (4-10) is an endogenous peptide fragment of ACTH, a peptide hormone produced by the anterior pituitary gland that is involved in the biological stress response. Synonyms: Adrenocorticotropic hormone (4-10); Corticotropin (4-10); H-Met-Glu-His-Phe-Arg-Trp-Gly-OH. Grades: ≥95%. Molecular formula: C44H59N13O10S·xCF3COOH. Mole weight: 962.09. | |
| ACTH (6-24) (human, mouse, rat, porcine, bovine, ovine) trifluoroacetate salt | ACTH (6-24) is a peptide fragment of adrenocorticotropic hormone, a peptide hormone found in the brain that is involved in the biological stress response. Synonyms: HFRWGKPVGKKRRPVKVYP; Corticotropin-(6-24)-peptide. Grades: ≥95%. CAS No. 33512-65-1. Molecular formula: C111H175N35O21·xCF3COOH. Mole weight: 2335.8. | |
| Adrenomedullin (porcine) | Synonyms: ADM (porcine); H-Tyr-Arg-Gln-Ser-Met-Asn-Asn-Phe-Gln-Gly-Leu-Arg-Ser-Phe-Gly-Cys-Arg-Phe-Gly-Thr-Cys-Thr-Val-Gln-Lys-Leu-Ala-His-Gln-Ile-Tyr-Gln-Phe-Thr-Asp-Lys-Asp-Lys-Asp-Gly-Val-Ala-Pro-Arg-Ser-Lys-Ile-Ser-Pro-Gln-Gly-Tyr-NH2 (Disulfide bridge: Cys16-Cys21); Adrenomedullin (1-52), porcine. Grades: ≥95%. CAS No. 912862-96-5. Molecular formula: C262H403N79O76S3. Mole weight: 5971.77. | |
| Alanine aminotransferase, Porcine heart | Alanine aminotransferase, Porcine heart is a pyridoxal enzyme that catalyzes the reversible interconversion of L-alanine and 2-oxoglutalate to pyruvate and L-glutamate [1]. Uses: Scientific research. Group: Signaling pathways. CAS No. 9000-86-6. Pack Sizes: 200 U. Product ID: HY-P2985. | |
| Angiotensinogen (1-14), Porcine | Angiotensin is a peptide hormone that causes vasoconstriction and an increase in blood pressure. Uses: Serine proteinase inhibitors. Synonyms: H-ASP-ARG-VAL-TYR-ILE-HIS-PRO-PHE-HIS-LEU-LEU-VAL-TYR-SER-OH; ASP-ARG-VAL-TYR-ILE-HIS-PRO-PHE-HIS-LEU-LEU-VAL-TYR-SER; ANGIOTENSINOGEN FRAGMENT 1-14 PORCINE; ANGIOTENSINOGEN (1-14), PORCINE; ANGIOTENSINOGEN (1-14) (HORSE); ANGIOTENSINOGEN; PREANGIOTENSINOGEN (. Grades: 95%. CAS No. 64315-16-8. Molecular formula: C85H123N21O20. Mole weight: 1759. | |
| Anterior Lobe Pituitary Powder(Porcine) | Anterior Lobe Pituitary Powder(Porcine). Categories: betamethasone sodium phosphate; 151-73-5. | CA, FL & NJ |
| (Asp28)-Glucagon (1-29) (human, rat, porcine) | (Asp28)-Glucagon (1-29) (human, rat, porcine) is a deamidation product of glucagon. Synonyms: H-His-Ser-Gln-Gly-Thr-Phe-Thr-Ser-Asp-Tyr-Ser-Lys-Tyr-Leu-Asp-Ser-Arg-Arg-Ala-Gln-Asp-Phe-Val-Gln-Trp-Leu-Met-Asp-Thr-OH; L-Histidyl-L-seryl-L-glutaminylglycyl-L-threonyl-L-phenylalanyl-L-threonyl-L-seryl-L-α-aspartyl-L-tyrosyl-L-seryl-L-lysyl-L-tyrosyl-L-leucyl-L-α-aspartyl-L-seryl-L-arginyl-L-arginyl-L-alanyl-L-glutaminyl-L-α-aspartyl-L-phenylalanyl-L-valyl-L-glutaminyl-L-tryptophyl-L-leucyl-L-methionyl-L-α-aspartyl-L-threonine. Grades: ≥95%. CAS No. 1037751-81-7. Molecular formula: C153H224N42O50S. Mole weight: 3483.78. | |
| Atrial natriuretic factor (1-28) (human, porcine) | Atrial natriuretic factor (1-28) (human, porcine) is a 28 amino acid peptide corresponding to the rat protein sequence. It is an endogenous peptide synthesized in myoendocrine cells of the heart from which it is released into the circulation. It has effects on the renal and cardiovascular systems that decrease vasoconstriction, increase sodium excretion and inhibit renin secretion. It decreases plasma renin activity and cAMP levels in anesthetized rats and increases cGMP levels at 8 μg/kg. It also inhibits arginine vasopressin-induced increase in mean arterial blood pressure in spontaneously hypertensive and control rats when administered intracerebroventricularly at a dose of 150 ng. It produces diuretic, natriuretic and vasodilatory effects through stimulation of guanylate cyclase-linked NPR-A receptors. It plays an important role in blood volume and blood pressure regulation. Synonyms: ANF 1-28; hANF; Atrial Natriuretic Peptide human. CAS No. 91917-63-4. Molecular formula: C127H205N45O39S3. Mole weight: 3080.46. | |
| Atrial natriuretic factor(3-28)(human,bovine,porcine) | Heterocyclic Organic Compound. Alternative Names: ATRIAL NATRIURETIC PEPTIDE (3-28), HUMAN;ATRIAL NATRIURETIC FACTOR (3-28) (HUMAN);ANF (3-28) (HUMAN, CANINE);H-ARG-ARG-SER-SER-CYS-PHE-GLY-GLY-ARG-MET-ASP-ARG-ILE-GLY-ALA-GLN-SER-GLY-LEU-GLY-CYS-ASN-SER-PHE-ARG-TYR-OH;HANF (3-28). CAS No. 102686-43-1. Molecular formula: C118H187N43O36S3. Mole weight: 2880.21. Catalog: ACM102686431. |  |
| Atrial Natriuretic Peptide (ANP) (1-28), human, porcine Acetate | It is a 28-amino acid hormone that inhibits the secretion of endothelin-1 in a dose-dependent manner. Normally, it is produced and secreted by the human heart in response to cardiac injury and mechanical stretching. Synonyms: Atrial Natriuretic Factor (1-28) (human) acetate salt; H-Ser-Leu-Arg-Arg-Ser-Ser-Cys(1)-Phe-Gly-Gly-Arg-Met-Asp-Arg-Ile-Gly-Ala-Gln-Ser-Gly-Leu-Gly-Cys(1)-Asn-Ser-Phe-Arg-Tyr-OH.CH3CO2H; L-seryl-L-leucyl-L-arginyl-L-arginyl-L-seryl-L-seryl-L-cysteinyl-L-phenylalanyl-glycyl-glycyl-L-arginyl-L-methionyl-L-alpha-aspartyl-L-arginyl-L-isoleucyl-glycyl-L-alanyl-L-glutaminyl-L-seryl-glycyl-L-leucyl-glycyl-L-cysteinyl-L-asparagyl-L-seryl-L-phenylalanyl-L-arginyl-L-tyrosine (7->23)-disulfide acetic acid. Grades: ≥95%. CAS No. 1366000-58-9. Molecular formula: C127H203N45O39S3.C2H4O2. Mole weight: 3140.50. | |
| β-Lipotropin (1-10) (porcine) | (25R)-3β,17α-dihydroxy-5α-spirostan-6-one 3-O-α-L-rhamnopyranosyl-(1?2)-β-D-glucopyranoside is a natural product isolated from the bulbs of Lilium brownii var. viridulum. Synonyms: H-Glu-Leu-Ala-Gly-Ala-Pro-Pro-Glu-Pro-Ala-OH; L-alpha-glutamyl-L-leucyl-L-alanyl-glycyl-L-alanyl-L-prolyl-L-prolyl-L-alpha-glutamyl-L-prolyl-L-alanine; beta-LPH; L-Alanine, L-α-glutamyl-L-leucyl-L-alanylglycyl-L-alanyl-L-prolyl-L-prolyl-L-α-glutamyl-L-prolyl-; L-Alanine, N-[1-[N-[1-[1-[N-[N-[N-(N-L-α-glutamyl-L-leucyl)-L-alanyl]glycyl]-L-alanyl]-L-prolyl]-L-prolyl]-L-α-glutamyl]-L-prolyl]-; L-α-Glutamyl-L-leucyl-L-alanylglycyl-L-alanyl-L-prolyl-L-prolyl-L-α-glutamyl-L-prolyl-L-alanine. Grades: 95%. CAS No. 77875-68-4. Molecular formula: C42H66N10O15. Mole weight: 951.03. | |
| Biotinyl-Glucagon (1-29) (human, rat, porcine) | Synonyms: Biotinyl-Glucagon (1-29), human, bovine, porcine; Biotinyl-His-Ser-Gln-Gly-Thr-Phe-Thr-Ser-Asp-Tyr-Ser-Lys-Tyr-Leu-Asp-Ser-Arg-Arg-Ala-Gln-Asp-Phe-Val-Gln-Trp-Leu-Met-Asn-Thr-OH. Grades: ≥95% by HPLC. CAS No. 1802086-28-7. Molecular formula: C163H239N45O51S2. Mole weight: 3709.03. | |
| Bnp-26(porcine) | Heterocyclic Organic Compound. Alternative Names: DSGCFGRRLDRIGSLSGLGCNVLRRY (DISULFIDE BRIDGE: 4-20);H-ASP-SER-GLY-CYS-PHE-GLY-ARG-ARG-LEU-ASP-ARG-ILE-GLY-SER-LEU-SER-GLY-LEU-GLY-CYS-ASN-VAL-LEU-ARG-ARG-TYR-OH;H-ASP-SER-GLY-CYS-PHE-GLY-ARG-ARG-LEU-ASP-ARG-ILE-GLY-SER-LEU-SER-GLY-LEU-GLY-CYS-ASN-VAL-LEU. CAS No. 114547-28-3. Molecular formula: C120H198N42O36S2. Mole weight: 2869.25. Catalog: ACM114547283. | |
| Carboxypeptidase B from Porcine, Recombinant | Carboxypeptidase B (or peptidyl-L-lysine (-L-arginine) hydrolase) catalyzes the hydrolysis of the basic amino acids, lysine, arginine, and ornithine from the C-terminal position of polypeptides. It has been shown to be a single polypeptide of 34 kDa Da. Trypsin is capable of converting native enzyme to the active enzyme, carboxypeptidase B II in vitro. The optimum pH is found to be 9.0. The enzyme may be used for sequence analysis by successive cleavage of C-terminal basic amino acids. It can also be used as a serum marker for the diagnosis of acute pancreatitis. Carboxypeptidase b (ec 3.4.17.2), also well known as protaminase, pancreatic procarboxy-peptidase b (pcpb), ... mature chain. the secreted cpb zymogen is converted to enzymatically active cpb by limited proteolysis by trypsin. Group: Enzymes. Synonyms: carboxypeptidase B; protaminase; CPB1; pancreatic carboxypeptidase B; tissue carboxypeptidase B; peptidyl-L-lysine [L-arginine]hydrolase; EC 3.4.17.2; 9025-24-5. Enzyme Commission Number: EC 3.4.17.2. Purity: >90% (SDS-PAGE test). Mole weight: About 35kDa (SDS-PAGE detection). Activity: >180U/mg. Appearance: White powder, lyophilized. Storage: Redissolved in 20% glycerol, 4°C, store at -20°C for long-term preservation, Avoid multiple freeze-thaw cycles. Form: Freeze dried powder. Source: Porcine. carboxypeptidase B; protaminase; C |  |
| Carboxypeptidase B, Porcine pancreas | Carboxypeptidase B, Porcine pancreas (EC 3.4.2.2) is a peptide exonuclease that can specifically degrade peptide chains. Carboxypeptidase B is progressively degraded from the C-terminal to release free amino acids. Carboxypeptidase B hydrolyzes only peptide bonds with basic amino acids (such as arginine and lysine) as C-terminal residues [1] [2]. Uses: Scientific research. Group: Signaling pathways. Alternative Names: EC 3.4.2.2. CAS No. 9025-24-5. Pack Sizes: 1 mg; 5 mg. Product ID: HY-P2746. | |
| Cecropin p1(porcine) | Heterocyclic Organic Compound. CAS No. 125667-96-1. Molecular formula: C147H253N45O43. Mole weight: 3338.86. Catalog: ACM125667961. | |
| Cecropin P1, porcine | Cecropin P1, porcine is an antibacterial peptide that can be isolated from the upper part of the small intestine of the pig. Cecropin P1, porcine shows antibacterial activity against Gram-negative bacteria. Cecropin P1, porcine shows antiviral activity and inhibits PRRSV infection [1] [2]. Uses: Scientific research. Group: Peptides. CAS No. 125667-96-1. Pack Sizes: 5 mg; 10 mg. Product ID: HY-P2317. | |
| Chemically modified Porcine L-Lactate Dehydrogenase | Dehydrogenase that catalyzes the interconversion of L(+)-lactate to pyruvate. Take advantage of the enhanced liquid stability of this enzyme. Rely on the proven diagnostic quality of this product. Applications: Use l-lactate dehydrogenase (l-ldh), chemically modified, in a variety of diagnostic tests for the removal of pyruvate in determinations working with nadh (i.e., triglycerides, lipase, aldolase, aminotransferases, glutamate dehydrogenase). Group: Enzymes. Synonyms: lactic acid dehydrogenase; L-lactic dehydrogenase; L-lactic acid dehydrogenase; lactate dehydrogenase; L-lactate dehydrogenase; L-LDH; LAD; LD; Lactate. LDH. Activity: >25 U/mg lyophilizate; >150 U/mg protein. Stability: At +2 to +8°C within specification range for 12 months. Appearance: White lyophilizate. Source: Porcine heart. Species: Porcine. EC 1.1.1.27; 9001-60-9; lactic acid dehydrogenase; L (+)-nLDH; L-(+)-lactate dehydrogenase; L-lactic dehydrogenase; L-lactic acid dehydrogenase; lactate dehydrogenase; lactate dehydrogenase NAD-dependent; lactic dehydrogenase; NAD-lactate dehydrogenase; L-lactate dehydrogenase; (S)-Lactate:NAD+ oxidoreductase; L-LDH; LAD; LD; Lactate. Cat No: DIA-279. | |
| Chondroitin Sulfate Sodium Deodorized 90% (Porcine) | Chondroitin Sulfate Sodium Deodorized 90% (Porcine). Categories: creatineorotate; creatine orotate. | CA, FL & NJ |
| Collagen Type II, Porcine Sternal Cartilage, Dilution Buffer (10X) | Collagen Type II, Porcine Sternal Cartilage, Dilution Buffer (10X). Group: Molecular Biology. Grades: Highly Purified. Pack Sizes: 1x10ml. US Biological Life Sciences. |  Worldwide |
| C-Type Natriuretic Peptide-22 (human, porcine, rat) trifluoroacetate salt | C-Type natriuretic peptide-22 is an endogenous peptide which has diverse biological activities. CNP-22 acts as a selective agonist of natriuretic peptide receptors (NPRs) 2 and 3 (Kds = 7, 10.8, and >500,000 pM for NPR2, 3, and 1, respectively). The 22 amino acid sequence corresponds to residues 105-126 of its precursors prepro CNP, pro CNP, and CNP-53. Synonyms: CNP-22; glycyl-L-leucyl-L-seryl-L-lysylglycyl-L-cysteinyl-L-phenylalanylglycyl-L-leucyl-L-lysyl-L-leucyl-L-α-aspartyl-L-arginyl-L-isoleucylglycyl-L-seryl-L-methionyl-L-serylglycyl-L-leucylglycyl-L-cysteine cyclic (6?22)-disulfide trifluoroacetate salt. Grades: ≥95%. Molecular formula: C93H157N27O28S3·xCF3COOH. Mole weight: 2197.60. | |
| Diamine Oxidase from porcine kidney | Synonyms: Amine:oxygen oxidoreductase (deaminating) (pyridoxal-containing). CAS No. 9001-53-0. | |
| (D-Lys16)-ACTH (1-24) (human, bovine, mouse, ovine, porcine, rabbit, rat) | (D-Lys16)-ACTH (1-24) (human, bovine, mouse, ovine, porcine, rabbit, rat), a diastereoisomer of tetracosactide, is a synthetic human adrenocorticotropic hormone peptide analogue that stimulates cortisol production. Synonyms: (D-Lys16)-Tetracosactide; H-Ser-Tyr-Ser-Met-Glu-His-Phe-Arg-Trp-Gly-Lys-Pro-Val-Gly-Lys-D-Lys-Arg-Arg-Pro-Val-Lys-Val-Tyr-Pro-OH; (D-Lys16)-ACTH (1-24) (human, bovine, rat); L-Proline, L-seryl-L-tyrosyl-L-seryl-L-methionyl-L-α-glutamyl-L-histidyl-L-phenylalanyl-L-arginyl-L-tryptophylglycyl-L-lysyl-L-prolyl-L-valylglycyl-L-lysyl-D-lysyl-L-arginyl-L-arginyl-L-prolyl-L-valyl-L-lysyl-L-valyl-L-tyrosyl-; L-seryl-L-tyrosyl-L-seryl-L-methionyl-L-alpha-glutamyl-L-histidyl-L-phenylalanyl-L-arginyl-L-tryptophyl-glycyl-L-lysyl-L-prolyl-L-valyl-glycyl-L-lysyl-D-lysyl-L-arginyl-L-arginyl-L-prolyl-L-valyl-L-lysyl-L-valyl-L-tyrosyl-L-proline. Grades: ≥90%. CAS No. 494750-52-6. Molecular formula: C136H210N40O31S. Mole weight: 2933.48. | |
| Elastase, Porcine pancreas | Elastase, Porcine pancreas (EC 3.4.21.36) is a single polypeptide chain of 240 amino acid residues, derived from pig pancreas. Elastase, Porcine pancreas is a serine protease that can hydrolyze proteins and polypeptide. Elastase from porcine pancreas can induce emphysema in hamsters [1] [2] [3]. Uses: Scientific research. Group: Signaling pathways. Alternative Names: EC 3.4.21.36; Pancreatopeptidase E. CAS No. 39445-21-1. Pack Sizes: 5 mg; 10 mg; 25 mg; 50 mg; 100 mg. Product ID: HY-P2974. | |
| Endothelin-1 (human, bovine, dog, mouse, porcine, rat) acetate salt | Pheromone Ingredients. CAS No. 117399-94-7. Molecular formula: C109H159N25O32S5. Mole weight: 2491.902. Density: 1.3±0.1 g/cm3. Catalog: ACM117399947. | |
| Endothelin-1 (human, porcine) trifluoroacetate salt | Endothelin-1 is a peptide vasoconstrictor that in humans is encoded by the EDN1 gene and produced by vascular endothelial cells. It is an agonist of endothelin (ET) receptors ETA and ETB (IC50s = 0.15 and 0.12 nM, respectively). Synonyms: ET-1. Grades: ≥95%. Molecular formula: C109H159N25O32S5·xCF3COOH. Mole weight: 2491.91. | |
| Enterokinase, Ultrapure, Porcine, Cleavage Buffer | Enterokinase, Ultrapure, Porcine, Cleavage Buffer. Group: Molecular Biology. Grades: Molecular Biology Grade. CAS No. 9014-74-8. Pack Sizes: 5x1Vial. US Biological Life Sciences. | Worldwide |
| Enterokinase, Ultrapure, Porcine, Cleavage Control | Enterokinase, Ultrapure, Porcine, Cleavage Control. Group: Molecular Biology. Grades: Molecular Biology Grade. CAS No. 9014-74-8. Pack Sizes: 5x10ug. US Biological Life Sciences. | Worldwide |
| Enterokinase, Ultrapure, Porcine (Enteropeptidase) | Enterokinase, Ultrapure, Porcine (Enteropeptidase). Group: Molecular Biology. Alternative Names: EC=3.4.21.9. Grades: Molecular Biology Grade. CAS No. 9014-74-8. Pack Sizes: 5x100U. US Biological Life Sciences. | Worldwide |
| Enterokinase, Ultrapure, Porcine, Storage Buffer | Enterokinase, Ultrapure, Porcine, Storage Buffer. Group: Molecular Biology. Grades: Molecular Biology Grade. CAS No. 9014-74-8. Pack Sizes: 5x1Vial. US Biological Life Sciences. | Worldwide |
| Enterostatin(bovine,canine,porcine) | Heterocyclic Organic Compound. Alternative Names: H-VAL-PRO-ASP-PRO-ARG-OH;ENTEROSTATIN (PIG, RAT);ENTEROSTATIN, PORCINE, RAT;V-P-D-P-R;VAL-PRO-ASP-PRO-ARG. CAS No. 117137-85-6. Molecular formula: C25H42N8O8. Mole weight: 582.65. Purity: 0.96. IUPACName: 2-[[1-[2-[[1- (2-amino-3-methylbutanoyl)pyrrolidine-2-carbonyl]amino]-3-carboxypropanoyl]pyrrolidine-2-carbonyl]amino]-5- (diaminomethylideneamino)pentanoic acid. Canonical SMILES: CC (C)C (C (=O)N1CCCC1C (=O)NC (CC (=O)O)C (=O)N2CCCC2C (=O)NC (CCCN=C (N)N)C (=O)O)N. Catalog: ACM117137856. | |
| Esterase Isoenzyme 1 from Porcine liver, Recombinant | An esterase is a hydrolase that splits esters into acids and alcohols. Applications: Esterase isoenzymes may be used to identify the mon ocytic element in normal and leukemic cells. they may be used for the bi ochemical characterization of different hematopoietic cell lineages and stages of differentiation when studying leukemias and lymphomas. esterase isoenzyme is recombinant and from porcine liver. it is expressed in e. coli. Group: Enzymes. Synonyms: EC 3.1.1.1; Esterase Isoenzyme 1; 9016-18-6; carboxylesterase; ali-esterase; B-esterase; monobutyrase; cocaine esteras. Enzyme Commission Number: EC 3.1.1.1. CAS No. 9016-18-6. Esterase. Activity: > 30.0 U/g. Storage: -20°C. Source: E. coli. Species: Porcine liver. EC 3.1.1.1; Esterase Isoenzyme 1; 9016-18-6; carboxylesterase; ali-esterase; B-esterase; monobutyrase; cocaine esterase; procaine esterase; methylbutyrase; vitamin A esterase; butyryl esterase; carboxyesterase; carboxylate esterase; carboxylic esterase; methylbutyrate esterase; triacetin esterase; carboxyl ester hydrolase; butyrate esterase; methylbutyrase; α-carboxylesterase; propionyl esterase; nonspecific carboxylesterase; esterase D; esterase B; esterase A; serine esterase; carboxylic acid esterase; cocaine esterase. Pack: Bottomless glass bottle. Contents are inside inserted fused cone. Cat No: NATE-0229. | |
| Esterase Isoenzyme 2 from Porcine liver, Recombinant | An esterase is a hydrolase that splits esters into acids and alcohols. Applications: Esterase isoenzymes may be used to identify the mon ocytic element in normal and leukemic cells. they may be used for the bi ochemical characterization of different hematopoietic cell lineages and stages of differentiation when studying leukemias and lymphomas. esterase isoenzyme 2, is from porcine liver and is recombinant and expressed in e. coli. Group: Enzymes. Synonyms: EC 3.1.1.1; Esterase Isoenzyme 2; 9016-18-6; carboxylesterase; ali-esterase; B-esterase; monobutyrase; cocaine estera. Enzyme Commission Number: EC 3.1.1.1. CAS No. 9016-18-6. Esterase. Activity: > 80 U/g. Storage: -20°C. Source: E. coli. Species: Porcine liver. EC 3.1.1.1; Esterase Isoenzyme 2; 9016-18-6; carboxylesterase; ali-esterase; B-esterase; monobutyrase; cocaine esterase; procaine esterase; methylbutyrase; vitamin A esterase; butyryl esterase; carboxyesterase; carboxylate esterase; carboxylic esterase; methylbutyrate esterase; triacetin esterase; carboxyl ester hydrolase; butyrate esterase; methylbutyrase; α-carboxylesterase; propionyl esterase; nonspecific carboxylesterase; esterase D; esterase B; esterase A; serine esterase; carboxylic acid esterase; cocaine esterase. Pack: Bottomless glass bottle. Contents are inside inserted fused cone. Cat No: NATE-0230. | |
| Esterase Isoenzyme 3 from Porcine liver, Recombinant | An esterase is a hydrolase that splits esters into acids and alcohols. Applications: Esterase isoenzymes may be used to identify the mon ocytic element in normal and leukemic cells. they may be used for the biochemical characterization of different hematopoietic cell lineages and stages of differentiation when studying leukemias and lymphomas. Group: Enzymes. Synonyms: EC 3.1.1.1; ali-esterase; B-esterase; monobutyrase; cocaine esterase; procaine esterase; methylbutyrase; vitamin A esterase; butyryl esterase; carboxyesterase; carboxylate esterase; carboxylic esterase. Enzyme Commission Number: EC 3.1.1.1. CAS No. 9016-18-6. Esterase. Activity: > 0.8 units/mg. Storage: -20°C. Source: E. coli. Species: Porcine liver. EC 3.1.1.1; Esterase Isoenzyme 3; 9016-18-6; carboxylesterase; ali-esterase; B-esterase; monobutyrase; cocaine esterase; procaine esterase; methylbutyrase; vitamin A esterase; butyryl esterase; carboxyesterase; carboxylate esterase; carboxylic esterase; methylbutyrate esterase; triacetin esterase; carboxyl ester hydrolase; butyrate esterase; methylbutyrase; α-carboxylesterase; propionyl esterase; nonspecific carboxylesterase; esterase D; esterase B; esterase A; serine esterase; carboxylic acid esterase; cocaine esterase. Pack: Bottomless glass bottle. Contents are inside inserted fused cone. Cat No: NATE-0231. | |
| Esterase Isoenzyme 5 from Porcine liver, Recombinant | An esterase is a hydrolase that splits esters into acids and alcohols. Applications: Esterase isoenzymes may be used to identify the mon ocytic element in normal and leukemic cells. they may be used for the bi ochemical characterization of different hematopoietic cell lineages and stages of differentiation when studying leukemias and lymphomas. esterase isoenzyme 5 is recombinant and from porcine liver. it is expressed in e. coli. Group: Enzymes. Synonyms: EC 3.1.1.1; Esterase Isoenzyme 5; 9016-18-6; carboxylesterase; ali-esterase; B-esterase; monobutyrase; cocaine e. Enzyme Commission Number: EC 3.1.1.1. CAS No. 9016-18-6. Esterase. Activity: > 0.5 units/mg. Storage: -20°C. Source: E. coli. Species: Porcine liver. EC 3.1.1.1; Esterase Isoenzyme 5; 9016-18-6; carboxylesterase; ali-esterase; B-esterase; monobutyrase; cocaine esterase; procaine esterase; methylbutyrase; vitamin A esterase; butyryl esterase; carboxyesterase; carboxylate esterase; carboxylic esterase; methylbutyrate esterase; triacetin esterase; carboxyl ester hydrolase; butyrate esterase; methylbutyrase; α-carboxylesterase; propionyl esterase; nonspecific carboxylesterase; esterase D; esterase B; esterase A; serine esterase; carboxylic acid esterase; cocaine esterase. Pack: Bottomless glass bottle. Contents are inside inserted fused cone. Cat No: NATE-0232. | |
| Esterase Isoenzyme 6 from Porcine liver, Recombinant | An esterase is a hydrolase that splits esters into acids and alcohols. Applications: Esterase isoenzymes may be used to identify the mon ocytic element in normal and leukemic cells. they may be used for the bi ochemical characterization of different hematopoietic cell lineages and stages of differentiation when studying leukemias and lymphomas. esterase isoenzyme 6 is recombinant and from porcine liver. it is expressed in e. coli. Group: Enzymes. Synonyms: EC 3.1.1.1; Esterase Isoenzyme 6; 9016-18-6; carboxylesterase; ali-esterase; B-esterase; monobutyrase; cocaine e. Enzyme Commission Number: EC 3.1.1.1. CAS No. 9016-18-6. Esterase. Activity: > 1.2 units/mg. Storage: -20°C. Source: E. coli. Species: Porcine liver. EC 3.1.1.1; Esterase Isoenzyme 6; 9016-18-6; carboxylesterase; ali-esterase; B-esterase; monobutyrase; cocaine esterase; procaine esterase; methylbutyrase; vitamin A esterase; butyryl esterase; carboxyesterase; carboxylate esterase; carboxylic esterase; methylbutyrate esterase; triacetin esterase; carboxyl ester hydrolase; butyrate esterase; methylbutyrase; α-carboxylesterase; propionyl esterase; nonspecific carboxylesterase; esterase D; esterase B; esterase A; serine esterase; carboxylic acid esterase; cocaine esterase. Pack: Bottomless glass bottle. Contents are inside inserted fused cone. Cat No: NATE-0233. | |
| Galanin (1-15) (porcine, rat) | Galanin (1-15) (porcine, rat) is a N-terminal galanin fragment. It modulates central cardiovascular effects in contrast to the full length (1-29) peptide. Synonyms: Galanin (1-15); 1-15-Galanin(cattle)(9ci). CAS No. 112747-70-3. Molecular formula: C72H105N19O20. Mole weight: 1556.74. | |
| Galanin (1-16), mouse, porcine, rat | Galanin (1-16), mouse, porcine, rat is an agonist of the hippocampal galanin receptor with Kd of 3 nM. Synonyms: H-Gly-Trp-Thr-Leu-Asn-Ser-Ala-Gly-Tyr-Leu-Leu-Gly-Pro-His-Ala-Ile-OH; glycyl-L-tryptophyl-L-threonyl-L-leucyl-L-asparagyl-L-seryl-L-alanyl-glycyl-L-tyrosyl-L-leucyl-L-leucyl-glycyl-L-prolyl-L-histidyl-L-alanyl-L-isoleucine; Galanin (1-16) (porcine, rat); Galanin Fragment 1-16, porcine, rat. Grades: 95%. CAS No. 125118-77-6. Molecular formula: C78H116N20O21. Mole weight: 1669.88. | |
| Galanin(1-16)(porcine,rat) | Heterocyclic Organic Compound. Alternative Names: GWTLNSAGYLLGPHAI;GALANIN (1-16) (PORCINE, RAT);GLY-TRP-THR-LEU-ASN-SER-ALA-GLY-TYR-LEU-LEU-GLY-PRO-HIS-ALA-ILE;GLY-TRP-THR-LEU-ASN-SER-SER-ALA-GLY-TYR-LEU-LEU-GLY-PRO-HIS-ALA-ILE;H-GLY-TRP-THR-LEU-ASN-SER-ALA-GLY-TYR-LEU-LEU-GLY-PRO-HIS-ALA-ILE-OH;galani. CAS No. 125118-77-6. Molecular formula: C78H116N20O21. Mole weight: 1669.88. Appearance: white powder. Purity: 0.96. IUPACName: Galanin (1-16). Canonical SMILES: CCC (C)C (C (=O)O)NC (=O)C (C)NC (=O)C (CC1=CNC=N1)NC (=O)C2CCCN2C (=O)CNC (=O)C (CC (C)C)NC (=O)C (CC (C)C)NC (=O)C (CC3=CC=C (C=C3)O)NC (=O)CNC (=O)C (C)NC (=O)C (CO)NC (=O)C (CC (=O)N)NC (=O)C (CC (C)C)NC (=O)C (C (C)O)NC (=O)C (CC4=CNC5=CC=CC=C54)NC (=O)CN. Catalog: ACM125118776. | |
| Galanin-Like Peptide (porcine) | Galanin-Like Peptide (porcine) is a GALR2 (galanin receptor)-binding neuropeptide isolated from porcine hypothalamus. It is an endogenous ligand that preferentially binds to GALR2 receptors and plays a role in regulating the effects of leptin, a satiety hormone. It is a potent vasoactive peptide and is thought to be involved in inflammatory responses. Synonyms: GALP (porcine); H-Ala-Pro-Val-His-Arg-Gly-Arg-Gly-Gly-Trp-Thr-Leu-Asn-Ser-Ala-Gly-Tyr-Leu-Leu-Gly-Pro-Val-Leu-His-Pro-Pro-Ser-Arg-Ala-Glu-Gly-Gly-Gly-Lys-Gly-Lys-Thr-Ala-Leu-Gly-Ile-Leu-Asp-Leu-Trp-Lys-Ala-Ile-Asp-Gly-Leu-Pro-Tyr-Pro-Gln-Ser-Gln-Leu-Ala-Ser-OH. Grades: 95%. CAS No. 245114-96-9. Molecular formula: C281H443N81O78. Mole weight: 6204.02. | |
| Galanin (porcine) | Galanin (porcine) is an endogenous porcine galanin receptor agonist (pKi = 9.63, 9.49, 9.02, 8.98, 8.01 and 8.14 at hGAL1, rGAL1, hGAL2, rGAL2, hGAL3 and rGAL3, respectively). It causes an increase in food intake under free access conditions and also plays roles in learning and memory, anxiety and sexual behavior. CAS No. 88813-36-9. Molecular formula: C146H213N43O40. Mole weight: 3210.55. | |
| Ganglioside GD1a (Porcine Brain) | Ganglioside GD1a (Porcine Brain) is a remarkable bioactive lipid molecule used for studying neurodegeneration, specifically Alzheimer's and Parkinson's afflictions. Synonyms: Disialoganglioside-GD1a (porcine brain, diammonium salt). Grades: >99%. CAS No. 12707-58-3. Molecular formula: C84H154N6O39. Mole weight: 1872.14. | |
| Ganglioside GD1b (Porcine Brain) | Ganglioside GD1b (porcine brain, triammonium salt). Group: Natural lipids. CAS No. 2315262-17-8. Molecular formula: C84H154N6O39. Mole weight: 1872.14. Purity: >99%. Catalog: ACM2315262178. | |
| Ganglioside GD1b (Porcine Brain) Triammonium salt | Ganglioside GD1b (Porcine Brain) Triammonium salt, a crucial glycosphingolipid, exerts vital influence over cell signaling and adhesion in the human body. Given its emerging therapeutic implications in treating neurological ailments like Parkinson's disease and multiple sclerosis, and certain cancers, it remains the focus of extensive studies. Meanwhile, its potential for modulating immune cell function in the realm of autoimmune disorders is compelling scientists to explore its promising attributes further. Synonyms: Ganglioside GD1b (porcine brain, triammonium salt). Grades: >99%. CAS No. 2315262-17-8. Molecular formula: C84H154N6O39. Mole weight: 1872.14. | |
| Ganglioside GQ1b (Porcine Brain) | Ganglioside GQ1b (porcine brain, tetraammonium salt). Group: Natural lipids. CAS No. 2316360-46-8. Molecular formula: C106H194N10O55. Mole weight: 2488.73. Catalog: ACM2316360468. | |
| Ganglioside GQ1b (Porcine Brain) Tetraammonium salt | Ganglioside GQ1b (Porcine Brain) Tetraammonium salt is an essential biomolecule found in the porcine brain. This tetraammonium salt of Ganglioside GQ1b is used for studying various neurological disorders, known for its neuroprotective properties. Synonyms: Ganglioside GQ1b (porcine brain, tetraammonium salt). Grades: >99%. CAS No. 2316360-46-8. Molecular formula: C106H194N10O55. Mole weight: 2488.73. | |
| Gastric Inhibitory Polypeptide (1-30) amide (porcine) | It is a fully glucose-dependent insulinotropic polypeptide (GIP) receptor agonist with high affinity equal to native GIP(1-42). It is a weak inhibitor of gastric acid secretion and a strong stimulator of insulin. The site responsible for insulinotropic activity is apparently located between residues 19 and 30 of GIP. Synonyms: Glucose-Dependent Insulinotropic Polypeptide (1-30) amide (porcine); H-Tyr-Ala-Glu-Gly-Thr-Phe-Ile-Ser-Asp-Tyr-Ser-Ile-Ala-Met-Asp-Lys-Ile-Arg-Gln-Gln-Asp-Phe-Val-Asn-Trp-Leu-Leu-Ala-Gln-Lys-NH2; L-tyrosyl-L-alanyl-L-alpha-glutamyl-glycyl-L-threonyl-L-phenylalanyl-L-isoleucyl-L-seryl-L-alpha-aspartyl-L-tyrosyl-L-seryl-L-isoleucyl-L-alanyl-L-methionyl-L-alpha-aspartyl-L-lysyl-L-isoleucyl-L-arginyl-L-glutaminyl-L-glutaminyl-L-alpha-aspartyl-L-phenylalanyl-L-valyl-L-asparagyl-L-tryptophyl-L-leucyl-L-leucyl-L-alanyl-L-glutaminyl-L-lysinamide; GIP (1-30) amide, porcine. Grades: ≥95%. CAS No. 134846-93-8. Molecular formula: C162H245N41O47S. Mole weight: 3551.04. | |
| Gastric inhibitory polypeptide(porcine) | Heterocyclic Organic Compound. Alternative Names: YAEGTFISDYSIAMDKIRQQDFVNWLLAQKGKKSDW KHNITQ; H-TYR-ALA-GLU-Gly -THR-PHE-ILE-SER-ASP-TYR-SER-ILE-ALA-MET-ASP-ly S-ILE-ARG-GLN-GLN-ASP-PHE-VAL-ASN-TRP-LEU-LEU-ALA-GLN-ly S-Gly -ly S-ly S-SER-ASP-TRP-ly S-HIS-ASN-ILE-THR-GLN-OH; GAStri C INHIBITORY PEPTIDE, PORCINE;GA. CAS No. 11063-17-5. Molecular formula: C225H342N60O66S. Mole weight: 4975.55. Catalog: ACM11063175. | |
| Gastric Inhibitory Polypeptide (porcine) | Synonyms: L-Tyrosyl-L-alanyl-L-α-glutamylglycyl-L-threonyl-L-phenylalanyl-L-isoleucyl-L-seryl-L-α-aspartyl-L-tyrosyl-L-seryl-L-isoleucyl-L-alanyl-L-methionyl-L-α-aspartyl-L-lysyl-L-isoleucyl-L-arginyl-L-glutaminyl-L-glutaminyl-L-α-aspartyl-L-phenylalanyl-L-valyl-L-asparaginyl-L-tryptophyl-L-leucyl-L-leucyl-L-alanyl-L-glutaminyl-L-lysylglycyl-L-lysyl-L-lysyl-L-seryl-L-α-aspartyl-L-tryptophyl-L-lysyl-L-histidyl-L-asparaginyl-L-isoleucyl-L-threonyl-L-glutamine; Gastric inhibitory polypeptide (pig major); Gastric inhibitory polypeptide (swine major); Gastric inhibitory polypeptide (pig); Pig gastric inhibitory polypeptide; Porcine gastric inhibitory peptide; Porcine gastric inhibitory polypeptide; H-Tyr-Ala-Glu-Gly-Thr-Phe-Ile-Ser-Asp-Tyr-Ser-Ile-Ala-Met-Asp-Lys-Ile-Arg-Gln-Gln-Asp-Phe-Val-Asn-Trp-Leu-Leu-Ala-Gln-Lys-Gly-Lys-Lys-Ser-Asp-Trp-Lys-His-Asn-Ile-Thr-Gln-OH. CAS No. 11063-17-5. Molecular formula: C225H342N60O66S. Mole weight: 4975.55. | |
| Gelatin from porcine skin | Gelatin from porcine skin. Group: 3d printing materials. CAS No. 9000-70-8. |  |
| Gelatin powdered, from porcine skin | 100g Pack Size. Group: Analytical Reagents, Biochemicals, Diagnostic Raw Materials. Formula: C31H27NO4. CAS No. 9000-70-8. Prepack ID 20930194-100g. Molecular Weight 477.55. See USA prepack pricing. |  |
| Glogotriaosylsphingosine from porcine blood | Heterocyclic Organic Compound. Alternative Names: Lysogb3, Gb3 Lysosphingolipid, nchembio.191-comp3, Globotriaosyl lysosphingolipid, CID6449939, (R-(R*,S*-(E)))-2-Amino-3-hydroxy-4-octadecenyl O-alpha-D-galactopyranosyl-(1-4)-O-beta-D-galctopyranosyl-(1-4)-beta-D-glucopyranoside, 126550-86-5, alpha-D-Galactopyranosyl-(1,4)-beta-D-galactopyranosyl-(1,4)-beta-D-glucopyranosyl-(1,1)-(2S,3R,4E)-2-amino-octadec-4-ene-1,3-diol, beta-D-Glucopyranoside, 2-amino-3-hydroxy-4-octadecenyl O-alpha-D-galactopyranosyl-(1-4)-O-beta-D-galctopyranosyl-(1-4)-, (R-(R*,S*-(E)))-. CAS No. 126550-86-5. Molecular formula: C36H67NO17. Mole weight: 785.91. Purity: 0.96. IUPACName: (2R,3R,4S,5R,6R)-2-[(2R,3R,4R,5R,6S)-6-[(2R,3S,4R,5R,6R)-6-[(E,2S,3R)-2-amino-3-hydroxyoctadec-4-enoxy]-4,5-dihydroxy-2-(hydroxymethyl)oxan-3-yl]oxy-4,5-dihydroxy-2-(hydroxymethyl)oxan-3-yl]oxy-6-(hydroxymethyl)oxane-3,4,5-triol. Density: 1.37g/cm³. Catalog: ACM126550865. | |
| (Glu20)-Glucagon (1-29) (human, rat, porcine) | (Glu20)-Glucagon (1-29) (human, rat, porcine) is a deamidation product of glucagon. Synonyms: H-His-Ser-Gln-Gly-Thr-Phe-Thr-Ser-Asp-Tyr-Ser-Lys-Tyr-Leu-Asp-Ser-Arg-Arg-Ala-Glu-Asp-Phe-Val-Gln-Trp-Leu-Met-Asn-Thr-OH. Grades: ≥95%. CAS No. 2022956-46-1. Molecular formula: C153H224N42O50S. Mole weight: 3483.78. | |
| (Glu24)-Glucagon (1-29) (human, rat, porcine) | (Glu24)-Glucagon (1-29) (human, rat, porcine) is a deamidation product of glucagon. Synonyms: H-His-Ser-Gln-Gly-Thr-Phe-Thr-Ser-Asp-Tyr-Ser-Lys-Tyr-Leu-Asp-Ser-Arg-Arg-Ala-Gln-Asp-Phe-Val-Glu-Trp-Leu-Met-Asn-Thr-OH. Grades: ≥95%. CAS No. 308356-99-2. Molecular formula: C153H224N42O50S. Mole weight: 3483.78. | |
| (Glu3)-Glucagon (1-29) (human, rat, porcine) | (Glu3)-Glucagon (1-29) (human, rat, porcine) is a deamidation product of glucagon. Synonyms: H-His-Ser-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Tyr-Ser-Lys-Tyr-Leu-Asp-Ser-Arg-Arg-Ala-Gln-Asp-Phe-Val-Gln-Trp-Leu-Met-Asn-Thr-OH. Grades: ≥95%. CAS No. 108997-34-8. Molecular formula: C153H224N42O50S. Mole weight: 3483.78. | |
Our database is helping our users find suppliers everyday.
