A directory of where to buy chemicals in the USA, including: distributors, industrial manufacturers, bulk supplies and wholesalers of raw ingredients & finished goods.
GLP-1R agonist DMB is a glucagon-like peptide-1 (GLP-1) receptor agonist used potentially for the treatment of type 2 diabetes. Uses: Potential treatment of type 2 diabetes. Synonyms: N-(tert-Butyl)-6,7-dichloro-3-(methylsulfonyl)quinoxalin-2-amine. Grade: 99%. CAS No. 281209-71-0. Molecular formula: C13H15Cl2N3O2S. Mole weight: 348.25.
GLP-1R Antagonist 1
GLP-1R Antagonist 1 (compound 5d) is an orally active, CNS penetrant and non-competitive antagonist of glucagon-like peptide 1 receptor (GLP-1R), with an IC50 of 650 nM[1]. Uses: Scientific research. Group: Signaling pathways. CAS No. 488097-06-9. Pack Sizes: 10 mM * 1 mL; 5 mg; 10 mg; 25 mg; 50 mg; 100 mg. Product ID: HY-101116.
GLP-1 receptor agonist 10
GLP-1 receptor agonist 10 (compound 42) is an agonist of GLP Receptor. GLP-1 receptor agonist 10 inhibits food intake and reduces glucose excursion in mice. GLP-1 receptor agonist 10 can be used in the study of type 2 diabetes (T2DM) and obesity [1]. Uses: Scientific research. Group: Signaling pathways. CAS No. 3015555-46-8. Pack Sizes: 10 mM * 1 mL; 5 mg; 10 mg; 25 mg; 50 mg; 100 mg. Product ID: HY-153798.
GLP-1 receptor agonist 12
GLP-1 receptor agonist 12 (compound 20A) is an agonist of GLP Receptor. GLP-1 receptor agonist 12 can be used in the study of diseases such as diabetes [1]. Uses: Scientific research. Group: Signaling pathways. CAS No. 2775376-50-4. Pack Sizes: 1 mg; 5 mg; 10 mg. Product ID: HY-153816.
GLP-1 receptor agonist 2
GLP-1 receptor agonist 2 is a glucagon-like peptide-1 receptor (GLP-1R) agonist. Uses: Scientific research. Group: Signaling pathways. CAS No. 2230197-64-3. Pack Sizes: 10 mM * 1 mL; 5 mg; 10 mg. Product ID: HY-112679.
GLP-1 receptor agonist 2
GLP-1 receptor agonist 2 is an agonist of glucagon-like peptide-1 receptor (GLP-1R). Synonyms: 1H-Benzimidazole-6-carboxylic acid, 2-[[(2S)-4-[6-[(4-chloro-2-fluorophenyl)methoxy]-2-pyridinyl]-2-methyl-1-piperazinyl]methyl]-1-[(2S)-2-oxetanylmethyl]-; 2-{[(2S)-4-{6-[(4-Chloro-2-fluorobenzyl)oxy]-2-pyridinyl}-2-methyl-1-piperazinyl]methyl}-1-[(2S)-2-oxetanylmethyl]-1H-benzimidazole-6-carboxylic acid. Grade: ≥95%. CAS No. 2230197-64-3. Molecular formula: C30H31ClFN5O4. Mole weight: 580.05.
GLP-1 receptor agonist 3
GLP-1 receptor agonist 3 is a GLP-1 receptor agonist with EC50s of 1.1 and 13 nM in Clone H6 and Clone C6 cell lines assay, respectively. (Extracted from patent WO2018109607A1, Example 4A-1). Synonyms: 1H-Benzimidazole-6-carboxylic acid, 2-[[4-[6-[(4-cyano-2-fluorophenyl)methoxy]-2-pyridinyl]-1-piperidinyl]methyl]-1-[(2R)-2-oxetanylmethyl]-; 2-[(4-{6-[(4-Cyano-2-fluorobenzyl)oxy]-2-pyridinyl}-1-piperidinyl)methyl]-1-[(2R)-2-oxetanylmethyl]-1H-benzimidazole-6-carboxylic acid. Grade: ≥95%. CAS No. 2230200-09-4. Molecular formula: C31H30FN5O4. Mole weight: 555.60.
GLP-1 receptor agonist 4
GLP-1 receptor agonist 4, a glucagon-like peptide-1 receptor (GLP-1R) agonist with an EC50 of 64.5 nM, can be used in the study of diabetes treatment. (Extracted from patent WO2009111700A2, compound 87). Synonyms: (S)-3-(4'-Cyano-[1,1'-biphenyl]-4-yl)-2-((3R,8S)-3-(4-((3,4-dichlorobenzyl)oxy)phenyl)-1-methyl-2-oxo-7-((S)-1-phenylpropyl)-2,3,6,7,8,9-hexahydro-1H-[1,4]oxazino[3,2-g]isoquinoline-8-carboxamido)propanoic acid; (2S)-3-(4'-Cyano-4-biphenylyl)-2-[({(3R,8S)-3-{4-[(3,4-dichlorobenzyl)oxy]phenyl}-1-methyl-2-oxo-7-[(1S)-1-phenylpropyl]-2,3,6,7,8,9-hexahydro-1H-[1,4]oxazino[3,2-g]isoquinolin-8-yl}carbonyl)amino]propanoic acid. Grade: ≥95%. CAS No. 1187061-62-6. Molecular formula: C51H44Cl2N4O6. Mole weight: 879.82.
GLP-1 receptor agonist 7
GLP-1 receptor agonist 7 is a potent agonist of glucagon-like peptide-1 ( GLP-1 ). GLP-1 receptor agonist 7 has the potential for the research of GLP-1-associated diseases, disorders, and conditions including diabetes mellitus (extracted from patent WO2021219019A1, compound 130b) [1]. Uses: Scientific research. Group: Signaling pathways. CAS No. 2736447-04-2. Pack Sizes: 5 mg; 10 mg. Product ID: HY-145412.
GLP-1 receptor agonist 7
GLP-1 receptor agonist 7 is a potent glucagon-like peptide-1 (GLP-1) agonist with potential to study GLP-1-related diseases, disorders and conditions, including diabetes mellitus. (Extracted from patent WO2021219019A1, compound 130b). Synonyms: 2-((4-((S)-3-(4-chloro-2-fluorophenyl)-2,3-dihydrobenzo[b][1,4]dioxin-5-yl)piperidin-1-yl)methyl)-3-(((S)-oxetan-2-yl)methyl)-3H-imidazo[4,5-b]pyridine-5-carboxylic acid. CAS No. 2736447-04-2. Molecular formula: C31H30ClFN4O5. Mole weight: 593.05.
GLP-1 receptor agonist 8
GLP-1 receptor agonist 8, a potent GLP-1 receptor agonist, has potential in the study of diabetes, obesity and non-alcoholic fatty liver disease (NAFLD). (Extracted from patent WO2019239319A1, compound 17). Synonyms: ammonium (R)-2-((4-(2-(4-chloro-2-fluorophenyl)-2-methylbenzo[d][1,3]dioxol-4-yl)piperidin-1-yl)methyl)-1-((1-ethyl-1H-imidazol-5-yl)methyl)-1H-benzo[d]imidazole-6-carboxylate. CAS No. 2401892-86-0. Molecular formula: C34H36ClFN6O4. Mole weight: 647.14.
GLP-1 receptor agonist 9
GLP-1 receptor agonist 9 is an agonist of GLP-1 receptor. (Extracted from WO2020234726 A1, example 7). Synonyms: 1H-Benzimidazole-6-carboxylic acid, 2-[[4-[(2S)-2-(4-chloro-2-fluorophenyl)-2-methyl-1,3-benzodioxol-4-yl]-1-piperidinyl]methyl]-1-[(2S)-2-oxetanylmethyl]-. Grade: ≥95%. CAS No. 2401892-71-3. Molecular formula: C32H31ClFN3O5. Mole weight: 592.06.
GLP-1 receptor agonist 9 citrate
GLP-1 receptor agonist 9 is an agonist of GLP-1 receptor. Molecular formula: C38H39ClFN3O12. Mole weight: 784.18.
GLP-1R modulator C16
GLP-1R modulator C16 is an allosteric modulator that enhances the binding of GLP-1 to GLP-1R through transmembrane site with an EC50 of 8.43±3.82 μM. Synonyms: N-{4-[(2-chloro-6-fluorobenzyl)oxy]-3-methoxybenzyl}-N-[2-(4-morpholinyl)ethyl]amine; N-{4-[(2-Chloro-6-fluorobenzyl)oxy]-3-methoxybenzyl}-2-(4-morpholinyl)ethanamine; 4-Morpholineethanamine, N-[[4-[(2-chloro-6-fluorophenyl)methoxy]-3-methoxyphenyl]methyl]-. Grade: ≥90%. CAS No. 875005-43-9. Molecular formula: C21H26ClFN2O3. Mole weight: 408.89.
GLP-1R modulator C5
GLP-1R modulator C5 is an allosteric modulator enhancing GLP-1 binding to GLP-1R via a transmembrane site (EC50 1.59 ± 0.53 ?M). Uses: Scientific research. Group: Signaling pathways. CAS No. 421578-93-0. Pack Sizes: 10 mM * 1 mL; 5 mg; 10 mg; 25 mg; 50 mg; 100 mg. Product ID: HY-141840.
GLP-1R modulator C5
GLP-1R modulator C5 is an allosteric modulator that enhances the binding of GLP-1 to GLP-1R through transmembrane site with an EC50 of 1.59±0.53 μM. Synonyms: 3-hydroxy-3-(2-oxo-2-phenylethyl)-1-(2-phenylethyl)-1,3-dihydro-2H-indol-2-one; 2H-Indol-2-one, 1,3-dihydro-3-hydroxy-3-(2-oxo-2-phenylethyl)-1-(2-phenylethyl)-. Grade: ≥90%. CAS No. 421578-93-0. Molecular formula: C24H21NO3. Mole weight: 371.43.
GLP-1R modulator L7-028
GLP-1R modulator L7-028 is an allosteric modulator that enhances the binding of GLP-1 to GLP-1R through transmembrane site with an EC50 of 11.01±2.73 μM. Synonyms: Benzamide, 3-(cyclopentyloxy)-N-[3-(1-piperidinylcarbonyl)phenyl]-. Grade: ≥95%. CAS No. 2648317-95-5. Molecular formula: C24H28N2O3. Mole weight: 392.49.
GLP-1 TFA
GLP-1 is a potent insulin secretagogue that has multiple synergetic effects on the glucose-dependent insulin secretion pathways of the beta-cell. Synonyms: GLP-1 trifluoroacetate salt; Glucagon-like peptide 1 trifluoroacetate salt; H-His-Ala-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Val-Ser-Ser-Tyr-Leu-Glu-Gly-Gln-Ala-Ala-Lys-Glu-Phe-Ile-Ala-Trp-Leu-Val-Lys-Gly-Arg-NH2.TFA.
GLP-2 (1-33) (human)
GLP-2 (human) is an endogenous peptide that acts as an intestinal epithelium-specific growth factor. It stimulates cell proliferation and inhibits apoptosis, and also modulates intestinal glucose transport, food intake, and gastric acid secretion. Synonyms: Glucagon-like peptide 2 (human); GLP-2 (human); GLP 2 (human). Grade: >98%. CAS No. 223460-79-5. Molecular formula: C165H254N44O55S. Mole weight: 3766.1.
GLP-2(1-33)(human)
GLP-2(1-33) (human) is an enteroendocrine hormone which can bind to the GLP-2 receptor and stimulate the growth of intestinal epithelium. Uses: Scientific research. Group: Peptides. Alternative Names: GLP-2 (human); Glucagon-like peptide 2 (human). CAS No. 223460-79-5. Pack Sizes: 500 ?g; 1 mg; 5 mg. Product ID: HY-P1024.
GLP-2 (1-34) (human)
GLP-2 (1-34) (human) is a human-derived mimic of glucagon-like peptide 2 employed in studying gastrointestinal disorders such as short bowel syndrome (SBS). Synonyms: Preproglucagon (146-179) (human); H-His-Ala-Asp-Gly-Ser-Phe-Ser-Asp-Glu-Met-Asn-Thr-Ile-Leu-Asp-Asn-Leu-Ala-Ala-Arg-Asp-Phe-Ile-Asn-Trp-Leu-Ile-Gln-Thr-Lys-Ile-Thr-Asp-Arg-OH; L-histidyl-L-alanyl-L-alpha-aspartyl-glycyl-L-seryl-L-phenylalanyl-L-seryl-L-alpha-aspartyl-L-alpha-glutamyl-L-methionyl-L-asparagyl-L-threonyl-L-isoleucyl-L-leucyl-L-alpha-aspartyl-L-asparagyl-L-leucyl-L-alanyl-L-alanyl-L-arginyl-L-alpha-aspartyl-L-phenylalanyl-L-isoleucyl-L-asparagyl-L-tryptophyl-L-leucyl-L-isoleucyl-L-glutaminyl-L-threonyl-L-lysyl-L-isoleucyl-L-threonyl-L-alpha-aspartyl-L-arginine. Grade: 95%. CAS No. 99120-49-7. Molecular formula: C171H266N48O56S1. Mole weight: 3922.29.
GLP-2(3-33), generated naturally by dipeptidylpeptidase IV (DPPIV), acts as a partial agonist on GLP-2 receptor ( EC 50 =5.8 nM) [1] [2]. Uses: Scientific research. Group: Peptides. CAS No. 275801-62-2. Pack Sizes: 1 mg; 5 mg. Product ID: HY-P2625.
GLP-26
GLP-26 is an HBV capsid assembly modulator (CAM) that inhibits HBV DNA replication (IC50 = 3 nM) in Hep AD38 system and reduces cccDNA by >90% at 1 μM. GLP-26 disrupts pregenomic RNA encapsulation, leading to nucleocapsid disintegration and reduced cccDNA pools. Synonyms: N-(3,4-Difluorophenyl)-1,3,5-trimethyl-4-(2-oxo-2-(prop-2-yn-1-ylamino)acetyl)-1H-pyrrole-2-carboxamide; N-(3,4-Difluorophenyl)-1,3,5-trimethyl-4-[oxo(2-propyn-1-ylamino)acetyl]-1H-pyrrole-2-carboxamide; 1H-Pyrrole-3-acetamide, 5-[[(3,4-difluorophenyl)amino]carbonyl]-1,2,4-trimethyl-α-oxo-N-2-propyn-1-yl-. Grade: ≥98%. CAS No. 2133017-36-2. Molecular formula: C19H17F2N3O3. Mole weight: 373.35.
Glp-2(rat)
GLP-2(rat) is an intestinal growth factor. GLP-2(rat) stimulates cell proliferation and inhibits apoptosis. GLP-2(rat) enhances mucosal mass and function in residual small intestine after massive small bowel resection (MSBR). Uses: Designed for use in research and industrial production. Additional or Alternative Names: GLUCAGON-LIKE PEPTIDE 2 (RAT);GLUCAGON-LIKE PEPTIDE II RAT;GLP-2 (RAT);H-HIS-ALA-ASP-GLY-SER-PHE-SER-ASP-GLU-MET-ASN-THR-ILE-LEU-ASP-ASN-LEU-ALA-THR-ARG-ASP-PHE-ILE-ASN-TRP-LEU-ILE-GLN-THR-LYS-ILE-THR-ASP-OH;HADGSFSDEMNTILDNLATRDFINWLIQTKITD;PREPROGLUCAG. Product Category: Inhibitors. Appearance: Solid. CAS No. 195262-56-7. Molecular formula: C166H256N44O56S. Mole weight: 3796.14. Purity: 0.9804. Product ID: ACM195262567. Alfa Chemistry ISO 9001:2015 Certified.
GLP-2 (rat)
GLP-2 (rat) is an endogenous peptide that acts as an intestinal epithelium-specific growth factor. It stimulates cell proliferation and inhibits apoptosis, and also modulates intestinal glucose transport, food intake, and gastric acid secretion. Synonyms: Preproglucagon (146-178) (rat); H-His-Ala-Asp-Gly-Ser-Phe-Ser-Asp-Glu-Met-Asn-Thr-Ile-Leu-Asp-Asn-Leu-Ala-Thr-Arg-Asp-Phe-Ile-Asn-Trp-Leu-Ile-Gln-Thr-Lys-Ile-Thr-Asp-OH; Glucagon-like Peptide 2 (rat); L-histidyl-L-alanyl-L-alpha-aspartyl-glycyl-L-seryl-L-phenylalanyl-L-seryl-L-alpha-aspartyl-L-alpha-glutamyl-L-methionyl-L-asparagyl-L-threonyl-L-isoleucyl-L-leucyl-L-alpha-aspartyl-L-asparagyl-L-leucyl-L-alanyl-L-threonyl-L-arginyl-L-alpha-aspartyl-L-phenylalanyl-L-isoleucyl-L-asparagyl-L-tryptophyl-L-leucyl-L-isoleucyl-L-glutaminyl-L-threonyl-L-lysyl-L-isoleucyl-L-threonyl-L-aspartic acid. Grade: ≥95%. CAS No. 195262-56-7. Molecular formula: C166H256N44O56S. Mole weight: 3796.17.
GLP-2(rat)
GLP-2(rat) is an intestinal growth factor. GLP-2(rat) stimulates cell proliferation and inhibits apoptosis. GLP-2(rat) enhances mucosal mass and function in residual small intestine after massive small bowel resection (MSBR) [1] [2]. Uses: Scientific research. Group: Peptides. CAS No. 195262-56-7. Pack Sizes: 5 mg; 10 mg. Product ID: HY-P1142.
GLP-2 (rat) trifluoroacetate salt
GLP-2 is a gut peptide hormone that is primarily produced by enteroendocrine L cells of the small and large intestine. GLP-2 is an antagonist of the GLP-2 receptor (GLP-2R; Ki = 60 pM). Synonyms: Glucagon-like Peptide 2. Grade: ≥95%. Molecular formula: C166H256N44O56S·xCF3COOH. Mole weight: 3796.14.
GLPG0187
GLPG0187 is a broad spectrum integrin receptor antagonist with antitumor activity; inhibits ?v?1-integrin with an IC50 of 1.3 nM[1]. GLPG0187 inhibits migrasome biogenesis without cytotoxicity[3]. Uses: Scientific research. Group: Signaling pathways. CAS No. 1320346-97-1. Pack Sizes: 10 mM * 1 mL; 1 mg; 5 mg; 10 mg; 25 mg; 50 mg; 100 mg. Product ID: HY-100506.
GLPG-0187
GLPG-0187 is a small molecule integrin receptor antagonist (IRA) with nanomolar affinity for the RGD-integrin receptors αvβ1, αvβ3, αvβ5, αvβ6 and α5β1 (IC50s = 1.2-3.7 nM). Integrin receptors are expressed on the surface of tumor vessel endothelial cells and some types of cancer cells, and play a crucial role in endothelial cell adhesion and migration. This compound shows an inhibitory activity of angiogenesis, bone-resorption and tumor, which is hopefully used as an anticancer drug. Uses: An integrin receptor antagonist (ira) can be used as an anticancer drug. Synonyms: GLPG0187; GLPG 0187; GLPG-0187; UNII-43A5P87Z4T; 43A5P87Z4T; SCHEMBL2372722; CHEMBL3319236; (2S)-3-[[2,5-dimethyl-6-[4-(5,6,7,8-tetrahydro-1,8-naphthyridin-2-yl)piperidin-1-yl]pyrimidin-4-yl]amino]-2-[(4-methoxyphenyl)sulfonylamino]propanoic acid. Grade: ≥98 %. CAS No. 1320346-97-1. Molecular formula: C29H37N7O5S. Mole weight: 595.719.
GLPG0492
GLPG0492, a selective androgen receptor modulator, could be effective in decreasing muscle loss. The treatment study against Duchenne muscular dystrophy of it has alreadt been discontinued. Uses: Glpg0492 is a selective androgen receptor modulator that could be effective in decreasing muscle loss. Synonyms: DT-200; DT 200; DT200; GLPG0492; SCHEMBL2021011; CHEMBL2178100; GLPG 0492; GLPG-0492; VAJGULUVTFDTAS-GOSISDBHSA-N. Grade: 98%. CAS No. 1215085-92-9. Molecular formula: C19H14F3N3O3. Mole weight: 389.33.
GLPG0492 R enantiomer
The R-enantiomer of GLPG0492 which is a selective androgen receptor modulator, could be effective in decreasing muscle loss. Uses: The r-enantiomer of glpg0492 which is a selective androgen receptor modulator that could be effective in decreasing muscle loss. Synonyms: GLPG-0492 R enantiomer; GLPG 0492 R enantiomer; GLPG0492 R enantiomer. Grade: 98%. CAS No. 1215085-93-0. Molecular formula: C19H14F3N3O3. Mole weight: 389.33.
GLPG0634 analog
GLPG0634 analog (Compoun 176) is a broad spectrum JAK inhibitor with IC 50 values of <100 nM against JAK1, JAK2 and JAK3 [1]. Uses: Scientific research. Group: Signaling pathways. CAS No. 1206101-20-3. Pack Sizes: 10 mM * 1 mL; 5 mg; 10 mg; 50 mg. Product ID: HY-13961.
GLPG0634 analogue
A potent and selective JAK1 inhibitor with IC50 values of 10, 28, 810, and 116 nM for JAK1, JAK2, JAK3, and TYK2, respectively. Synonyms: GLPG0634 analog; N-[5-[4-[(6-cyanopyridin-3-yl)methoxy]phenyl]-[1,2,4]triazolo[1,5-a]pyridin-2-yl]cyclopropanecarboxamide. Grade: >98%. CAS No. 1206101-20-3. Molecular formula: C23H18N6O2. Mole weight: 410.43.
GLPG0974
GLPG0974 is a free fatty acid receptor-2 (FFA2/GPR43) antagonist with an IC50 of 9 nM. Uses: Scientific research. Group: Signaling pathways. CAS No. 1391076-61-1. Pack Sizes: 10 mM * 1 mL; 5 mg; 10 mg; 25 mg; 50 mg; 100 mg. Product ID: HY-12940.
GLPG 0974
GLPG 0974 is a potent FFA2 antagonist (IC50 = 9 nM) with selectivity for FFA2 over FFA3. It was shown that GLPG 0974 inhibited acetate-induced human neutrophil migration in plasma or buffer, and also suppressed FFA2-induced expression of CD11b activation-specific epitope (AE) in human whole blood. Synonyms: GLPG0974; GLPG 0974; GLPG-0974. 4-[[[(2R)-1-(Benzo[b]thien-3-ylcarbonyl)-2-methyl-2-azetidinyl]carbonyl][(3-chlorophenyl)methyl]amino]butanoic acid. Grade: ≥98% by HPLC. CAS No. 1391076-61-1. Molecular formula: C25H25ClN2O4S. Mole weight: 485.
GLPG1205
GLPG1205 is potent, selective and orally active GPR84 (a G-protein-coupled receptor) antagonist with a favorable PK/PD profile. GLPG1205 has anti-inflammatory activity and is used for the treatment of pulmonary fibrosis[1][2]. GLPG1205 is a click chemistry reagent, it contains an Alkyne group and can undergo copper-catalyzed azide-alkyne cycloaddition (CuAAc) with molecules containing Azide groups. Uses: Scientific research. Group: Signaling pathways. CAS No. 1445847-37-9. Pack Sizes: 10 mM * 1 mL; 5 mg; 10 mg; 25 mg; 50 mg; 100 mg. Product ID: HY-135303.
GLPG-1690
GLPG-1690, an imidazopyridine derivative, has been found to be a selective autotaxin inhibitor that could probably be effective as an anti-inflammatory agent and is under Phase II trial against Idiopathic pulmonary fibrosis (IPF). Synonyms: Ziritaxestat; GLPG 1690; GLPG1690; 2-((2-ethyl-6-(4-(2-(3-hydroxyazetidin-1-yl)-2-oxoethyl)piperazin-1-yl)-8-methylimidazo[1,2-a]pyridin-3-yl)(methyl)amino)-4-(4-fluorophenyl)thiazole-5-carbonitrile. Grade: >98%. CAS No. 1628260-79-6. Molecular formula: C30H33FN8O2S. Mole weight: 588.71.
GLPG1837
GLPG1837 is a potent, orally available potentiator of cystic fibrosis transmembrane conductance regulator (CFTR) with EC50 of 3 nM and 339 nM on F508del and G551D CFTR, respectively. Synonyms: ABBV-974; N-[3-(aminocarbonyl)-4,7-dihydro-5,5,7,7-tetramethyl-5H-thieno[2,3-c]pyran-2-yl]-1H-pyrazole-3-carboxamide. Grade: ≥98%. CAS No. 1654725-02-6. Molecular formula: C16H20N4O3S. Mole weight: 348.42.
GLPG2938
GLPG2938 is a potent and selective S1P2 antagonist that can be used for the study of idiopathic pulmonary fibrosis. It inhibits S1P-induced calcium flux in CHO cells overexpressing human S1P2 (IC50 = 8.8 nM), inhibits S1P-induced IL-8 release in HFL1 cells (IC50 = 0.6 nM) and S1P-induced contraction of human lung fibroblasts. Synonyms: 1-(2-Ethoxy-6-(trifluoromethyl)pyridin-4-yl)-3-((5-methyl-6-(1-methyl-3-(trifluoromethyl)-1H-pyrazol-4-yl)pyridazin-3-yl)methyl)urea; MUN96006; 1-[2-Ethoxy-6-(trifluoromethyl)-4-pyridinyl]-3-({5-methyl-6-[1-methyl-3-(trifluoromethyl)-1H-pyrazol-4-yl]-3-pyridazinyl}methyl)urea; Urea, N-[2-ethoxy-6-(trifluoromethyl)-4-pyridinyl]-N'-[[5-methyl-6-[1-methyl-3-(trifluoromethyl)-1H-pyrazol-4-yl]-3-pyridazinyl]methyl]-. Grade: ≥98%. CAS No. 2130996-00-6. Molecular formula: C20H19F6N7O2. Mole weight: 503.40.
GLPG2938
GLPG2938 is an antagonists of sphingosine-1-phosphate (S1P) receptor for prophylaxis and?/or treatment of diseases including fibrotic, inflammatory, autoimmune, metabolic, cardiovascular, and?/or proliferative diseases. GLPG2938 displayed S1P inhibitory activity.with EC50 value of 9.5 nM (S1P2 antagonist EC50)?. Uses: Designed for use in research and industrial production. Additional or Alternative Names: MUN96006; MUN-96006; MUN 96006; GLPG2938; GLPG-2938; GLPG 2938. Product Category: Antagonists. Appearance: Solid powder. CAS No. 2130996-00-6. Molecular formula: C20H19F6N7O2. Mole weight: 503.41. Purity: >98%. IUPACName: 1-(2-ethoxy-6-(trifluoromethyl)pyridin-4-yl)-3-((5-methyl-6-(1-methyl-3-(trifluoromethyl)-1H-pyrazol-4-yl)pyridazin-3-yl)methyl)urea. Canonical SMILES: O=C(NCC1=NN=C(C2=CN(C)N=C2C(F)(F)F)C(C)=C1)NC3=CC(OCC)=NC(C(F)(F)F)=C3. Product ID: ACM2130996006. Alfa Chemistry ISO 9001:2015 Certified.
GLPG2938
GLPG2938 is a potent and selective S1P2 antagonist. GLPG2938 can be used for the research of idiopathic pulmonary fibrosis[1]. Uses: Scientific research. Group: Signaling pathways. CAS No. 2130996-00-6. Pack Sizes: 10 mM * 1 mL; 1 mg; 5 mg; 10 mg; 25 mg; 50 mg; 100 mg. Product ID: HY-139310.
GLPG3312
GLPG3312 (Compound 28) is an orally active SIK inhibitor with IC50 values of 2.0 nM, 0.7 nM and 0.6 nM for SIK1, SIK2 and SIK3, respectively. GLPG3312 exhibits anti-inflammatory and immunomodulatory activity in vitro on human primary myeloid cells and in vivo in mouse models. GLPG3312 has good oral bioavailability and can be used for research on inflammatory and immune diseases[1]. Uses: Scientific research. Group: Signaling pathways. CAS No. 2340388-72-7. Pack Sizes: 1 mg; 5 mg; 10 mg; 25 mg; 50 mg; 100 mg. Product ID: HY-157442.
GLPG3667
GLPG3667 is a reversible, ATP-competitive and orally active TYK2 inhibitor with an IC 50 of 2.3 nM. GLPG3667 inhibits IFNα/pSTAT1, and the IC 50 values ??in human peripheral blood mononuclear cell (PBMC) and whole blood assays are 70 nM and 623 nM, respectively. GLPG3667 has the potential for the study of inflammatory and autoimmune diseases [1]. Uses: Scientific research. Group: Signaling pathways. CAS No. 2308520-97-8. Pack Sizes: 1 mg; 5 mg; 10 mg; 25 mg; 50 mg; 100 mg. Product ID: HY-156961.
GLPG3970
GLPG3970 (compound 88) is a first-in-class SIK2/SIK3 inhibitor. GLPG3970 can be used for the research of inflammation and autoimmune disease[1]. Uses: Scientific research. Group: Signaling pathways. CAS No. 2403733-82-2. Pack Sizes: 10 mM * 1 mL; 5 mg; 10 mg; 25 mg; 50 mg; 100 mg; 250 mg; 500 mg; 1 g. Product ID: HY-150203.
GLS1 Inhibitor-1
GLS1 Inhibitor-1 (Compound 27) is an orally active inhibitor for glutaminase 1 ( GLS1 ) with an IC 50 of 0.021 μM. GLS1 Inhibitor-1 inhibits the proliferation of PC-3 with an IC 50 of 0.3 nM. GLS1 Inhibitor-1 exhibits antitumor efficacy against NCI-H1703 with GI 50 of 0.011 μM. GLS1 Inhibitor-1 exhibits moderate pharmacokinetic characteristics [1]. Uses: Scientific research. Group: Signaling pathways. CAS No. 1832646-52-2. Pack Sizes: 5 mg; 10 mg. Product ID: HY-136704.
Glu13, Exendin-4
Glu13, Exendin-4 is an impurity and degradation product of exenatide. Synonyms: His-Gly-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Leu-Ser-Lys-Glu-Met-Glu-Glu-Glu-Ala-Val-Arg-Leu-Phe-Ile-Glu-Trp-Leu-Lys-Asn-Gly-Gly-Pro-Ser-Ser-Gly-Ala-Pro-Pro-Pro-Ser-NH2. Molecular formula: C184H281N49O61S. Mole weight: 4187.81.
Glu-14-Calcitonin
Glu-14-Calcitonin is an impurity of Calcitonin salmon, which is a calcium regulating hormone used to be an effective alternative for the treatment of postmenopausal osteoporosis. Synonyms: H-Cys-Ser-Asn-Leu-Ser-Thr-Cys-Val-Leu-Gly-Lys-Leu-Ser-Glu-Glu-Leu-His-Lys-Leu-Gln-Thr-Tyr-Pro-Arg-Thr-Asn-Thr-Gly-Ser-Gly-Thr-Pro-NH2 (Disulfide bond between Cys1 and Cys7); L-cysteinyl-L-seryl-L-asparagyl-L-leucyl-L-seryl-L-threonyl-L-cysteinyl-L-valyl-L-leucyl-glycyl-L-lysyl-L-leucyl-L-seryl-L-alpha-glutamyl-L-alpha-glutamyl-L-leucyl-L-histidyl-L-lysyl-L-leucyl-L-glutaminyl-L-threonyl-L-tyrosyl-L-prolyl-L-arginyl-L-threonyl-L-asparagyl-L-threonyl-glycyl-L-seryl-glycyl-L-threonyl-L-prolinamide (1->7)-disulfide; RPR 108969; Calcitonin (salmon), 14-L-glutamic acid-. CAS No. 187476-38-6. Molecular formula: C145H239N43O49S2. Mole weight: 3432.88.
Glu-20-Calcitonin
Glu-20-Calcitonin is an impurity of Calcitonin salmon, which is a calcium regulating hormone used to be an effective alternative for the treatment of postmenopausal osteoporosis. Synonyms: H-Cys-Ser-Asn-Leu-Ser-Thr-Cys-Val-Leu-Gly-Lys-Leu-Ser-Gln-Glu-Leu-His-Lys-Leu-Glu-Thr-Tyr-Pro-Arg-Thr-Asn-Thr-Gly-Ser-Gly-Thr-Pro-NH2 (Disulfide bond between Cys1 and Cys7); L-cysteinyl-L-seryl-L-asparagyl-L-leucyl-L-seryl-L-threonyl-L-cysteinyl-L-valyl-L-leucyl-glycyl-L-lysyl-L-leucyl-L-seryl-L-glutaminyl-L-alpha-glutamyl-L-leucyl-L-histidyl-L-lysyl-L-leucyl-L-alpha-glutamyl-L-threonyl-L-tyrosyl-L-prolyl-L-arginyl-L-threonyl-L-asparagyl-L-threonyl-glycyl-L-seryl-glycyl-L-threonyl-L-prolinamide (1->7)-disulfide; RPR 108970; Calcitonin (salmon), 20-L-glutamic acid-. CAS No. 187476-39-7. Molecular formula: C145H239N43O49S2. Mole weight: 3432.88.
Glu4,Asp5,Gly9-Oxytocin
Glu4,Asp5,Gly9-Oxytocin is a modified analog of oxytocin with specific amino acid substitutions and modifications. Oxytocin is a peptide hormone and neuropeptide that plays crucial roles in various physiological processes. Oxytocin is best known for its functions in childbirth and lactation, where it helps to stimulate uterine contractions during labor and milk ejection during breastfeeding. Synonyms: Cys-Tyr-Ile-Glu-Asp-Cys-Pro-Leu-Gly(Cys1&Cys6 bridge); Glu4,Asp5,Gly9-OH-Oxytocin; 4-Glu-5-Asp-9-Gly-OH-oxytocin; L-Cysteinyl-L-tyrosyl-L-isoleucyl-L-alpha-glutamyl-L-alpha-aspartyl-L-cysteinyl-L-prolyl-L-leucyl-glycine (1->6)-disulfide; Oxytocin, 4-glutamic acid-5-aspartic acid-9-glycine; 3-((4R,7S,10S,13S,16S,19R)-19-Amino-13-((S)-sec-butyl)-7-(carboxymethyl)-4-((S)-2-(((S)-1-((carboxymethyl)amino)-4-methyl-1-oxopentan-2-yl)carbamoyl)pyrrolidine-1-carbonyl)-16-(4-hydroxybenzyl)-6,9,12,15,18-pentaoxo-1,2-dithia-5,8,11,14,17-pentaazacycloicosan-10-yl)propanoic acid; [Glu4,Asp5,Gly9]-Oxytocin. Grade: >95%. Molecular formula: C43H63N9O15S2. Mole weight: 1010.15.
Glu4,Asp5-Oxytocin
Glu4,Asp5-Oxytocin is a modified analog of oxytocin where the amino acids at positions 4 and 5 are altered. Specifically, glutamic acid (Glu) is introduced at position 4, and aspartic acid (Asp) is introduced at position 5. These modifications can significantly influence the biological activity and pharmacological properties of the peptide. Synonyms: Cys-Tyr-Ile-Glu-Asp-Cys-Pro-Leu-Gly-NH2(Cys1&Cys6 bridge); 4-Glu-5-Asp-oxytocin; L-Cysteinyl-L-tyrosyl-L-isoleucyl-L-alpha-glutamyl-L-alpha-aspartyl-L-cysteinyl-L-prolyl-L-leucyl-glycinamide (1->6)-disulfide; 3-((4R,7S,10S,13S,16S,19R)-19-Amino-4-((S)-2-(((S)-1-((2-amino-2-oxoethyl)amino)-4-methyl-1-oxopentan-2-yl)carbamoyl)pyrrolidine-1-carbonyl)-13-((S)-sec-butyl)-7-(carboxymethyl)-16-(4-hydroxybenzyl)-6,9,12,15,18-pentaoxo-1,2-dithia-5,8,11,14,17-pentaazacycloicosan-10-yl)propanoic acid; Oxytocin [4-Glu,5-Asp]; [Glu4,Asp5]-Oxytocin; Oxytocin Impurity 18. Grade: >95%. CAS No. 2092497-01-1. Molecular formula: C43H64N10O14S2. Mole weight: 1009.16.
Glu(4)-AVP
Glu4-AVP is an impurity of Vasopressin, which is an antidiuretic hormone secreted from the posterior pituitary. Synonyms: Glu(4)-Arg-Vasopressin; Glu(4)-Vasopressin; Glu4-AVP; H-Cys-Tyr-Phe-Glu-Asn-Cys-Pro-Arg-Gly-NH2 (Disulfide bridge: Cys1-Cys6); L-cysteinyl-L-tyrosyl-L-phenylalanyl-L-glutamyl-L-asparagyl-L-cysteinyl-L-prolyl-L-arginyl-glycinamide (1->6)-disulfide. CAS No. 2075712-12-6. Molecular formula: C46H64N14O13S2. Mole weight: 1085.22.
Glu4-Carbetocin
An impurity of Carbetocin. Carbetocin is a long-acting analogue of the hormone oxytocin, used primarily to control postpartum hemorrhage and to induce uterine contractions. Synonyms: cyclo(Butyryl-Tyr(Me)-Ile-Glu-Asn-Cys)-Pro-Leu-Gly-NH2; Glu3-Carbetocin; Glu(4)-Carbetocin; [Glu4]-Carbetocin; [L-Glu4]-Carbetocin; Carbetocin Impurity 3; [Glu4] Carbetocin; Carbetocin Glu impurity; 1-Carbaoxytocin, 1-butanoic acid-2-(O-methyl-L-tyrosine)-4-L-glutamic acid-; But-Tyr(Me)-Ile-Glu-Asn-Cys-Pro-Leu-Gly-NH2 (Thioether bridge: But1-Cys6); Butyryl-O-methyl-L-tyrosyl-L-isoleucyl-L-alpha-glutamyl-L-asparagyl-L-cysteinyl-L-prolyl-L-leucyl-glycinamide (1->6)-thioether. Grade: ≥95%. CAS No. 69228-04-2. Molecular formula: C45H68N10O13S. Mole weight: 989.15.
Glu 4-Oxytocin
Glu 4-Oxytocin is an impurity of Oxytocin, which is a mammalian neurohypophysial hormone used as a vasodilator agent. Synonyms: [4-Glutamic acid]oxytocin; L-Cystyl-L-tyrosyl-L-isoleucyl-L-glutamyl-L-asparginyl-L-cystyl-L-leucyl-L-prolyl-L-glycinamide (disulfide bridge between cysteines); H-Cys-Tyr-Ile-Glu-Asn-Cys-Pro-Leu-Gly-NH2 (Disulfide bridge: Cys1-Cys6); [Glu4]-Oxytocin; L-Cysteinyl-L-tyrosyl-L-isoleucyl-L-alpha-glutamyl-L-asparagyl-L-cysteinyl-L-prolyl-L-leucyl-glycinamide (1->6)-disulfide; Oxytocin, 4-L-glutamic acid-; Oxytocin, 4-glutamic acid; 4-L-glutamic acid-Oxytocin; Oxytocin EP Impurity C; Glu4-Oxytocin; Cys-Tyr-Ile-Glu-Asn-Cys-Pro-Leu-Gly-NH2(Cys1&Cys6 bridge); CYIENCPLG-NH2(Cys1&Cys6 bridge). Grade: ≥95%. CAS No. 4314-67-4. Molecular formula: C43H65N11O13S2. Mole weight: 1008.18.
Glu7,Gly12-Terlipressin
An impurity of Terlipressin. Terlipressin is a synthetic vasopressin analogue primarily used to improve kidney function in adults with hepatorenal syndrome (HRS), a condition that causes kidney problems in individuals with severe liver disease. It acts as a vasoconstrictor, predominantly in the splanchnic circulation, which helps increase arterial pressure and reduce portal venous pressure. Synonyms: Gly-Gly-Gly-Cys-Tyr-Phe-Glu-Asn-Cys-Pro-Lys-Gly(Cys4&Cys9 bridge); [7-L-glutamic acid,12-glycine]terlipressin; Terlipressin EP Impurity K; GGGCYFENCPKG(Cys4&Cys9 bridge); H-Gly-Gly-Gly-Cys-Tyr-Phe-Glu-Asn-Cys-Pro-Lys-Gly-OH (Disulfide bridge: Cys4-Cys9); Glycyl-glycyl-glycyl-L-cysteinyl-L-tyrosyl-L-phenylalanyl-L-α-glutamyl-L-asparagyl-L-cysteinyl-L-prolyl-L-lysyl-glycine (4->9)-disulfide; [Glu(7), Gly(12)]-Terlipressin [Glu(7)-TLY-COOH]; [Glu7, Gly12]-Terlipressin. Grade: ≥95%. Molecular formula: C52H72N14O17S2. Mole weight: 1229.35.
Glu7-Terlipressin
An impurity of Terlipressin. Terlipressin is a synthetic vasopressin analogue primarily used to improve kidney function in adults with hepatorenal syndrome (HRS), a condition that causes kidney problems in individuals with severe liver disease. It acts as a vasoconstrictor, predominantly in the splanchnic circulation, which helps increase arterial pressure and reduce portal venous pressure. Synonyms: Gly-Gly-Gly-Cys-Tyr-Phe-Glu-Asn-Cys-Pro-Lys-Gly-NH2(Cys4&Cys9 bridge); [7-L-glutamic acid]terlipressin; Terlipressin EP Impurity F; [8-L-α-aspartic acid]terlipressin; H-Gly-Gly-Gly-Cys-Tyr-Phe-Glu-Asn-Cys-Pro-Lys-Gly-NH2 (Disulfide bridge: Cys4-Cys9); Glycyl-glycyl-glycyl-L-cysteinyl-L-tyrosyl-L-phenylalanyl-L-α-glutamyl-L-asparagyl-L-cysteinyl-L-prolyl-L-lysyl-glycinamide (4->9)-disulfide; Glu(7)-Terlipressin; [Glu7]-Terlipressin; GGGCYFENCPKG-NH2(Cys4&Cys9 bridge). Grade: ≥95%. Molecular formula: C52H73N15O16S2. Mole weight: 1228.37.
Glu-Asp-OH
Glu-Asp-OH is a dipeptide used as a diagnostic indicator of the disease. Synonyms: L-α-Glutamyl-L-aspartic acid; Vesilute; (S)-2-((S)-2-Amino-4-carboxybutanamido)succinic acid. Grade: ≥ 98% (TLC). CAS No. 3918-84-1. Molecular formula: C9H14N2O7. Mole weight: 262.22.
Glu-Asp-OH 98+% (TLC)
Glu-Asp-OH 98+% (TLC). Group: Biochemicals. Grades: Reagent Grade. Pack Sizes: 250mg, 1g, 2.5g. US Biological Life Sciences.
Worldwide
Glubionate Calcium
Glubionate Calcium is a mineral supplement. It can be used to prevent or treat low blood calcium levels. Synonyms: Calcium glubionate; Neocalglucon; Calcium, (4-O-β-D-galactopyranosyl-D-gluconato)(D-gluconato)-, monohydrate; D-Gluconic acid, 4-O-β-D-galactopyranosyl-, calcium complex; D-Gluconic acid, calcium complex; Calcium glucono-galacto-gluconate; Calcium gluconolactobionate; Gluconogalactogluconic acid, calcium salt; Hi-Glucon; Neo-Calglucon. CAS No. 12569-38-9. Molecular formula: C18H32CaO19.H2O. Mole weight: 610.53.
Glucagon (1-29), bovine, human
Glucagon (1-29), bovine, human, porcine is a peptide hormone, produced by pancreatic α-cells. Glucagon stimulates gluconeogenesis [1]. Glucagon (1-29), bovine, human, porcine activates HNF4α and increases HNF4α phosphorylation [2] [3]. Uses: Scientific research. Group: Peptides. Alternative Names: Glucagon. CAS No. 16941-32-5. Pack Sizes: 1 mg; 5 mg; 10 mg; 25 mg; 50 mg. Product ID: HY-P0082.
Glucagon (1-29), bovine, human hydrochloride
Glucagon (1-29), bovine, human, porcine hydrochloride is a peptide hormone, produced by pancreatic α-cells. Glucagon hydrochloride stimulates gluconeogenesis [1]. Glucagon (1-29), bovine, human, porcine hydrochloride activates HNF4α and increases HNF4α phosphorylation [2] [3]. Uses: Scientific research. Group: Peptides. Alternative Names: Glucagon hydrochloride. CAS No. 28270-04-4. Pack Sizes: 1 mg; 5 mg; 10 mg. Product ID: HY-P0082A.
Glucagon (19-29), human acetate
Glucagon (19-29), human acetate, a COOH-terminal fragment processed from glucagon, is a potent and efficient inhibitor of insulin secretion. Molecular formula: C63H93N15O20S. Mole weight: 1412.57.
Glucagon (19-29) (human, rat, porcine)
Glucagon is an endogenous short peptide. Synonyms: Miniglucagon (human, rat, porcine). Grade: >95%. CAS No. 64790-15-4. Molecular formula: C61H89N15O18S. Mole weight: 1352.5.
Glucagon arbitrary peak I
Glucagon arbitrary peak I is a derivative of Glucagon, a peptide hormone produced by alpha cells of the pancreas that regulates the blood glucose levels in human body.
Glucagon arbitrary peak II
Glucagon arbitrary peak II is a derivative of Glucagon, a peptide hormone produced by alpha cells of the pancreas that regulates the blood glucose levels in human body.
Glucagon arbitrary peak III
Glucagon arbitrary peak III is a derivative of Glucagon, a peptide hormone produced by alpha cells of the pancreas that regulates the blood glucose levels in human body.
Glucagon arbitrary peak IV
Glucagon arbitrary peak IV is a derivative of Glucagon, a peptide hormone produced by alpha cells of the pancreas that regulates the blood glucose levels in human body. Synonyms: H-Ser-Arg-Arg-Ala-Gln-Asp-Phe-Val-Glu-Trp-Leu-Met-Asn-Thr-OH; (2S,5S,8S,11S,14S,17S,20S,23S,26S)-14-((1H-indol-3-yl)methyl)-5-(2-amino-2-oxoethyl)-26-((6S,9S,12S,15S)-1-amino-6-((S)-2-amino-3-hydroxypropanamido)-15-(3-amino-3-oxopropyl)-9-(3-guanidinopropyl)-1-imino-12-methyl-7,10,13-trioxo-2,8,11,14-tetraazahexadecanamido)-23-benzyl-17-(2-carboxyethyl)-2-((R)-1-hydroxyethyl)-11-isobutyl-20-isopropyl-8-(2-(methylthio)ethyl)-4,7,10,13,16,19,22,25-octaoxo-3,6,9,12,15,18,21,24-octaazaoctacosane-1,28-dioic acid. Molecular formula: C76H117N23O23S. Mole weight: 1752.95.
Glucagon arbitrary Peak IX
Glucagon arbitrary Peak IX is a derivative of Glucagon, a peptide hormone produced by alpha cells of the pancreas that regulates the blood glucose levels in human body. Synonyms: H-His-Ser-Glu-Gly-Thr-Phe-Thr-Ser-Asp-OH. Molecular formula: C40H57N11O18. Mole weight: 979.94.
Glucagon arbitrary peak V
Glucagon arbitrary peak V is a derivative of Glucagon, a peptide hormone produced by alpha cells of the pancreas that regulates the blood glucose levels in human body. Synonyms: H-Tyr-Ser-Lys-Tyr-Leu-Asp-Ser-Arg-Arg-Ala-Gln-Asp-Phe-Val-Gln-Trp-Leu-Met-Asn-Thr-OH. Molecular formula: C113H169N31O33S. Mole weight: 2521.80.
Glucagon arbitrary peak VI
Glucagon arbitrary peak VI is a derivative of Glucagon, a peptide hormone produced by alpha cells of the pancreas that regulates the blood glucose levels in human body.