American Chemical Suppliers

A directory of where to buy chemicals in the USA, including: distributors, industrial manufacturers, bulk supplies and wholesalers of raw ingredients & finished goods.

Search for products or services, then visit the suppliers website for prices or more information.

Product
GlowDot GlowDot. Uses: Cell imaging, ph sensing, fluorescence, drug delivery and etc. Group: other quantum dots. Alfa Chemistry Materials 3
Gloxazone Gloxazone is an effective anaplasmacide. Uses: Designed for use in research and industrial production. Additional or Alternative Names: Contrapar, Gloxazon, GLOXAZONE, KTS, pharmaceutical, Kethoxal bis(thiosemicarbazone), NSC82116, AIDS125723, AIDS-125723, BW 356C61, CID9571200, KC 1331, WR 9838, (1-Ethoxyethyl)glyoxal bis(thiosemicarbazone). alpha.-Ethoxyethylglyoxal dithiosemicarbazone, 3-Ethoxy-2-oxobutyraldehyde bis(thiosemicarbazone), Butyraldehyde, 3-ethoxy-2-oxo-, bis(thiosemicarbazone), 2-((Aminocarbothioyl)hydrazono)-3-ethoxybutanal thiosemicarbazone, Butyraldehyde, 3-ethoxy-2-oxo-, bis(thiosemicarbazone, hemihydrate, 2507-91-7, Hydrazinecarbothioamide, 2, {2-[1-(1-ethoxyethyl)-1,2-ethanediylidene]bis-}. Product Category: Inhibitors. Appearance: Solid. CAS No. 2507-91-7. Molecular formula: C8H16N6OS2. Mole weight: 276.38. Purity: 0.96. IUPACName: [(E)-[(1E)-1-(carbamothioylhydrazinylidene)-3-ethoxybutan-2-ylidene]amino]thiourea. Canonical SMILES: CC(C(/C=N/NC(N)=S)=N\NC(N)=S)OCC. Density: 1.41g/cm³. Product ID: ACM2507917. Alfa Chemistry — ISO 9001:2015 Certified. Alfa Chemistry.
GLP-1 Glucagon-like peptide-1 (GLP-1) is a potent insulin secretagogue that has multiple synergetic effects on the glucose-dependent insulin secretion pathways of the beta-cell. Synonyms: Glucagon-like peptide 1. CAS No. 89750-14-1. Molecular formula: C149H226N40O45. Mole weight: 3297.7. BOC Sciences 10
Glp-1(1-36)amide(human,bovine,guinea pig,mouse,rat) Glp-1(1-36)amide(human,bovine,guinea pig,mouse,rat). Uses: Designed for use in research and industrial production. Additional or Alternative Names: GLP-1 (1-36) amide (human, bovine, guinea pig, mouse, rat);Glucagon-like peptide 1 amide. Product Category: Heterocyclic Organic Compound. CAS No. 99658-04-5. Molecular formula: C184H273N51O57. Mole weight: 4111.44. Purity: 0.96. Product ID: ACM99658045. Alfa Chemistry — ISO 9001:2015 Certified. Alfa Chemistry. 4
GLP-1 (1-36) amide (human, bovine, guinea pig, mouse, rat) GLP-1 (1-36) amide is a promising peptide hormone unlocking avenues for type 2 diabetes mellitus research. Its extraordinary resemblance to the native GLP-1 facilitates heightened glucose-dependent insulin secretion. Synonyms: Preproglucagon (92-127) amide (human, bovine, guinea pig, mouse, rat); Glucagon-like peptide 1 (1-36) amide (human, bovine, guinea pig, mouse, rat); H-His-Asp-Glu-Phe-Glu-Arg-His-Ala-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Val-Ser-Ser-Tyr-Leu-Glu-Gly-Gln-Ala-Ala-Lys-Glu-Phe-Ile-Ala-Trp-Leu-Val-Lys-Gly-Arg-NH2; L-histidyl-L-alpha-aspartyl-L-alpha-glutamyl-L-phenylalanyl-L-alpha-glutamyl-L-arginyl-L-histidyl-L-alanyl-L-alpha-glutamyl-glycyl-L-threonyl-L-phenylalanyl-L-threonyl-L-seryl-L-alpha-aspartyl-L-valyl-L-seryl-L-seryl-L-tyrosyl-L-leucyl-L-alpha-glutamyl-glycyl-L-glutaminyl-L-alanyl-L-alanyl-L-lysyl-L-alpha-glutamyl-L-phenylalanyl-L-isoleucyl-L-alanyl-L-tryptophyl-L-leucyl-L-valyl-L-lysyl-glycyl-L-argininamide. Grade: ≥95%. CAS No. 99658-04-5. Molecular formula: C184H273N51O57. Mole weight: 4111.44. BOC Sciences
GLP-1 (25-37), human GLP-1 is a potent insulin secretagogue that has multiple synergetic effects on the glucose-dependent insulin secretion pathways of the beta-cell. Synonyms: Ala-Lys-Glu-Phe-Ile-Ala-Trp-Leu-Val-Lys-Gly-Arg-Gly. Molecular formula: C70H111N19O16. Mole weight: 1474.84. BOC Sciences 10
GLP-1(28-36)amide acetate GLP-1(28-36)amide acetate inhibits mitochondrial permeability transition with antioxidant, anti-diabetic and cardioprotection activities. Molecular formula: C56H89N15O11. Mole weight: 1148.40. BOC Sciences 8
GLP-1(32-36)amide GLP-1(32-36)amide, a pentapeptide, derived from the C terminus of the glucoregulatory hormone GLP-1. GLP-1(32-36)amide could inhibit weight gain and modulate whole body glucose metabolism in diabetic mice [1] [2]. Uses: Scientific research. Group: Peptides. CAS No. 1417302-71-6. Pack Sizes: 5 mg; 10 mg. Product ID: HY-P3102. MedChemExpress MCE
GLP-1 (7-36) Acetate GLP-1 (7-36) is an intestinal hormone that stimulates glucose-induced β cells to secrete insulin. Synonyms: Human GLP-1-(7-36)-amide Acetate. Grade: >98%. CAS No. 1119517-19-9. Molecular formula: C149H226N40O45.xC2H4O2. Mole weight: 3394.67. BOC Sciences 10
GLP-1(7-36) amide GLP-1(7-36) amide is a glucose-dependent insulinotropic peptide displaying high affinity for GLP-1 receptors expressed in rat insulinoma-derived RINm5F cells (Kd = 204 pM). GLP-1 (7-36) amide exhibits antiapoptotic effects in hippocampal neurons and reduces food intake in fasted rats following central administration. Synonyms: GLP-1; GLP-1 (7-36) amide; Insulinotropin. Grade: 98%. CAS No. 107444-51-9. Molecular formula: C149H226N40O45. Mole weight: 3297.67. BOC Sciences
GLP-1(7-36), amide GLP-1(7-36), amide is a physiological incretin hormone that stimulates insulin secretion. Uses: Scientific research. Group: Peptides. Alternative Names: Glucagon-like peptide-1 (GLP-1)(7-36), amide; Human GLP-1 (7-36), amide. CAS No. 107444-51-9. Pack Sizes: 1 mg. Product ID: HY-P0054A. MedChemExpress MCE
GLP-1(7-36), amide acetate GLP-1(7-36), amide acetate is a major intestinal hormone that stimulates glucose-induced insulin secretion from β cells. Uses: Scientific research. Group: Peptides. Alternative Names: Glucagon-like peptide-1 (GLP-1)(7-36), amide acetate; Human GLP-1 (7-36), amide acetate. CAS No. 1119517-19-9. Pack Sizes: 500 μg; 1 mg; 5 mg; 10 mg. Product ID: HY-P0054. MedChemExpress MCE
GLP-1 (7-36) amide (chicken, common turkey) GLP-1 (7-36) amide (chicken, common turkey). Synonyms: Preproglucagon (118-147) amide (chicken, common turkey); H-His-Ala-Glu-Gly-Thr-Tyr-Thr-Ser-Asp-Ile-Thr-Ser-Tyr-Leu-Glu-Gly-Gln-Ala-Ala-Lys-Glu-Phe-Ile-Ala-Trp-Leu-Val-Asn-Gly-Arg-NH2; L-histidyl-L-alanyl-L-alpha-glutamyl-glycyl-L-threonyl-L-tyrosyl-L-threonyl-L-seryl-L-alpha-aspartyl-L-isoleucyl-L-threonyl-L-seryl-L-tyrosyl-L-leucyl-L-alpha-glutamyl-glycyl-L-glutaminyl-L-alanyl-L-alanyl-L-lysyl-L-alpha-glutamyl-L-phenylalanyl-L-isoleucyl-L-alanyl-L-tryptophyl-L-leucyl-L-valyl-L-asparagyl-glycyl-L-argininamide; Glucagon-Like Peptide 1 (7-36) amide (chicken, common turkey). Grade: ≥95% by HPLC. CAS No. 1802078-26-7. Molecular formula: C149H224N40O47. Mole weight: 3327.66. BOC Sciences 10
GLP-1 (7-36) amide trifluoroacetate salt GLP-1 (7-36) amide is an important peptide hormone that displays a strong insulinotropic effect. It binds the GLP-1 receptor (pIC50 = 8.5) in the pancreas and shows various antidiabetic effects. Synonyms: Glucagon-like Peptide 1 (7-36) amide. Mole weight: 3297.6. BOC Sciences 8
GLP-1 (7-36)-Lys(6-FAM) amide (human, bovine, guinea pig, mouse, rat) GLP-1 (7-36)-Lys(6-FAM) amide (human, bovine, guinea pig, mouse, rat). Synonyms: Preproglucagon (98-127)-Lys(6-FAM)amide (human, bovine, guinea pig, mouse, rat); H-His-Ala-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Val-Ser-Ser-Tyr-Leu-Glu-Gly-Gln-Ala-Ala-Lys-Glu-Phe-Ile-Ala-Trp-Leu-Val-Lys-Gly-Arg-Lys(fluorescein-6-carbonyl)-NH2; Proglucagon (78-107)-Lys(6-FAM)amide (human, bovine, guinea pig, mouse, rat); Glucagon-Like Peptide 1 (7-36)-Lys(6-FAM)amide (human, bovine, guinea pig, mouse, rat). Grade: ≥95%. CAS No. 1802089-53-7. Molecular formula: C176H248N42O52. Mole weight: 3784.16. BOC Sciences 10
GLP-1 (7-36)-Lys(biotinyl) amide (human, bovine, guinea pig, mouse, rat) GLP-1 (7-36)-Lys(biotinyl) amide (human, bovine, guinea pig, mouse, rat). Synonyms: Preproglucagon (98-127)-Lys(biotinyl) amide (human, bovine, guinea pig, mouse, rat); H-His-Ala-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Val-Ser-Ser-Tyr-Leu-Glu-Gly-Gln-Ala-Ala-Lys-Glu-Phe-Ile-Ala-Trp-Leu-Val-Lys-Gly-Arg-Lys(biotinyl)-NH2; Proglucagon (78-107)-Lys(biotinyl)amide (human, bovine, guinea pig, mouse, rat); Glucagon-Like Peptide 1 (7-36)-Lys(biotinyl)amide (human, bovine, guinea pig, mouse, rat). Grade: ≥95%. CAS No. 1802086-70-9. Molecular formula: C165H252N44O48S. Mole weight: 3652.15. BOC Sciences
GLP-1(7-37) GLP-1 (7-37) is an insulinotropic peptide generated from the precursor peptide GLP-1 (1-37). It is a potent stimulator of insulin secretion at concentrations as low as 5 X 10(-11) M and has no effect on insulin secretion even at concentrations as high as 5 X 10(-7) M. It participates in the physiological regulation of insulin secretion. Uses: Glp-1 (7-37) acetate participates in the physiological regulation of insulin secretion. Synonyms: Proglucagon (78-108) (human, bovine, guinea pig, mouse, rat); Insulinotropin (human, bovine, guinea pig, mouse, rat); Glucagon-Like Peptide 1 (7-37) (human, bovine, guinea pig, mouse, rat); Preproglucagon (98-128) (human, bovine, guinea pig, mouse, rat); GLP-1 (7-37) human; Glucagon-like Peptide-1 (7-37); H-His-Ala-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Val-Ser-Ser-Tyr-Leu-Glu-Gly-Gln-Ala-Ala-Lys-Glu-Phe-Ile-Ala-Trp-Leu-Val-Lys-Gly-Arg-Gly-OH; L-histidyl-L-alanyl-L-alpha-glutamyl-glycyl-L-threonyl-L-phenylalanyl-L-threonyl-L-seryl-L-alpha-aspartyl-L-valyl-L-seryl-L-seryl-L-tyrosyl-L-leucyl-L-alpha-glutamyl-glycyl-L-glutaminyl-L-alanyl-L-alanyl-L-lysyl-L-alpha-glutamyl-L-phenylalanyl-L-isoleucyl-L-alanyl-L-tryptophyl-L-leucyl-L-valyl-L-lysyl-glycyl-L-arginyl-glycine. Grade: 98%. CAS No. 106612-94-6. Molecular formula: C151H228N40O47. Mole weight: 3355.67. BOC Sciences
GLP-1(7-37) GLP-1(7-37) is an intestinal insulinotropic hormone that augments glucose induced insulin secretion. Uses: Scientific research. Group: Peptides. CAS No. 106612-94-6. Pack Sizes: 1 mg; 5 mg; 10 mg; 25 mg. Product ID: HY-P0055. MedChemExpress MCE
Glp-1(7-37)acetate Glp-1(7-37)acetate. Uses: Designed for use in research and industrial production. Additional or Alternative Names: GLP-1 (7-37) acetate;GLP-1 (7-36) amide Acetate (GMP);GLP-1 (7-37) human;GLP-1 (7-37) (human, bovine, guinea pig, mouse, rat);Glucagon-like peptide 1 (7-37) (human). Product Category: Heterocyclic Organic Compound. CAS No. 106612-94-6. Molecular formula: C151H228N40O47. Mole weight: 3355.67. Purity: >95%. Product ID: ACM106612946. Alfa Chemistry — ISO 9001:2015 Certified. Categories: GLP-1(7-37) Acetate. Alfa Chemistry. 4
GLP-1(7-37) acetate GLP-1(7-37) acetate is an intestinal insulinotropic hormone that augments glucose induced insulin secretion [1]. Uses: Scientific research. Group: Peptides. CAS No. 1450806-98-0. Pack Sizes: 5 mg; 10 mg; 25 mg; 50 mg; 100 mg. Product ID: HY-P0055A. MedChemExpress MCE
GLP-1 (9-36) amide GLP-1 (9-36) amide is an N-terminal truncated metabolite of glucagon-like peptide GLP-1-(7-36) formed by dipeptidyl peptidase-IV cleavage. GLP-1 (9-36) amide functions as a human GLP-1 receptor antagonist. Synonyms: Glucagon-like peptide-1 (9-36) amide; Glucagon-like peptide-1 (9 36) amide. CAS No. 161748-29-4. Molecular formula: C140H214N36O43. Mole weight: 3089.44. BOC Sciences 8
GLP-1(9-36)amide GLP-1(9-36)amide is a major metabolite of glucagon-like peptide-1-(7-36) amide formed by the enzyme dipeptidyl peptidase-4 (DPP-4). GLP-1(9-36)amide acts as an antagonist to the human pancreatic GLP-1 receptor [1] [2]. Uses: Scientific research. Group: Peptides. CAS No. 161748-29-4. Pack Sizes: 1 mg; 5 mg. Product ID: HY-P1141. MedChemExpress MCE
GLP-1 antagonist A glucagon-like peptide-1 (GLP-1) receptor antagonist. Synonyms: GLP-1 antagonist; GLP 1 antagonist; N-[[4,5-dimethyl-1-[(2-methylphenyl)methyl]imidazol-2-yl]methyl]-2,4-dimethoxy-N-(3-methylbutyl)benzamide. Grade: 99%. CAS No. 475466-57-0. Molecular formula: C28H37N3O3. Mole weight: 463.61. BOC Sciences 8
GLP-1, IGF-1 (1-3) GLP-1, IGF-1 (1-3) is a fragment of amino acids of Glucagon-like peptide-1. Grade: 98%. Molecular formula: C12H19N3O6. Mole weight: 301.3. BOC Sciences 10
GLP-1 moiety from Dulaglutide GLP-1 moiety from Dulaglutide is a fragment of Dulaglutide containing 31 amino acids, and Dulaglutide is a glucagonlike peptide 1 receptor (GLP-1) agonist. Synonyms: His-Gly-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Val-Ser-Ser-Tyr-Leu-Glu-Glu-Gln-Ala-Ala-Lys-Glu-Phe-Ile-Ala-Trp-Leu-Val-Lys-Gly-Gly-Gly. Grade: ≥98%. Molecular formula: C149H221N37O49. Mole weight: 3314.62. BOC Sciences 10
GLP-1R agonist 2 GLP-1R agonist 2 (compound 2) is an effective GLP-1R agonist that exerts its activating effect by forming hydrogen bonds with the Tyr42, Cys71, and Ser84 residues of GLP-1R. GLP-1R agonist 2 has the potential for research in metabolic diseases such as type 2 diabetes and obesity[1]. Uses: Scientific research. Group: Signaling pathways. CAS No. 281209-71-0. Pack Sizes: 10 mM * 1 mL; 1 mg; 5 mg; 10 mg; 25 mg; 50 mg; 100 mg. Product ID: HY-121835. MedChemExpress MCE
GLP-1R agonist 4 GLP-1R agonist 4 is a potent agonist of GLP-1R. Glucagon-like peptide-1 (GLP-1) is an intestinal hypoglycemic hormone secreted by L-cells in the lower gastrointestinal tract. GLP-1R agonist 4 has the potential for the research of diabetes (extracted from patent WO2019239319A1, compound 96) [1]. Uses: Scientific research. Group: Signaling pathways. CAS No. 2401894-26-4. Pack Sizes: 1 mg; 5 mg; 10 mg; 25 mg; 50 mg. Product ID: HY-144035. MedChemExpress MCE
GLP-1R agonist DMB GLP-1R agonist DMB is a glucagon-like peptide-1 (GLP-1) receptor agonist used potentially for the treatment of type 2 diabetes. Uses: Potential treatment of type 2 diabetes. Synonyms: N-(tert-Butyl)-6,7-dichloro-3-(methylsulfonyl)quinoxalin-2-amine. Grade: 99%. CAS No. 281209-71-0. Molecular formula: C13H15Cl2N3O2S. Mole weight: 348.25. BOC Sciences 8
GLP-1R Antagonist 1 GLP-1R Antagonist 1 (compound 5d) is an orally active, CNS penetrant and non-competitive antagonist of glucagon-like peptide 1 receptor (GLP-1R), with an IC50 of 650 nM[1]. Uses: Scientific research. Group: Signaling pathways. CAS No. 488097-06-9. Pack Sizes: 10 mM * 1 mL; 5 mg; 10 mg; 25 mg; 50 mg; 100 mg. Product ID: HY-101116. MedChemExpress MCE
GLP-1 receptor agonist 10 GLP-1 receptor agonist 10 (compound 42) is an agonist of GLP Receptor. GLP-1 receptor agonist 10 inhibits food intake and reduces glucose excursion in mice. GLP-1 receptor agonist 10 can be used in the study of type 2 diabetes (T2DM) and obesity [1]. Uses: Scientific research. Group: Signaling pathways. CAS No. 3015555-46-8. Pack Sizes: 10 mM * 1 mL; 5 mg; 10 mg; 25 mg; 50 mg; 100 mg. Product ID: HY-153798. MedChemExpress MCE
GLP-1 receptor agonist 12 GLP-1 receptor agonist 12 (compound 20A) is an agonist of GLP Receptor. GLP-1 receptor agonist 12 can be used in the study of diseases such as diabetes [1]. Uses: Scientific research. Group: Signaling pathways. CAS No. 2775376-50-4. Pack Sizes: 1 mg; 5 mg; 10 mg. Product ID: HY-153816. MedChemExpress MCE
GLP-1 receptor agonist 2 GLP-1 receptor agonist 2 is an agonist of glucagon-like peptide-1 receptor (GLP-1R). Synonyms: 1H-Benzimidazole-6-carboxylic acid, 2-[[(2S)-4-[6-[(4-chloro-2-fluorophenyl)methoxy]-2-pyridinyl]-2-methyl-1-piperazinyl]methyl]-1-[(2S)-2-oxetanylmethyl]-; 2-{[(2S)-4-{6-[(4-Chloro-2-fluorobenzyl)oxy]-2-pyridinyl}-2-methyl-1-piperazinyl]methyl}-1-[(2S)-2-oxetanylmethyl]-1H-benzimidazole-6-carboxylic acid. Grade: ≥95%. CAS No. 2230197-64-3. Molecular formula: C30H31ClFN5O4. Mole weight: 580.05. BOC Sciences 8
GLP-1 receptor agonist 2 GLP-1 receptor agonist 2 is a glucagon-like peptide-1 receptor (GLP-1R) agonist. Uses: Scientific research. Group: Signaling pathways. CAS No. 2230197-64-3. Pack Sizes: 10 mM * 1 mL; 5 mg; 10 mg. Product ID: HY-112679. MedChemExpress MCE
GLP-1 receptor agonist 3 GLP-1 receptor agonist 3 is a GLP-1 receptor agonist with EC50s of 1.1 and 13 nM in Clone H6 and Clone C6 cell lines assay, respectively. (Extracted from patent WO2018109607A1, Example 4A-1). Synonyms: 1H-Benzimidazole-6-carboxylic acid, 2-[[4-[6-[(4-cyano-2-fluorophenyl)methoxy]-2-pyridinyl]-1-piperidinyl]methyl]-1-[(2R)-2-oxetanylmethyl]-; 2-[(4-{6-[(4-Cyano-2-fluorobenzyl)oxy]-2-pyridinyl}-1-piperidinyl)methyl]-1-[(2R)-2-oxetanylmethyl]-1H-benzimidazole-6-carboxylic acid. Grade: ≥95%. CAS No. 2230200-09-4. Molecular formula: C31H30FN5O4. Mole weight: 555.60. BOC Sciences 8
GLP-1 receptor agonist 4 GLP-1 receptor agonist 4, a glucagon-like peptide-1 receptor (GLP-1R) agonist with an EC50 of 64.5 nM, can be used in the study of diabetes treatment. (Extracted from patent WO2009111700A2, compound 87). Synonyms: (S)-3-(4'-Cyano-[1,1'-biphenyl]-4-yl)-2-((3R,8S)-3-(4-((3,4-dichlorobenzyl)oxy)phenyl)-1-methyl-2-oxo-7-((S)-1-phenylpropyl)-2,3,6,7,8,9-hexahydro-1H-[1,4]oxazino[3,2-g]isoquinoline-8-carboxamido)propanoic acid; (2S)-3-(4'-Cyano-4-biphenylyl)-2-[({(3R,8S)-3-{4-[(3,4-dichlorobenzyl)oxy]phenyl}-1-methyl-2-oxo-7-[(1S)-1-phenylpropyl]-2,3,6,7,8,9-hexahydro-1H-[1,4]oxazino[3,2-g]isoquinolin-8-yl}carbonyl)amino]propanoic acid. Grade: ≥95%. CAS No. 1187061-62-6. Molecular formula: C51H44Cl2N4O6. Mole weight: 879.82. BOC Sciences 8
GLP-1 receptor agonist 7 GLP-1 receptor agonist 7 is a potent glucagon-like peptide-1 (GLP-1) agonist with potential to study GLP-1-related diseases, disorders and conditions, including diabetes mellitus. (Extracted from patent WO2021219019A1, compound 130b). Synonyms: 2-((4-((S)-3-(4-chloro-2-fluorophenyl)-2,3-dihydrobenzo[b][1,4]dioxin-5-yl)piperidin-1-yl)methyl)-3-(((S)-oxetan-2-yl)methyl)-3H-imidazo[4,5-b]pyridine-5-carboxylic acid. CAS No. 2736447-04-2. Molecular formula: C31H30ClFN4O5. Mole weight: 593.05. BOC Sciences 8
GLP-1 receptor agonist 7 GLP-1 receptor agonist 7 is a potent agonist of glucagon-like peptide-1 ( GLP-1 ). GLP-1 receptor agonist 7 has the potential for the research of GLP-1-associated diseases, disorders, and conditions including diabetes mellitus (extracted from patent WO2021219019A1, compound 130b) [1]. Uses: Scientific research. Group: Signaling pathways. CAS No. 2736447-04-2. Pack Sizes: 5 mg; 10 mg. Product ID: HY-145412. MedChemExpress MCE
GLP-1 receptor agonist 8 GLP-1 receptor agonist 8, a potent GLP-1 receptor agonist, has potential in the study of diabetes, obesity and non-alcoholic fatty liver disease (NAFLD). (Extracted from patent WO2019239319A1, compound 17). Synonyms: ammonium (R)-2-((4-(2-(4-chloro-2-fluorophenyl)-2-methylbenzo[d][1,3]dioxol-4-yl)piperidin-1-yl)methyl)-1-((1-ethyl-1H-imidazol-5-yl)methyl)-1H-benzo[d]imidazole-6-carboxylate. CAS No. 2401892-86-0. Molecular formula: C34H36ClFN6O4. Mole weight: 647.14. BOC Sciences 8
GLP-1 receptor agonist 9 GLP-1 receptor agonist 9 is an agonist of GLP-1 receptor. (Extracted from WO2020234726 A1, example 7). Synonyms: 1H-Benzimidazole-6-carboxylic acid, 2-[[4-[(2S)-2-(4-chloro-2-fluorophenyl)-2-methyl-1,3-benzodioxol-4-yl]-1-piperidinyl]methyl]-1-[(2S)-2-oxetanylmethyl]-. Grade: ≥95%. CAS No. 2401892-71-3. Molecular formula: C32H31ClFN3O5. Mole weight: 592.06. BOC Sciences 8
GLP-1 receptor agonist 9 citrate GLP-1 receptor agonist 9 is an agonist of GLP-1 receptor. Molecular formula: C38H39ClFN3O12. Mole weight: 784.18. BOC Sciences 8
GLP-1R modulator C16 GLP-1R modulator C16 is an allosteric modulator that enhances the binding of GLP-1 to GLP-1R through transmembrane site with an EC50 of 8.43±3.82 μM. Synonyms: N-{4-[(2-chloro-6-fluorobenzyl)oxy]-3-methoxybenzyl}-N-[2-(4-morpholinyl)ethyl]amine; N-{4-[(2-Chloro-6-fluorobenzyl)oxy]-3-methoxybenzyl}-2-(4-morpholinyl)ethanamine; 4-Morpholineethanamine, N-[[4-[(2-chloro-6-fluorophenyl)methoxy]-3-methoxyphenyl]methyl]-. Grade: ≥90%. CAS No. 875005-43-9. Molecular formula: C21H26ClFN2O3. Mole weight: 408.89. BOC Sciences 8
GLP-1R modulator C5 GLP-1R modulator C5 is an allosteric modulator that enhances the binding of GLP-1 to GLP-1R through transmembrane site with an EC50 of 1.59±0.53 μM. Synonyms: 3-hydroxy-3-(2-oxo-2-phenylethyl)-1-(2-phenylethyl)-1,3-dihydro-2H-indol-2-one; 2H-Indol-2-one, 1,3-dihydro-3-hydroxy-3-(2-oxo-2-phenylethyl)-1-(2-phenylethyl)-. Grade: ≥90%. CAS No. 421578-93-0. Molecular formula: C24H21NO3. Mole weight: 371.43. BOC Sciences 8
GLP-1R modulator C5 GLP-1R modulator C5 is an allosteric modulator enhancing GLP-1 binding to GLP-1R via a transmembrane site (EC50 1.59 ± 0.53 ?M). Uses: Scientific research. Group: Signaling pathways. CAS No. 421578-93-0. Pack Sizes: 10 mM * 1 mL; 5 mg; 10 mg; 25 mg; 50 mg; 100 mg. Product ID: HY-141840. MedChemExpress MCE
GLP-1R modulator L7-028 GLP-1R modulator L7-028 is an allosteric modulator that enhances the binding of GLP-1 to GLP-1R through transmembrane site with an EC50 of 11.01±2.73 μM. Synonyms: Benzamide, 3-(cyclopentyloxy)-N-[3-(1-piperidinylcarbonyl)phenyl]-. Grade: ≥95%. CAS No. 2648317-95-5. Molecular formula: C24H28N2O3. Mole weight: 392.49. BOC Sciences 8
GLP-1 TFA GLP-1 is a potent insulin secretagogue that has multiple synergetic effects on the glucose-dependent insulin secretion pathways of the beta-cell. Synonyms: GLP-1 trifluoroacetate salt; Glucagon-like peptide 1 trifluoroacetate salt; H-His-Ala-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Val-Ser-Ser-Tyr-Leu-Glu-Gly-Gln-Ala-Ala-Lys-Glu-Phe-Ile-Ala-Trp-Leu-Val-Lys-Gly-Arg-NH2.TFA. BOC Sciences
GLP-2 (1-33) (human) GLP-2 (human) is an endogenous peptide that acts as an intestinal epithelium-specific growth factor. It stimulates cell proliferation and inhibits apoptosis, and also modulates intestinal glucose transport, food intake, and gastric acid secretion. Synonyms: Glucagon-like peptide 2 (human); GLP-2 (human); GLP 2 (human). Grade: >98%. CAS No. 223460-79-5. Molecular formula: C165H254N44O55S. Mole weight: 3766.1. BOC Sciences
GLP-2(1-33)(human) GLP-2(1-33) (human) is an enteroendocrine hormone which can bind to the GLP-2 receptor and stimulate the growth of intestinal epithelium. Uses: Scientific research. Group: Peptides. Alternative Names: GLP-2 (human); Glucagon-like peptide 2 (human). CAS No. 223460-79-5. Pack Sizes: 500 ?g; 1 mg; 5 mg. Product ID: HY-P1024. MedChemExpress MCE
GLP-2 (1-34) (human) GLP-2 (1-34) (human) is a human-derived mimic of glucagon-like peptide 2 employed in studying gastrointestinal disorders such as short bowel syndrome (SBS). Synonyms: Preproglucagon (146-179) (human); H-His-Ala-Asp-Gly-Ser-Phe-Ser-Asp-Glu-Met-Asn-Thr-Ile-Leu-Asp-Asn-Leu-Ala-Ala-Arg-Asp-Phe-Ile-Asn-Trp-Leu-Ile-Gln-Thr-Lys-Ile-Thr-Asp-Arg-OH; L-histidyl-L-alanyl-L-alpha-aspartyl-glycyl-L-seryl-L-phenylalanyl-L-seryl-L-alpha-aspartyl-L-alpha-glutamyl-L-methionyl-L-asparagyl-L-threonyl-L-isoleucyl-L-leucyl-L-alpha-aspartyl-L-asparagyl-L-leucyl-L-alanyl-L-alanyl-L-arginyl-L-alpha-aspartyl-L-phenylalanyl-L-isoleucyl-L-asparagyl-L-tryptophyl-L-leucyl-L-isoleucyl-L-glutaminyl-L-threonyl-L-lysyl-L-isoleucyl-L-threonyl-L-alpha-aspartyl-L-arginine. Grade: 95%. CAS No. 99120-49-7. Molecular formula: C171H266N48O56S1. Mole weight: 3922.29. BOC Sciences
GLP-2 (3-33) GLP-2 (3-33). Synonyms: Glucagon-Like Peptide 2-(3-33); L-Aspartic acid, L-α-aspartylglycyl-L-seryl-L-phenylalanyl-L-seryl-L-α-aspartyl-L-α-glutamyl-L-methionyl-L-asparaginyl-L-threonyl-L-isoleucyl-L-leucyl-L-α-aspartyl-L-asparaginyl-L-leucyl-L-alanyl-L-alanyl-L-arginyl-L-α-aspartyl-L-phenylalanyl-L-isoleucyl-L-asparaginyl-L-tryptophyl-L-leucyl-L-isoleucyl-L-glutaminyl-L-threonyl-L-lysyl-L-isoleucyl-L-threonyl-; H-Asp-Gly-Ser-Phe-Ser-Asp-Glu-Met-Asn-Thr-Ile-Leu-Asp-Asn-Leu-Ala-Ala-Arg-Asp-Phe-Ile-Asn-Trp-Leu-Ile-Gln-Thr-Lys-Ile-Thr-Asp-OH; L-alpha-aspartyl-glycyl-L-seryl-L-phenylalanyl-L-seryl-L-alpha-aspartyl-L-alpha-glutamyl-L-methionyl-L-asparagyl-L-threonyl-L-isoleucyl-L-leucyl-L-alpha-aspartyl-L-asparagyl-L-leucyl-L-alanyl-L-alanyl-L-arginyl-L-alpha-aspartyl-L-phenylalanyl-L-isoleucyl-L-asparagyl-L-tryptophyl-L-leucyl-L-isoleucyl-L-glutaminyl-L-threonyl-L-lysyl-L-isoleucyl-L-threonyl-L-aspartic acid. Grade: ≥95%. CAS No. 275801-62-2. Molecular formula: C156H242N40O53S. Mole weight: 3557.89. BOC Sciences 10
GLP-2(3-33) GLP-2(3-33), generated naturally by dipeptidylpeptidase IV (DPPIV), acts as a partial agonist on GLP-2 receptor ( EC 50 =5.8 nM) [1] [2]. Uses: Scientific research. Group: Peptides. CAS No. 275801-62-2. Pack Sizes: 1 mg; 5 mg. Product ID: HY-P2625. MedChemExpress MCE
GLP-26 GLP-26 is an HBV capsid assembly modulator (CAM) that inhibits HBV DNA replication (IC50 = 3 nM) in Hep AD38 system and reduces cccDNA by >90% at 1 μM. GLP-26 disrupts pregenomic RNA encapsulation, leading to nucleocapsid disintegration and reduced cccDNA pools. Synonyms: N-(3,4-Difluorophenyl)-1,3,5-trimethyl-4-(2-oxo-2-(prop-2-yn-1-ylamino)acetyl)-1H-pyrrole-2-carboxamide; N-(3,4-Difluorophenyl)-1,3,5-trimethyl-4-[oxo(2-propyn-1-ylamino)acetyl]-1H-pyrrole-2-carboxamide; 1H-Pyrrole-3-acetamide, 5-[[(3,4-difluorophenyl)amino]carbonyl]-1,2,4-trimethyl-α-oxo-N-2-propyn-1-yl-. Grade: ≥98%. CAS No. 2133017-36-2. Molecular formula: C19H17F2N3O3. Mole weight: 373.35. BOC Sciences 8
Glp-2(rat) GLP-2(rat) is an intestinal growth factor. GLP-2(rat) stimulates cell proliferation and inhibits apoptosis. GLP-2(rat) enhances mucosal mass and function in residual small intestine after massive small bowel resection (MSBR). Uses: Designed for use in research and industrial production. Additional or Alternative Names: GLUCAGON-LIKE PEPTIDE 2 (RAT);GLUCAGON-LIKE PEPTIDE II RAT;GLP-2 (RAT);H-HIS-ALA-ASP-GLY-SER-PHE-SER-ASP-GLU-MET-ASN-THR-ILE-LEU-ASP-ASN-LEU-ALA-THR-ARG-ASP-PHE-ILE-ASN-TRP-LEU-ILE-GLN-THR-LYS-ILE-THR-ASP-OH;HADGSFSDEMNTILDNLATRDFINWLIQTKITD;PREPROGLUCAG. Product Category: Inhibitors. Appearance: Solid. CAS No. 195262-56-7. Molecular formula: C166H256N44O56S. Mole weight: 3796.14. Purity: 0.9804. Product ID: ACM195262567. Alfa Chemistry — ISO 9001:2015 Certified. Alfa Chemistry.
GLP-2 (rat) GLP-2 (rat) is an endogenous peptide that acts as an intestinal epithelium-specific growth factor. It stimulates cell proliferation and inhibits apoptosis, and also modulates intestinal glucose transport, food intake, and gastric acid secretion. Synonyms: Preproglucagon (146-178) (rat); H-His-Ala-Asp-Gly-Ser-Phe-Ser-Asp-Glu-Met-Asn-Thr-Ile-Leu-Asp-Asn-Leu-Ala-Thr-Arg-Asp-Phe-Ile-Asn-Trp-Leu-Ile-Gln-Thr-Lys-Ile-Thr-Asp-OH; Glucagon-like Peptide 2 (rat); L-histidyl-L-alanyl-L-alpha-aspartyl-glycyl-L-seryl-L-phenylalanyl-L-seryl-L-alpha-aspartyl-L-alpha-glutamyl-L-methionyl-L-asparagyl-L-threonyl-L-isoleucyl-L-leucyl-L-alpha-aspartyl-L-asparagyl-L-leucyl-L-alanyl-L-threonyl-L-arginyl-L-alpha-aspartyl-L-phenylalanyl-L-isoleucyl-L-asparagyl-L-tryptophyl-L-leucyl-L-isoleucyl-L-glutaminyl-L-threonyl-L-lysyl-L-isoleucyl-L-threonyl-L-aspartic acid. Grade: ≥95%. CAS No. 195262-56-7. Molecular formula: C166H256N44O56S. Mole weight: 3796.17. BOC Sciences
GLP-2(rat) GLP-2(rat) is an intestinal growth factor. GLP-2(rat) stimulates cell proliferation and inhibits apoptosis. GLP-2(rat) enhances mucosal mass and function in residual small intestine after massive small bowel resection (MSBR) [1] [2]. Uses: Scientific research. Group: Peptides. CAS No. 195262-56-7. Pack Sizes: 5 mg; 10 mg. Product ID: HY-P1142. MedChemExpress MCE
GLP-2 (rat) trifluoroacetate salt GLP-2 is a gut peptide hormone that is primarily produced by enteroendocrine L cells of the small and large intestine. GLP-2 is an antagonist of the GLP-2 receptor (GLP-2R; Ki = 60 pM). Synonyms: Glucagon-like Peptide 2. Grade: ≥95%. Molecular formula: C166H256N44O56S·xCF3COOH. Mole weight: 3796.14. BOC Sciences 8
GLPG0187 GLPG0187 is a broad spectrum integrin receptor antagonist with antitumor activity; inhibits ?v?1-integrin with an IC50 of 1.3 nM[1]. GLPG0187 inhibits migrasome biogenesis without cytotoxicity[3]. Uses: Scientific research. Group: Signaling pathways. CAS No. 1320346-97-1. Pack Sizes: 10 mM * 1 mL; 1 mg; 5 mg; 10 mg; 25 mg; 50 mg; 100 mg. Product ID: HY-100506. MedChemExpress MCE
GLPG-0187 GLPG-0187 is a small molecule integrin receptor antagonist (IRA) with nanomolar affinity for the RGD-integrin receptors αvβ1, αvβ3, αvβ5, αvβ6 and α5β1 (IC50s = 1.2-3.7 nM). Integrin receptors are expressed on the surface of tumor vessel endothelial cells and some types of cancer cells, and play a crucial role in endothelial cell adhesion and migration. This compound shows an inhibitory activity of angiogenesis, bone-resorption and tumor, which is hopefully used as an anticancer drug. Uses: An integrin receptor antagonist (ira) can be used as an anticancer drug. Synonyms: GLPG0187; GLPG 0187; GLPG-0187; UNII-43A5P87Z4T; 43A5P87Z4T; SCHEMBL2372722; CHEMBL3319236; (2S)-3-[[2,5-dimethyl-6-[4-(5,6,7,8-tetrahydro-1,8-naphthyridin-2-yl)piperidin-1-yl]pyrimidin-4-yl]amino]-2-[(4-methoxyphenyl)sulfonylamino]propanoic acid. Grade: ≥98 %. CAS No. 1320346-97-1. Molecular formula: C29H37N7O5S. Mole weight: 595.719. BOC Sciences 8
GLPG0492 GLPG0492, a selective androgen receptor modulator, could be effective in decreasing muscle loss. The treatment study against Duchenne muscular dystrophy of it has alreadt been discontinued. Uses: Glpg0492 is a selective androgen receptor modulator that could be effective in decreasing muscle loss. Synonyms: DT-200; DT 200; DT200; GLPG0492; SCHEMBL2021011; CHEMBL2178100; GLPG 0492; GLPG-0492; VAJGULUVTFDTAS-GOSISDBHSA-N. Grade: 98%. CAS No. 1215085-92-9. Molecular formula: C19H14F3N3O3. Mole weight: 389.33. BOC Sciences 8
GLPG0492 R enantiomer The R-enantiomer of GLPG0492 which is a selective androgen receptor modulator, could be effective in decreasing muscle loss. Uses: The r-enantiomer of glpg0492 which is a selective androgen receptor modulator that could be effective in decreasing muscle loss. Synonyms: GLPG-0492 R enantiomer; GLPG 0492 R enantiomer; GLPG0492 R enantiomer. Grade: 98%. CAS No. 1215085-93-0. Molecular formula: C19H14F3N3O3. Mole weight: 389.33. BOC Sciences 8
GLPG0634 analog GLPG0634 analog (Compoun 176) is a broad spectrum JAK inhibitor with IC 50 values of <100 nM against JAK1, JAK2 and JAK3 [1]. Uses: Scientific research. Group: Signaling pathways. CAS No. 1206101-20-3. Pack Sizes: 10 mM * 1 mL; 5 mg; 10 mg; 50 mg. Product ID: HY-13961. MedChemExpress MCE
GLPG0634 analogue A potent and selective JAK1 inhibitor with IC50 values of 10, 28, 810, and 116 nM for JAK1, JAK2, JAK3, and TYK2, respectively. Synonyms: GLPG0634 analog; N-[5-[4-[(6-cyanopyridin-3-yl)methoxy]phenyl]-[1,2,4]triazolo[1,5-a]pyridin-2-yl]cyclopropanecarboxamide. Grade: >98%. CAS No. 1206101-20-3. Molecular formula: C23H18N6O2. Mole weight: 410.43. BOC Sciences 8
GLPG0974 GLPG0974 is a free fatty acid receptor-2 (FFA2/GPR43) antagonist with an IC50 of 9 nM. Uses: Scientific research. Group: Signaling pathways. CAS No. 1391076-61-1. Pack Sizes: 10 mM * 1 mL; 5 mg; 10 mg; 25 mg; 50 mg; 100 mg. Product ID: HY-12940. MedChemExpress MCE
GLPG 0974 GLPG 0974 is a potent FFA2 antagonist (IC50 = 9 nM) with selectivity for FFA2 over FFA3. It was shown that GLPG 0974 inhibited acetate-induced human neutrophil migration in plasma or buffer, and also suppressed FFA2-induced expression of CD11b activation-specific epitope (AE) in human whole blood. Synonyms: GLPG0974; GLPG 0974; GLPG-0974. 4-[[[(2R)-1-(Benzo[b]thien-3-ylcarbonyl)-2-methyl-2-azetidinyl]carbonyl][(3-chlorophenyl)methyl]amino]butanoic acid. Grade: ≥98% by HPLC. CAS No. 1391076-61-1. Molecular formula: C25H25ClN2O4S. Mole weight: 485. BOC Sciences 8
GLPG1205 GLPG1205 is potent, selective and orally active GPR84 (a G-protein-coupled receptor) antagonist with a favorable PK/PD profile. GLPG1205 has anti-inflammatory activity and is used for the treatment of pulmonary fibrosis[1][2]. GLPG1205 is a click chemistry reagent, it contains an Alkyne group and can undergo copper-catalyzed azide-alkyne cycloaddition (CuAAc) with molecules containing Azide groups. Uses: Scientific research. Group: Signaling pathways. CAS No. 1445847-37-9. Pack Sizes: 10 mM * 1 mL; 5 mg; 10 mg; 25 mg; 50 mg; 100 mg. Product ID: HY-135303. MedChemExpress MCE
GLPG-1690 GLPG-1690, an imidazopyridine derivative, has been found to be a selective autotaxin inhibitor that could probably be effective as an anti-inflammatory agent and is under Phase II trial against Idiopathic pulmonary fibrosis (IPF). Synonyms: Ziritaxestat; GLPG 1690; GLPG1690; 2-((2-ethyl-6-(4-(2-(3-hydroxyazetidin-1-yl)-2-oxoethyl)piperazin-1-yl)-8-methylimidazo[1,2-a]pyridin-3-yl)(methyl)amino)-4-(4-fluorophenyl)thiazole-5-carbonitrile. Grade: >98%. CAS No. 1628260-79-6. Molecular formula: C30H33FN8O2S. Mole weight: 588.71. BOC Sciences 8
GLPG1837 GLPG1837 is a potent, orally available potentiator of cystic fibrosis transmembrane conductance regulator (CFTR) with EC50 of 3 nM and 339 nM on F508del and G551D CFTR, respectively. Synonyms: ABBV-974; N-[3-(aminocarbonyl)-4,7-dihydro-5,5,7,7-tetramethyl-5H-thieno[2,3-c]pyran-2-yl]-1H-pyrazole-3-carboxamide. Grade: ≥98%. CAS No. 1654725-02-6. Molecular formula: C16H20N4O3S. Mole weight: 348.42. BOC Sciences 8
GLPG2938 GLPG2938 is an antagonists of sphingosine-1-phosphate (S1P) receptor for prophylaxis and?/or treatment of diseases including fibrotic, inflammatory, autoimmune, metabolic, cardiovascular, and?/or proliferative diseases. GLPG2938 displayed S1P inhibitory activity.with EC50 value of 9.5 nM (S1P2 antagonist EC50)?. Uses: Designed for use in research and industrial production. Additional or Alternative Names: MUN96006; MUN-96006; MUN 96006; GLPG2938; GLPG-2938; GLPG 2938. Product Category: Antagonists. Appearance: Solid powder. CAS No. 2130996-00-6. Molecular formula: C20H19F6N7O2. Mole weight: 503.41. Purity: >98%. IUPACName: 1-(2-ethoxy-6-(trifluoromethyl)pyridin-4-yl)-3-((5-methyl-6-(1-methyl-3-(trifluoromethyl)-1H-pyrazol-4-yl)pyridazin-3-yl)methyl)urea. Canonical SMILES: O=C(NCC1=NN=C(C2=CN(C)N=C2C(F)(F)F)C(C)=C1)NC3=CC(OCC)=NC(C(F)(F)F)=C3. Product ID: ACM2130996006. Alfa Chemistry — ISO 9001:2015 Certified. Alfa Chemistry.
GLPG2938 GLPG2938 is a potent and selective S1P2 antagonist. GLPG2938 can be used for the research of idiopathic pulmonary fibrosis[1]. Uses: Scientific research. Group: Signaling pathways. CAS No. 2130996-00-6. Pack Sizes: 10 mM * 1 mL; 1 mg; 5 mg; 10 mg; 25 mg; 50 mg; 100 mg. Product ID: HY-139310. MedChemExpress MCE
GLPG2938 GLPG2938 is a potent and selective S1P2 antagonist that can be used for the study of idiopathic pulmonary fibrosis. It inhibits S1P-induced calcium flux in CHO cells overexpressing human S1P2 (IC50 = 8.8 nM), inhibits S1P-induced IL-8 release in HFL1 cells (IC50 = 0.6 nM) and S1P-induced contraction of human lung fibroblasts. Synonyms: 1-(2-Ethoxy-6-(trifluoromethyl)pyridin-4-yl)-3-((5-methyl-6-(1-methyl-3-(trifluoromethyl)-1H-pyrazol-4-yl)pyridazin-3-yl)methyl)urea; MUN96006; 1-[2-Ethoxy-6-(trifluoromethyl)-4-pyridinyl]-3-({5-methyl-6-[1-methyl-3-(trifluoromethyl)-1H-pyrazol-4-yl]-3-pyridazinyl}methyl)urea; Urea, N-[2-ethoxy-6-(trifluoromethyl)-4-pyridinyl]-N'-[[5-methyl-6-[1-methyl-3-(trifluoromethyl)-1H-pyrazol-4-yl]-3-pyridazinyl]methyl]-. Grade: ≥98%. CAS No. 2130996-00-6. Molecular formula: C20H19F6N7O2. Mole weight: 503.40. BOC Sciences 8
GLPG3312 GLPG3312 (Compound 28) is an orally active SIK inhibitor with IC50 values of 2.0 nM, 0.7 nM and 0.6 nM for SIK1, SIK2 and SIK3, respectively. GLPG3312 exhibits anti-inflammatory and immunomodulatory activity in vitro on human primary myeloid cells and in vivo in mouse models. GLPG3312 has good oral bioavailability and can be used for research on inflammatory and immune diseases[1]. Uses: Scientific research. Group: Signaling pathways. CAS No. 2340388-72-7. Pack Sizes: 1 mg; 5 mg; 10 mg; 25 mg; 50 mg; 100 mg. Product ID: HY-157442. MedChemExpress MCE

Would you like to list your products on USA Chemical Suppliers?

Our database is helping our users find suppliers everyday.

Add Your Products