A directory of where to buy chemicals in the USA, including: distributors, industrial manufacturers, bulk supplies and wholesalers of raw ingredients & finished goods.
Search for products or services, then visit the suppliers website for prices or more information.
| Product | Description | |
|---|---|---|
| GLP-1 antagonist | A glucagon-like peptide-1 (GLP-1) receptor antagonist. Synonyms: GLP-1 antagonist; GLP 1 antagonist; N-[[4,5-dimethyl-1-[(2-methylphenyl)methyl]imidazol-2-yl]methyl]-2,4-dimethoxy-N-(3-methylbutyl)benzamide. Grades: 99%. CAS No. 475466-57-0. Molecular formula: C28H37N3O3. Mole weight: 463.61. |  |
| GLP-1R agonist 4 | GLP-1R agonist 4 is a potent agonist of GLP-1R. Glucagon-like peptide-1 (GLP-1) is an intestinal hypoglycemic hormone secreted by L-cells in the lower gastrointestinal tract. GLP-1R agonist 4 has the potential for the research of diabetes (extracted from patent WO2019239319A1, compound 96) [1]. Uses: Scientific research. Group: Signaling pathways. CAS No. 2401894-26-4. Pack Sizes: 1 mg; 5 mg; 10 mg; 25 mg; 50 mg. Product ID: HY-144035. |  |
| GLP-1R agonist DMB | GLP-1R agonist DMB is a glucagon-like peptide-1 (GLP-1) receptor agonist used potentially for the treatment of type 2 diabetes. Uses: Potential treatment of type 2 diabetes. Synonyms: N-(tert-Butyl)-6,7-dichloro-3-(methylsulfonyl)quinoxalin-2-amine. Grades: 99%. CAS No. 281209-71-0. Molecular formula: C13H15Cl2N3O2S. Mole weight: 348.25. | |
| GLP-1 receptor agonist 10 | GLP-1 receptor agonist 10 (compound 42) is an agonist of GLP Receptor. GLP-1 receptor agonist 10 inhibits food intake and reduces glucose excursion in mice. GLP-1 receptor agonist 10 can be used in the study of type 2 diabetes (T2DM) and obesity [1]. Uses: Scientific research. Group: Signaling pathways. CAS No. 3015555-46-8. Pack Sizes: 10 mM * 1 mL; 5 mg; 10 mg; 25 mg; 50 mg; 100 mg. Product ID: HY-153798. | |
| GLP-1 receptor agonist 12 | GLP-1 receptor agonist 12 (compound 20A) is an agonist of GLP Receptor. GLP-1 receptor agonist 12 can be used in the study of diseases such as diabetes [1]. Uses: Scientific research. Group: Signaling pathways. CAS No. 2775376-50-4. Pack Sizes: 1 mg; 5 mg; 10 mg. Product ID: HY-153816. | |
| GLP-1 receptor agonist 2 | GLP-1 receptor agonist 2 is a glucagon-like peptide-1 receptor (GLP-1R) agonist. Uses: Scientific research. Group: Signaling pathways. CAS No. 2230197-64-3. Pack Sizes: 10 mM * 1 mL; 5 mg; 10 mg. Product ID: HY-112679. | |
| GLP-1 receptor agonist 7 | GLP-1 receptor agonist 7 is a potent agonist of glucagon-like peptide-1 ( GLP-1 ). GLP-1 receptor agonist 7 has the potential for the research of GLP-1-associated diseases, disorders, and conditions including diabetes mellitus (extracted from patent WO2021219019A1, compound 130b) [1]. Uses: Scientific research. Group: Signaling pathways. CAS No. 2736447-04-2. Pack Sizes: 5 mg; 10 mg. Product ID: HY-145412. | |
| GLP-2 (1-33) (human) | GLP-2 (human) is an endogenous peptide that acts as an intestinal epithelium-specific growth factor. It stimulates cell proliferation and inhibits apoptosis, and also modulates intestinal glucose transport, food intake, and gastric acid secretion. Synonyms: Glucagon-like peptide 2 (human); GLP-2 (human); GLP 2 (human). Grades: >98%. CAS No. 223460-79-5. Molecular formula: C165H254N44O55S. Mole weight: 3766.1. | |
| GLP-2 (1-34) (human) | GLP-2 (1-34) (human) is a human-derived mimic of glucagon-like peptide 2 employed in studying gastrointestinal disorders such as short bowel syndrome (SBS). Synonyms: Preproglucagon (146-179) (human); H-His-Ala-Asp-Gly-Ser-Phe-Ser-Asp-Glu-Met-Asn-Thr-Ile-Leu-Asp-Asn-Leu-Ala-Ala-Arg-Asp-Phe-Ile-Asn-Trp-Leu-Ile-Gln-Thr-Lys-Ile-Thr-Asp-Arg-OH; L-histidyl-L-alanyl-L-alpha-aspartyl-glycyl-L-seryl-L-phenylalanyl-L-seryl-L-alpha-aspartyl-L-alpha-glutamyl-L-methionyl-L-asparagyl-L-threonyl-L-isoleucyl-L-leucyl-L-alpha-aspartyl-L-asparagyl-L-leucyl-L-alanyl-L-alanyl-L-arginyl-L-alpha-aspartyl-L-phenylalanyl-L-isoleucyl-L-asparagyl-L-tryptophyl-L-leucyl-L-isoleucyl-L-glutaminyl-L-threonyl-L-lysyl-L-isoleucyl-L-threonyl-L-alpha-aspartyl-L-arginine. Grades: 95%. CAS No. 99120-49-7. Molecular formula: C171H266N48O56S1. Mole weight: 3922.29. | |
| GLP-2 (3-33) | Synonyms: Glucagon-Like Peptide 2-(3-33); L-Aspartic acid, L-α-aspartylglycyl-L-seryl-L-phenylalanyl-L-seryl-L-α-aspartyl-L-α-glutamyl-L-methionyl-L-asparaginyl-L-threonyl-L-isoleucyl-L-leucyl-L-α-aspartyl-L-asparaginyl-L-leucyl-L-alanyl-L-alanyl-L-arginyl-L-α-aspartyl-L-phenylalanyl-L-isoleucyl-L-asparaginyl-L-tryptophyl-L-leucyl-L-isoleucyl-L-glutaminyl-L-threonyl-L-lysyl-L-isoleucyl-L-threonyl-; H-Asp-Gly-Ser-Phe-Ser-Asp-Glu-Met-Asn-Thr-Ile-Leu-Asp-Asn-Leu-Ala-Ala-Arg-Asp-Phe-Ile-Asn-Trp-Leu-Ile-Gln-Thr-Lys-Ile-Thr-Asp-OH; L-alpha-aspartyl-glycyl-L-seryl-L-phenylalanyl-L-seryl-L-alpha-aspartyl-L-alpha-glutamyl-L-methionyl-L-asparagyl-L-threonyl-L-isoleucyl-L-leucyl-L-alpha-aspartyl-L-asparagyl-L-leucyl-L-alanyl-L-alanyl-L-arginyl-L-alpha-aspartyl-L-phenylalanyl-L-isoleucyl-L-asparagyl-L-tryptophyl-L-leucyl-L-isoleucyl-L-glutaminyl-L-threonyl-L-lysyl-L-isoleucyl-L-threonyl-L-aspartic acid. Grades: ≥95%. CAS No. 275801-62-2. Molecular formula: C156H242N40O53S. Mole weight: 3557.89. | |
| GLP-2(3-33) | GLP-2(3-33), generated naturally by dipeptidylpeptidase IV (DPPIV), acts as a partial agonist on GLP-2 receptor ( EC 50 =5.8 nM) [1] [2]. Uses: Scientific research. Group: Peptides. CAS No. 275801-62-2. Pack Sizes: 1 mg; 5 mg. Product ID: HY-P2625. | |
| Glp-2(rat) | GLP-2(rat) is an intestinal growth factor. GLP-2(rat) stimulates cell proliferation and inhibits apoptosis. GLP-2(rat) enhances mucosal mass and function in residual small intestine after massive small bowel resection (MSBR). Uses: Designed for use in research and industrial production. Additional or Alternative Names: GLUCAGON-LIKE PEPTIDE 2 (RAT);GLUCAGON-LIKE PEPTIDE II RAT;GLP-2 (RAT);H-HIS-ALA-ASP-GLY-SER-PHE-SER-ASP-GLU-MET-ASN-THR-ILE-LEU-ASP-ASN-LEU-ALA-THR-ARG-ASP-PHE-ILE-ASN-TRP-LEU-ILE-GLN-THR-LYS-ILE-THR-ASP-OH;HADGSFSDEMNTILDNLATRDFINWLIQTKITD;PREPROGLUCAG. Product Category: Inhibitors. Appearance: Solid. CAS No. 195262-56-7. Molecular formula: C166H256N44O56S. Mole weight: 3796.14. Purity: 0.9804. Product ID: ACM195262567. Alfa Chemistry ISO 9001:2015 Certified. |  |
| GLP-2 (rat) | GLP-2 (rat) is an endogenous peptide that acts as an intestinal epithelium-specific growth factor. It stimulates cell proliferation and inhibits apoptosis, and also modulates intestinal glucose transport, food intake, and gastric acid secretion. Synonyms: Preproglucagon (146-178) (rat); H-His-Ala-Asp-Gly-Ser-Phe-Ser-Asp-Glu-Met-Asn-Thr-Ile-Leu-Asp-Asn-Leu-Ala-Thr-Arg-Asp-Phe-Ile-Asn-Trp-Leu-Ile-Gln-Thr-Lys-Ile-Thr-Asp-OH; Glucagon-like Peptide 2 (rat); L-histidyl-L-alanyl-L-alpha-aspartyl-glycyl-L-seryl-L-phenylalanyl-L-seryl-L-alpha-aspartyl-L-alpha-glutamyl-L-methionyl-L-asparagyl-L-threonyl-L-isoleucyl-L-leucyl-L-alpha-aspartyl-L-asparagyl-L-leucyl-L-alanyl-L-threonyl-L-arginyl-L-alpha-aspartyl-L-phenylalanyl-L-isoleucyl-L-asparagyl-L-tryptophyl-L-leucyl-L-isoleucyl-L-glutaminyl-L-threonyl-L-lysyl-L-isoleucyl-L-threonyl-L-aspartic acid. Grades: ≥95%. CAS No. 195262-56-7. Molecular formula: C166H256N44O56S. Mole weight: 3796.17. | |
| GLP-2(rat) | GLP-2(rat) is an intestinal growth factor. GLP-2(rat) stimulates cell proliferation and inhibits apoptosis. GLP-2(rat) enhances mucosal mass and function in residual small intestine after massive small bowel resection (MSBR) [1] [2]. Uses: Scientific research. Group: Peptides. CAS No. 195262-56-7. Pack Sizes: 5 mg; 10 mg. Product ID: HY-P1142. | |
| GLP-2 (rat) trifluoroacetate salt | GLP-2 is a gut peptide hormone that is primarily produced by enteroendocrine L cells of the small and large intestine. GLP-2 is an antagonist of the GLP-2 receptor (GLP-2R; Ki = 60 pM). Synonyms: Glucagon-like Peptide 2. Grades: ≥95%. Molecular formula: C166H256N44O56S·xCF3COOH. Mole weight: 3796.14. | |
| GLPG-0187 | GLPG-0187 is a small molecule integrin receptor antagonist (IRA) with nanomolar affinity for the RGD-integrin receptors αvβ1, αvβ3, αvβ5, αvβ6 and α5β1 (IC50s = 1.2-3.7 nM). Integrin receptors are expressed on the surface of tumor vessel endothelial cells and some types of cancer cells, and play a crucial role in endothelial cell adhesion and migration. This compound shows an inhibitory activity of angiogenesis, bone-resorption and tumor, which is hopefully used as an anticancer drug. Uses: An integrin receptor antagonist (ira) can be used as an anticancer drug. Synonyms: GLPG0187; GLPG 0187; GLPG-0187; UNII-43A5P87Z4T; 43A5P87Z4T; SCHEMBL2372722; CHEMBL3319236; (2S) -3-[[2, 5-dimethyl-6-[4- (5, 6, 7, 8-tetrahydro-1, 8-naphthyridin-2-yl) piperidin-1-yl]pyrimidin-4-yl]amino]-2-[ (4-methoxyphenyl) sulfonylamino]propanoic acid. Grades: ≥98 %. CAS No. 1320346-97-1. Molecular formula: C29H37N7O5S. Mole weight: 595.719. | |
| GLPG0492 | GLPG0492, a selective androgen receptor modulator, could be effective in decreasing muscle loss. The treatment study against Duchenne muscular dystrophy of it has alreadt been discontinued. Uses: Glpg0492 is a selective androgen receptor modulator that could be effective in decreasing muscle loss. Synonyms: DT-200; DT 200; DT200; GLPG0492; SCHEMBL2021011; CHEMBL2178100; GLPG 0492; GLPG-0492; VAJGULUVTFDTAS-GOSISDBHSA-N. Grades: 98%. CAS No. 1215085-92-9. Molecular formula: C19H14F3N3O3. Mole weight: 389.33. | |
| GLPG0492 R enantiomer | The R-enantiomer of GLPG0492 which is a selective androgen receptor modulator, could be effective in decreasing muscle loss. Uses: The r-enantiomer of glpg0492 which is a selective androgen receptor modulator that could be effective in decreasing muscle loss. Synonyms: GLPG-0492 R enantiomer; GLPG 0492 R enantiomer; GLPG0492 R enantiomer. Grades: 98%. CAS No. 1215085-93-0. Molecular formula: C19H14F3N3O3. Mole weight: 389.33. | |
| GLPG0634 analog | GLPG0634 analog (Compoun 176) is a broad spectrum JAK inhibitor with IC 50 values of <100 nM against JAK1, JAK2 and JAK3 [1]. Uses: Scientific research. Group: Signaling pathways. CAS No. 1206101-20-3. Pack Sizes: 10 mM * 1 mL; 5 mg; 10 mg; 50 mg. Product ID: HY-13961. | |
| GLPG0634 analogue | A potent and selective JAK1 inhibitor with IC50 values of 10, 28, 810, and 116 nM for JAK1, JAK2, JAK3, and TYK2, respectively. Synonyms: GLPG0634 analog; N-[5-[4-[(6-cyanopyridin-3-yl)methoxy]phenyl]-[1,2,4]triazolo[1,5-a]pyridin-2-yl]cyclopropanecarboxamide. Grades: >98%. CAS No. 1206101-20-3. Molecular formula: C23H18N6O2. Mole weight: 410.43. | |
| GLPG 0974 | GLPG 0974 is a potent FFA2 antagonist (IC50 = 9 nM) with selectivity for FFA2 over FFA3. It was shown that GLPG 0974 inhibited acetate-induced human neutrophil migration in plasma or buffer, and also suppressed FFA2-induced expression of CD11b activation-specific epitope (AE) in human whole blood. Synonyms: GLPG0974; GLPG 0974; GLPG-0974. 4-[[[(2R)-1-(Benzo[b]thien-3-ylcarbonyl)-2-methyl-2-azetidinyl]carbonyl][(3-chlorophenyl)methyl]amino]butanoic acid. Grades: ≥98% by HPLC. CAS No. 1391076-61-1. Molecular formula: C25H25ClN2O4S. Mole weight: 485. | |
| GLPG-1690 | Cas No. 1628260-79-6. | |
| GLPG1837 | GLPG1837 is a potent, orally available potentiator of cystic fibrosis transmembrane conductance regulator (CFTR) with EC50 of 3 nM and 339 nM on F508del and G551D CFTR, respectively. Synonyms: ABBV-974; N-[3-(aminocarbonyl)-4,7-dihydro-5,5,7,7-tetramethyl-5H-thieno[2,3-c]pyran-2-yl]-1H-pyrazole-3-carboxamide. Grades: ≥98%. CAS No. 1654725-02-6. Molecular formula: C16H20N4O3S. Mole weight: 348.42. | |
| GLPG2938 | GLPG2938 is an antagonists of sphingosine-1-phosphate (S1P) receptor for prophylaxis and?/or treatment of diseases including fibrotic, inflammatory, autoimmune, metabolic, cardiovascular, and?/or proliferative diseases. GLPG2938 displayed S1P inhibitory activity.with EC50 value of 9.5 nM (S1P2 antagonist EC50)?. Uses: Designed for use in research and industrial production. Additional or Alternative Names: MUN96006; MUN-96006; MUN 96006; GLPG2938; GLPG-2938; GLPG 2938. Product Category: Antagonists. Appearance: Solid powder. CAS No. 2130996-00-6. Molecular formula: C20H19F6N7O2. Mole weight: 503.41. Purity: >98%. IUPACName: 1-(2-ethoxy-6-(trifluoromethyl)pyridin-4-yl)-3-((5-methyl-6-(1-methyl-3-(trifluoromethyl)-1H-pyrazol-4-yl)pyridazin-3-yl)methyl)urea. Canonical SMILES: O=C(NCC1=NN=C(C2=CN(C)N=C2C(F)(F)F)C(C)=C1)NC3=CC(OCC)=NC(C(F)(F)F)=C3. Product ID: ACM2130996006. Alfa Chemistry ISO 9001:2015 Certified. | |
| GLPG3667 | GLPG3667 is a reversible, ATP-competitive and orally active TYK2 inhibitor with an IC 50 of 2.3 nM. GLPG3667 inhibits IFNα/pSTAT1, and the IC 50 values ??in human peripheral blood mononuclear cell (PBMC) and whole blood assays are 70 nM and 623 nM, respectively. GLPG3667 has the potential for the study of inflammatory and autoimmune diseases [1]. Uses: Scientific research. Group: Signaling pathways. CAS No. 2308520-97-8. Pack Sizes: 1 mg; 5 mg; 10 mg; 25 mg; 50 mg; 100 mg. Product ID: HY-156961. | |
| GLS1 Inhibitor-1 | GLS1 Inhibitor-1 (Compound 27) is an orally active inhibitor for glutaminase 1 ( GLS1 ) with an IC 50 of 0.021 μM. GLS1 Inhibitor-1 inhibits the proliferation of PC-3 with an IC 50 of 0.3 nM. GLS1 Inhibitor-1 exhibits antitumor efficacy against NCI-H1703 with GI 50 of 0.011 μM. GLS1 Inhibitor-1 exhibits moderate pharmacokinetic characteristics [1]. Uses: Scientific research. Group: Signaling pathways. CAS No. 1832646-52-2. Pack Sizes: 5 mg; 10 mg. Product ID: HY-136704. | |
| Glu-14-Calcitonin | Glu-14-Calcitonin is an impurity of Calcitonin salmon, which is a calcium regulating hormone used to be an effective alternative for the treatment of postmenopausal osteoporosis. Synonyms: H-Cys-Ser-Asn-Leu-Ser-Thr-Cys-Val-Leu-Gly-Lys-Leu-Ser-Glu-Glu-Leu-His-Lys-Leu-Gln-Thr-Tyr-Pro-Arg-Thr-Asn-Thr-Gly-Ser-Gly-Thr-Pro-NH2 (Disulfide bond between Cys1 and Cys7); L-cysteinyl-L-seryl-L-asparagyl-L-leucyl-L-seryl-L-threonyl-L-cysteinyl-L-valyl-L-leucyl-glycyl-L-lysyl-L-leucyl-L-seryl-L-alpha-glutamyl-L-alpha-glutamyl-L-leucyl-L-histidyl-L-lysyl-L-leucyl-L-glutaminyl-L-threonyl-L-tyrosyl-L-prolyl-L-arginyl-L-threonyl-L-asparagyl-L-threonyl-glycyl-L-seryl-glycyl-L-threonyl-L-prolinamide (1->7)-disulfide; RPR 108969; Calcitonin (salmon), 14-L-glutamic acid-. CAS No. 187476-38-6. Molecular formula: C145H239N43O49S2. Mole weight: 3432.88. | |
| Glu-20-Calcitonin | Glu-20-Calcitonin is an impurity of Calcitonin salmon, which is a calcium regulating hormone used to be an effective alternative for the treatment of postmenopausal osteoporosis. Synonyms: H-Cys-Ser-Asn-Leu-Ser-Thr-Cys-Val-Leu-Gly-Lys-Leu-Ser-Gln-Glu-Leu-His-Lys-Leu-Glu-Thr-Tyr-Pro-Arg-Thr-Asn-Thr-Gly-Ser-Gly-Thr-Pro-NH2 (Disulfide bond between Cys1 and Cys7); L-cysteinyl-L-seryl-L-asparagyl-L-leucyl-L-seryl-L-threonyl-L-cysteinyl-L-valyl-L-leucyl-glycyl-L-lysyl-L-leucyl-L-seryl-L-glutaminyl-L-alpha-glutamyl-L-leucyl-L-histidyl-L-lysyl-L-leucyl-L-alpha-glutamyl-L-threonyl-L-tyrosyl-L-prolyl-L-arginyl-L-threonyl-L-asparagyl-L-threonyl-glycyl-L-seryl-glycyl-L-threonyl-L-prolinamide (1->7)-disulfide; RPR 108970; Calcitonin (salmon), 20-L-glutamic acid-. CAS No. 187476-39-7. Molecular formula: C145H239N43O49S2. Mole weight: 3432.88. | |
| Glu(4)-AVP | Glu4-AVP is an impurity of Vasopressin, which is an antidiuretic hormone secreted from the posterior pituitary. Synonyms: Glu(4)-Arg-Vasopressin; Glu(4)-Vasopressin; Glu4-AVP; H-Cys-Tyr-Phe-Glu-Asn-Cys-Pro-Arg-Gly-NH2 (Disulfide bridge: Cys1-Cys6); L-cysteinyl-L-tyrosyl-L-phenylalanyl-L-glutamyl-L-asparagyl-L-cysteinyl-L-prolyl-L-arginyl-glycinamide (1->6)-disulfide. CAS No. 2075712-12-6. Molecular formula: C46H64N14O13S2. Mole weight: 1085.22. | |
| Glu 4-Oxytocin | Glu 4-Oxytocin is an impurity of Oxytocin, which is a mammalian neurohypophysial hormone used as a vasodilator agent. Synonyms: L-cystyl-L-tyrosyl-L-isoleucyl-L-glutamyl-L-asparginyl-L-cystyl-L-leucyl-L-prolyl-L-glycinamide (disulfide bridge between cysteines); H-Cys-Tyr-Ile-Glu-Asn-Cys-Pro-Leu-Gly-NH2 (Disulfide bridge: Cys1-Cys6); [Glu4]-Oxytocin; L-cysteinyl-L-tyrosyl-L-isoleucyl-L-alpha-glutamyl-L-asparagyl-L-cysteinyl-L-prolyl-L-leucyl-glycinamide (1->6)-disulfide; Oxytocin, 4-L-glutamic acid-; Oxytocin, 4-glutamic acid. Grades: ≥95%. CAS No. 4314-67-4. Molecular formula: C43H65N11O13S2. Mole weight: 1008.18. | |
| Glu-Asp-OH | Synonyms: L-α-Glutamyl-L-aspartic acid. Grades: ≥ 98% (TLC). CAS No. 3918-84-1. Molecular formula: C9H14N2O7. Mole weight: 262.22. | |
| Glu-Asp-OH 98+% (TLC) | Glu-Asp-OH 98+% (TLC). Group: Biochemicals. Grades: Reagent Grade. Pack Sizes: 250mg, 1g, 2.5g. US Biological Life Sciences. |  Worldwide |
| Glubionate Calcium | Glubionate Calcium is a mineral supplement. It can be used to prevent or treat low blood calcium levels. Synonyms: Calcium glubionate; Neocalglucon. CAS No. 12569-38-9. Molecular formula: C18H34CaO20. Mole weight: 610.528. | |
| Glucagon (1-29), bovine, human | Glucagon (1-29), bovine, human, porcine is a peptide hormone, produced by pancreatic α-cells. Glucagon stimulates gluconeogenesis [1]. Glucagon (1-29), bovine, human, porcine activates HNF4α and increases HNF4α phosphorylation [2] [3]. Uses: Scientific research. Group: Peptides. Alternative Names: Glucagon. CAS No. 16941-32-5. Pack Sizes: 1 mg; 5 mg; 10 mg; 25 mg; 50 mg. Product ID: HY-P0082. | |
| Glucagon (1-29), bovine, human hydrochloride | Glucagon (1-29), bovine, human, porcine hydrochloride is a peptide hormone, produced by pancreatic α-cells. Glucagon hydrochloride stimulates gluconeogenesis [1]. Glucagon (1-29), bovine, human, porcine hydrochloride activates HNF4α and increases HNF4α phosphorylation [2] [3]. Uses: Scientific research. Group: Peptides. Alternative Names: Glucagon hydrochloride. CAS No. 28270-04-4. Pack Sizes: 1 mg; 5 mg; 10 mg. Product ID: HY-P0082A. | |
| Glucagon (19-29) (human, rat, porcine) | Glucagon is an endogenous short peptide. Synonyms: Miniglucagon (human, rat, porcine). Grades: >95%. CAS No. 64790-15-4. Molecular formula: C61H89N15O18S. Mole weight: 1352.5. | |
| Glucagon Acetate | His-Ser-Gln-Gly-Thr-Phe-Thr-Ser-Asp-Tyr-Ser-Lys-Tyr-Leu-Asp-Ser-Arg-Arg-Ala-Gln-Asp-Phe-Val-Gln-Trp-Leu-Met-Asn-Thr-OH. CAS No. 16941-32-5. Product ID: 8-04268. Molecular formula: C153H225N43O49S. Mole weight: 3482.78. Purity: 0.95. |  |
| Glucagon, human | Glucagon, human. CAS No. 16941-32-5. Product ID: 8-04266. Molecular formula: C153H225N43O49S. Mole weight: 3482.78. Purity: 0.95. Categories: Glucagon ,human. | |
| Glucagon-like peptide 1 (1-37), human | Glucagon-like peptide 1 (1-37) is a pancreatic hormone synthesized by post-translational processing of proglucagon. It decreases plasma glucose level in high-fat-fed mice when administered at 25 nmol/kg. Glucagon-like peptide 1 (1-37) exhibits no effect on food intake in rats and does not enhance pancreatic insulin secretion. However it induces insulin expression in intestinal epithelial cells, which can restore glucose homeostasis when implanted into diabetic mice. Synonyms: HuGLP-1; GLP-1 (1-37) (human, bovine, guinea pig, mouse, rat); Preproglucagon (92-128) (human, bovine, guinea pig, mouse, rat); H-His-Asp-Glu-Phe-Glu-Arg-His-Ala-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Val-Ser-Ser-Tyr-Leu-Glu-Gly-Gln-Ala-Ala-Lys-Glu-Phe-Ile-Ala-Trp-Leu-Val-Lys-Gly-Arg-Gly-OH; L-histidyl-L-alpha-aspartyl-L-alpha-glutamyl-L-phenylalanyl-L-alpha-glutamyl-L-arginyl-L-histidyl-L-alanyl-L-alpha-glutamyl-glycyl-L-threonyl-L-phenylalanyl-L-threonyl-L-seryl-L-alpha-aspartyl-L-valyl-L-seryl-L-seryl-L-tyrosyl-L-leucyl-L-alpha-glutamyl-glycyl-L-glutaminyl-L-alanyl-L-alanyl-L-lysyl-L-alpha-glutamyl-L-phenylalanyl-L-isoleucyl-L-alanyl-L-tryptophyl-L-leucyl-L-valyl-L-lysyl-glycyl-L-arginyl-glycine. Grades: ≥95%. CAS No. 87805-34-3. Molecular formula: C186H275N51O59. Mole weight: 4169.48. | |
| Glucagon-Like Peptide 1 Receptor Agonist | A nonpeptidic quinoxaline compound that acts as a GLP-1R agonist and an allosteric modulator of GLP-1 binding. Shown to induce GLP-1R-mediated cAMP production in BHK plasma membrane preparations (EC50=101nM) and potentiate glucose-dependent insulin release in pancreatic islets derived from wild-type, but not GLP-1R -/-, mice. Unlike GLP-1, its biological activity is not inhibited by orthosteric antagonists such as Exendin. Group: Biochemicals. Alternative Names: 6,7-dichloro-N-(1,1-dimethylethyl)-3-(methylsulfonyl)-, 6,7-dichloro-2-methylsulfonyl-3-N-tert-butylaminoquinoxaline (DMB); Compound 2; GLP-1R Agonist. Grades: Highly Purified. CAS No. 281209-71-0. Pack Sizes: 5mg. Molecular Formula: C??H??Cl?N?O?S, Molecular Weight: 348.3. US Biological Life Sciences. | Worldwide |
| Glucagon-Like Peptide 1 Receptor Agonist II (4- (3- (benzyloxy) phenyl) -2- (ethylsulfinyl) -6- (trifluoromethyl) pyrimidine, Glucagon-Like Peptide 1 Receptor Agonist II, Compound B) | A pyrimidine small molecule that acts as a GLP-1 allosteric agonist that induces cAMP signaling in HEK293 cells expressing the GLP-1 receptor with EC50 = 0.66uM and 99% efficacy (similar data with rat GLP-1 receptor), does not compete with radiolabelled GLP-1 in receptor binding assays, and is not active in cells expressing the GLP-2, GIP, PTH, or glucagon receptors. In rodent islets, insulin secretion increases in a dose-dependent and glucose-dependent manner, either alone or in an additive fashion when combined with the endogenous GLP-1 peptide. In vivo, this molecule exhibits insulinotropic effects when dosed at 10mg/kg in SD rats undergoing an IVGTT and a hyperglycemic clamp. It is also shown to increase insulin secretion in perifusion assays involving normal and diabetic human islets ex vivo, at concentrations between 1 and 10uM. Group: Biochemicals. Grades: Highly Purified. Pack Sizes: 10mg. US Biological Life Sciences. | Worldwide |
| Glucagon-Like Peptide (GLP) II, human | Glucagon-Like Peptide (GLP) II, human, a 33-amino acid Peptide derived from proglucagon C-terminal, is mainly produced by intestinal L cells. GLP II stimulates intestinal mucosal growth and reduces intestinal epithelial cell apoptosis. Synonyms: Glucagon-like peptide 2; H-His-Ala-Asp-Gly-Ser-Phe-Ser-Asp-Glu-Met-Asn-Thr-Ile-Leu-Asp-Asn-Leu-Ala-Ala-Arg-Asp-Phe-Ile-Asn-Trp-Leu-Ile-Gln-Thr-Lys-Ile-Thr-Asp-OH; L-histidyl-L-alanyl-L-alpha-aspartyl-glycyl-L-seryl-L-phenylalanyl-L-seryl-L-alpha-aspartyl-L-alpha-glutamyl-L-methionyl-L-asparagyl-L-threonyl-L-isoleucyl-L-leucyl-L-alpha-aspartyl-L-asparagyl-L-leucyl-L-alanyl-L-alanyl-L-arginyl-L-alpha-aspartyl-L-phenylalanyl-L-isoleucyl-L-asparagyl-L-tryptophyl-L-leucyl-L-isoleucyl-L-glutaminyl-L-threonyl-L-lysyl-L-isoleucyl-L-threonyl-L-aspartic acid; [Ala19]Glucagon-Like Peptide II, rat; GLP-2 (1-33) (human); Glucagon-Like Peptide-2 (1-33). Grades: 95%. CAS No. 89750-15-2. Molecular formula: C165H254N44O55S. Mole weight: 3766.11. | |
| Glucagon receptor antagonist-2 | Glucagon receptor antagonist-2 is a highly potent glucagon receptor antagonist. Uses: Scientific research. Group: Signaling pathways. CAS No. 202917-18-8. Pack Sizes: 10 mM * 1 mL; 5 mg; 10 mg; 25 mg; 50 mg. Product ID: HY-50158. | |
| Glucagon Receptor Antagonist I | Glucagon receptor antagonist I is a potent and competitive antagonist of the glucagon receptor (GCGR) with an IC50 value of 181 nM. Synonyms: GCGR Antagonist I; hGCGR Antagonist; N-[3-cyano-6-(1,1-dimethylpropyl)-4,5,6,7-tetrahydrobenzo[b]thien-2-yl]-2-ethyl-butanamide. Grades: ≥99%. CAS No. 438618-32-7. Molecular formula: C20H30N2OS. Mole weight: 346.5. | |
| Glucagon receptor antagonists 1 | Glucagon receptor antagonists-1 is a highly potent glucagon receptor antagonist, which is activated by glucagon and is a member of the class B G-protein coupled family of receptors. Uses: Glucagon receptor antagonist. Synonyms: glucagon receptor antagonists 1; 1-(4-(2-(Benzyloxy)-4-fluorophenyl)-2,6-diisopropyl-5-(prop-1-en-1-yl)pyridin-3-yl)ethanol; 1-[4-(4-fluoro-2-phenylmethoxyphenyl)-2,6-di(propan-2-yl)-5-[(E)-prop-1-enyl]pyridin-3-yl]ethanol. Grades: ≥95%. CAS No. 503559-84-0. Molecular formula: C29H34FNO2. Mole weight: 447.59. | |
| glucagon receptor antagonists-2 | glucagon receptor antagonists-2 is a highly potent antagonist of glucagon receptor. Synonyms: glucagon receptor antagonists 2; (6E)-3-fluoro-6-[3-[(1R)-1-hydroxyethyl]-2,6-di(propan-2-yl)-5-propyl-1H-pyridin-4-ylidene]cyclohexa-2,4-dien-1-one3-Pyridinemethanol, 4-(4-fluoro-2-hydroxyphenyl)-a-methyl-2,6-bis(1-methylethyl)-5-propyl-, (aR)-. CAS No. 202917-18-8. Molecular formula: C22H30FNO2. Mole weight: 359.48. | |
| glucagon receptor antagonists-3 | glucagon receptor antagonists-3 is a highly potent antagonist of glucagon receptor. Synonyms: glucagon receptor antagonists 3; 3-Pyridinemethanol, 4-(4-fluoro-2-hydroxyphenyl)-a-methyl-2,6-bis(1-methylethyl)-5-propyl-, (aR,4R)-rel- (9CI);(aphlaR,4R)-4-(4-Fluoro-2-hydroxyphenyl)-alpha-methyl-2,6-bis(1-methylethyl)-5-propyl-3-pyridinemethanol. CAS No. 202917-17-7. Molecular formula: C22H30FNO2. Mole weight: 359.48. | |
| glucagon receptor antagonists-4 | glucagon receptor antagonists-4 is a potent glucagon receptor antagonist with great oral bioavailability in vivo. Synonyms: PF-06291874; PF 06291874; PF06291874; PF-6291874; PF 6291874; PF6291874; glucagon receptor antagonists 4; β-Alanine, N-[4-[(1S)?-1-[3,?5-dimethyl-4-[4-(trifluoromethyl)?-1H-pyrazol-1-yl]?phenoxy]?butyl]?benzoyl]?-. CAS No. 1393124-08-7. Molecular formula: C26H28F3N3O4. Mole weight: 503.51. | |
| Glucagon (swine) | Glucagon, a peptide compound, is effective in increasing the glucose concentration in bloodstream and could be released by pancreatic α cells. Synonyms: Glucagonum; Glucagone; HG-Factor; His-ser-glu(nh2)-gly-thr-phe-thr-ser-asp-tyr-ser-lys-tyr-leu-asp-ser-arg-arg-ala-glu(NH2)-asp-phe-val-glu(NH2)-trp-leu-met-asp(NH2)-thr; Glucagon-like-immunoreactivity; Glucaton. Grades: 98%. CAS No. 16941-32-5. Molecular formula: C153H225N43O49S. Mole weight: 3482.75. | |
| glucan 1,3-α-glucosidase | Does not act on nigeran. Group: Enzymes. Synonyms: exo-1,3-α-glucanase; glucosidase II; 1,3-α-D-glucan 3-glucohydrolase. Enzyme Commission Number: EC 3.2.1.84. CAS No. 9073-99-8. Storage: Store it at +4 ?C for short term. For long term storage, store it at -20 ?C?-80 ?C. Form: Liquid or lyophilized powder. EXWM-3948; glucan 1,3-α-glucosidase; EC 3.2.1.84; 9073-99-8; exo-1,3-α-glucanase; glucosidase II; 1,3-α-D-glucan 3-glucohydrolase. Cat No: EXWM-3948. |  |
| glucan 1,3-β-glucosidase | Acts on oligosaccharides, but very slowly on laminaribiose. Group: Enzymes. Synonyms: exo-1,3-β-glucosidase; β-1,3-glucan exo-hydrolase; exo (1?3)-glucanohydrolase; 1,3-β-glucan glucohydrolase. Enzyme Commission Number: EC 3.2.1.58. CAS No. 9073-49-8. exo-1,3-β-D-Glucanase. Storage: Store it at +4 ?C for short term. For long term storage, store it at -20 ?C?-80 ?C. Form: Liquid or lyophilized powder. EXWM-3921; glucan 1,3-β-glucosidase; EC 3.2.1.58; 9073-49-8; exo-1,3-β-glucosidase; β-1,3-glucan exo-hydrolase; exo (1?3)-glucanohydrolase; 1,3-β-glucan glucohydrolase. Cat No: EXWM-3921. | |
| glucan 1,4-α-glucosidase | Most forms of the enzyme can rapidly hydrolyse 1,6-α-D-glucosidic bonds when the next bond in the sequence is 1,4, and some preparations of this enzyme hydrolyse 1,6- and 1,3-α-D-glucosidic bonds in other polysaccharides. This entry covers all such enzymes acting on polysaccharides more rapidly than on oligosaccharides. EC 3.2.1.20 α-glucosidase, from mammalian intestine, can catalyse similar reactions. Group: Enzymes. Synonyms: glucoamylase; amyloglucosidase; γ-amylase; lysosomal α-glucosidase; acid maltase; exo-1,4-α-glucosidase; glucose amylase; γ-1,4-glucan glucohydrolase; acid maltase; 1,4-α-D-glucan glucohydrolase. Enzyme Commission Number: EC 3.2.1.3. CAS No. 9032-08-0. Glucoamylase. Storage: Store it at +4 ?C for short term. For long term storage, store it at -20 ?C?-80 ?C. Form: Liquid or lyophilized powder. EXWM-3893; glucan 1,4-α-glucosidase; EC 3.2.1.3; 9032-08-0; glucoamylase; amyloglucosidase; γ-amylase; lysosomal α-glucosidase; acid maltase; exo-1,4-α-glucosidase; glucose amylase; γ-1,4-glucan glucohydrolase; acid maltase; 1,4-α-D-glucan glucohydrolase. Cat No: EXWM-3893. | |
| glucan 1,4-α-maltohexaosidase | cf. EC 3.2.1.3 glucan 1,4-α-glucosidase, which removes successive glucose residues; EC 3.2.1.2 β-amylase, which removes successive maltose residues; EC 3.2.1.116 glucan 1,4-α-maltotriohydrolase, which removes successive maltotriose units and EC 3.2.1.60 glucan 1,4-α-maltotetraohydrolase, which removes successive maltotetraose residues. The products have the α-configuration. Group: Enzymes. Synonyms: exo-maltohexaohydrolase; 1,4-α-D-glucan maltohexaohydrolase. Enzyme Commission Number: EC 3.2.1.98. CAS No. 72561-12-7. Glucan 1,4-α-maltohexaosidase. Storage: Store it at +4 ?C for short term. For long term storage, store it at -20 ?C?-80 ?C. Form: Liquid or lyophilized powder. EXWM-3961; glucan 1,4-α-maltohexaosidase; EC 3.2.1.98; 72561-12-7; exo-maltohexaohydrolase; 1,4-α-D-glucan maltohexaohydrolase. Cat No: EXWM-3961. | |
| Glucan 1,4-α-maltohexaosidase 13A from Bacillus halodurans, Recombinant | Glucan 1,4-alpha-maltohexaosidase (EC 3.2.1.98, exo-maltohexaohydrolase, 1,4-alpha-D-glucan maltohexaohydrolase) is an enzyme with systematic name 4-alpha-D-glucan maltohexaohydrolase. This enzyme catalyses the following chemical reaction: Hydrolysis of (1->4)-alpha-D-glucosidic linkages in amylaceous polysaccharides, to remove successive maltohexaose residues from the non-reducing chain ends. The products have the alpha-configuration. Group: Enzymes. Synonyms: Glucan 1,4-alpha-maltohexaosidase; EC 3.2.1.98; exo-maltohexaohydrolase; 1,4-alpha-D-glucan maltohexaohydrolase; 4-α-D-glucan maltohexaohydrolase4-α-D-glucan maltohexaohydrolase. Enzyme Commission Number: EC 3.2.1.98. CAS No. 72561-12-7. Purity: >90% by SDS-PAGE. Glucan 1,4-α-maltohexaosidase. Mole weight: 64.9 kDa. Storage: This enzyme is shipped at room temperature but should be stored at -20 °C. Form: 35 mM NaHepes buffer, pH 7.5, 750 mM NaCl, 200 mM imidazol, 3.5 mM CaCl2, 0.02% sodium azide and 25% (v/v) glycerol. Source: E. coli. Species: Bacillus halodurans. Glucan 1,4-alpha-maltohexaosidase; EC 3.2.1.98; exo-maltohexaohydrolase; 1,4-alpha-D-glucan maltohexaohydrolase; 4-α-D-glucan maltohexaohydrolase4-α-D-glucan maltohexaohydrolase. Cat No: NATE-1296. | |
| glucan 1,4-α-maltohydrolase | Acts on starch and related polysaccharides and oligosaccharides. The product is α-maltose; cf. EC 3.2.1.2 β-amylase. Group: Enzymes. Synonyms: maltogenic α-amylase; 1,4-α-D-glucan α-maltohydrolase. Enzyme Commission Number: EC 3.2.1.133. CAS No. 160611-47-2. α-Amylase. Storage: Store it at +4 ?C for short term. For long term storage, store it at -20 ?C?-80 ?C. Form: Liquid or lyophilized powder. EXWM-3816; glucan 1,4-α-maltohydrolase; EC 3.2.1.133; 160611-47-2; maltogenic α-amylase; 1,4-α-D-glucan α-maltohydrolase. Cat No: EXWM-3816. | |
| glucan 1,4-α-maltotetraohydrolase | Compare EC 3.2.1.2 β-amylase, which removes successive maltose residues, and EC 3.2.1.98 (glucan 1,4-α-maltohexaosidase) and EC 3.2.1.116 (glucan 1,4-α-maltotriohydrolase). Group: Enzymes. Synonyms: exo-maltotetraohydrolase; 1,4-α-D-glucan maltotetraohydrolase. Enzyme Commission Number: EC 3.2.1.60. CAS No. 37288-44-1. Storage: Store it at +4 ?C for short term. For long term storage, store it at -20 ?C?-80 ?C. Form: Liquid or lyophilized powder. EXWM-3924; glucan 1,4-α-maltotetraohydrolase; EC 3.2.1.60; 37288-44-1; exo-maltotetraohydrolase; 1,4-α-D-glucan maltotetraohydrolase. Cat No: EXWM-3924. | |
| glucan 1,4-α-maltotriohydrolase | cf. EC 3.2.1.2 (β-amylase), EC 3.2.1.60 (glucan 1,4-α-maltotetraohydrolase) and EC 3.2.1.98 (glucan 1,4-α-maltohexaosidase). The products have the α-configuration. Group: Enzymes. Synonyms: exo-maltotriohydrolase; maltotriohydrolase; 1,4-α-D-glucan maltotriohydrolase. Enzyme Commission Number: EC 3.2.1.116. CAS No. 91273-84-6. Storage: Store it at +4 ?C for short term. For long term storage, store it at -20 ?C?-80 ?C. Form: Liquid or lyophilized powder. EXWM-3799; glucan 1,4-α-maltotriohydrolase; EC 3.2.1.116; 91273-84-6; exo-maltotriohydrolase; maltotriohydrolase; 1,4-α-D-glucan maltotriohydrolase. Cat No: EXWM-3799. | |
| glucan 1,4-β-glucosidase | Acts on 1,4-β-D-glucans and related oligosaccharides. Cellobiose is hydrolysed, but very slowly. Group: Enzymes. Synonyms: exo-1,4-β-glucosidase; exocellulase; exo-β-1,4-glucosidase; exo-β-1,4-glucanase; β-1,4-β-glucanase; β-glucosidase; exo-1,4-β-glucanase; 1,4-β-D-glucan glucohydrolase. Enzyme Commission Number: EC 3.2.1.74. CAS No. 37288-52-1. Glucan 1,4-β-glucosidase. Storage: Store it at +4 ?C for short term. For long term storage, store it at -20 ?C?-80 ?C. Form: Liquid or lyophilized powder. EXWM-3938; glucan 1,4-β-glucosidase; EC 3.2.1.74; 37288-52-1; exo-1,4-β-glucosidase; exocellulase; exo-β-1,4-glucosidase; exo-β-1,4-glucanase; β-1,4-β-glucanase; β-glucosidase; exo-1,4-β-glucanase; 1,4-β-D-glucan glucohydrolase. Cat No: EXWM-3938. | |
| glucan 1,6-α-glucosidase | Hydrolysis is accompanied by inversion at C-1, so that new reducing ends are released in the β-configuration. Dextrans and isomaltosaccharides are hydrolysed, as is isomaltose, but very slowly. The enzyme from some sources also possesses the activity of EC 3.2.1.59 (glucan endo-1,3-α-glucosidase). Group: Enzymes. Synonyms: exo-1,6-β-glucosidase; glucodextrinase; glucan α-1,6-D-glucohydrolase. Enzyme Commission Number: EC 3.2.1.70. CAS No. 37288-48-5. Storage: Store it at +4 ?C for short term. For long term storage, store it at -20 ?C?-80 ?C. Form: Liquid or lyophilized powder. EXWM-3934; glucan 1,6-α-glucosidase; EC 3.2.1.70; 37288-48-5; exo-1,6-β-glucosidase; glucodextrinase; glucan α-1,6-D-glucohydrolase. Cat No: EXWM-3934. | |
| glucan 1,6-α-isomaltosidase | Optimum activity is on those 1,6-α-D-glucans containing 6, 7 and 8 glucose units; those containing 3, 4 and 5 glucose units are hydrolysed at slower rates. Group: Enzymes. Synonyms: exo-isomaltohydrolase; isomalto-dextranase; isomaltodextranase; G2-dextranase; 1,6-α-D-glucan isomaltohydrolase. Enzyme Commission Number: EC 3.2.1.94. CAS No. 56467-68-6. Storage: Store it at +4 ?C for short term. For long term storage, store it at -20 ?C?-80 ?C. Form: Liquid or lyophilized powder. EXWM-3957; glucan 1,6-α-isomaltosidase; EC 3.2.1.94; 56467-68-6; exo-isomaltohydrolase; isomalto-dextranase; isomaltodextranase; G2-dextranase; 1,6-α-D-glucan isomaltohydrolase. Cat No: EXWM-3957. | |
| glucan endo-1,2-β-glucosidase | Glucan endo-1,2-beta-glucosidase (EC 3.2.1.71) is an enzyme with systematic name 2-beta-D-glucan glucanohydrolase. Group: Enzymes. Synonyms: endo-1,2-β-glucanase; β-D-1,2-glucanase; endo-(1?2)-β-D-glucanase; 1,2-β-D-glucan glucanohydrolase. Enzyme Commission Number: EC 3.2.1.71. CAS No. 37288-49-6. Storage: Store it at +4 ?C for short term. For long term storage, store it at -20 ?C?-80 ?C. Form: Liquid or lyophilized powder. EXWM-3935; glucan endo-1,2-β-glucosidase; EC 3.2.1.71; 37288-49-6; endo-1,2-β-glucanase; β-D-1,2-glucanase; endo-(1?2)-β-D-glucanase; 1,2-β-D-glucan glucanohydrolase. Cat No: EXWM-3935. | |
| glucan endo-1,3-α-glucosidase | Products from pseudonigeran (1,3-α-D-glucan) are nigerose and α-D-glucose. Group: Enzymes. Synonyms: endo-1,3-α-glucanase; mutanase; endo-(1?3)-α-glucanase; cariogenase; cariogenanase; endo-1,3-α-D-glucanase; 1,3(1,3;1,4)-α-D-glucan 3-glucanohydrolase. Enzyme Commission Number: EC 3.2.1.59. CAS No. 9075-84-7. Storage: Store it at +4 ?C for short term. For long term storage, store it at -20 ?C?-80 ?C. Form: Liquid or lyophilized powder. EXWM-3922; glucan endo-1,3-α-glucosidase; EC 3.2.1.59; 9075-84-7; endo-1,3-α-glucanase; mutanase; endo-(1?3)-α-glucanase; cariogenase; cariogenanase; endo-1,3-α-D-glucanase; 1,3(1,3;1,4)-α-D-glucan 3-glucanohydrolase. Cat No: EXWM-3922. | |
| Glucan endo-1,3-b-D-glucosidase | Glucan endo-1,3-b-D-glucosidase. Uses: Designed for use in research and industrial production. Appearance: solid. CAS No. 9025-37-0. Purity: 0.96. Product ID: ACM9025370. Alfa Chemistry ISO 9001:2015 Certified. Categories: Glucan endo-1,3-β-D-glucosidase. | |
| glucan endo-1,3-β-D-glucosidase | Different from EC 3.2.1.6 endo-1,3(4)-β-glucanase. Very limited action on mixed-link (1?3,1?4)-β-D-glucans. Hydrolyses laminarin, paramylon and pachyman. Group: Enzymes. Synonyms: endo-1,3-β-glucanase; laminarinase; laminaranase; oligo-1,3-glucosidase; endo-1,3-β-glucanase; callase; β-1,3-glucanase; kitalase; 1,3-β-D-glucan 3-glucanohydrolase; endo-(1,3)-β-D-glucanase; (1?3)-β-glucan 3-glucanohydrolase; endo-1,3-β-D-glucanase; endo-1,3-β-glucosidase; 1,3-β-D-glucan glucanohydrolase. Enzyme Commission Number: EC 3.2.1.39. CAS No. 9025-37-0. Glucanase. Storage: Store it at +4 ?C for short term. For long term storage, store it at -20 ?C?-80 ?C. Form: Liquid or lyophilized powder. EXWM-3901; glucan endo-1,3-β-D-glucosidase; EC 3.2.1.39; 9025-37-0; endo-1,3-β-glucanase; laminarinase; laminaranase; oligo-1,3-glucosidase; endo-1,3-β-glucanase; callase; β-1,3-glucanase; kitalase; 1,3-β-D-glucan 3-glucanohydrolase; endo-(1,3)-β-D-glucanase; (1?3)-β-glucan 3-glucanohydrolase; endo-1,3-β-D-glucanase; endo-1,3-β-glucosidase; 1,3-β-D-glucan glucanohydrolase. Cat No: EXWM-3901. | |
| glucan endo-1,6-β-glucosidase | Acts on lutean, pustulan and 1,6-oligo-β-D-glucosides. Group: Enzymes. Synonyms: endo-1,6-β-glucanase; β-1?6)-β-D-glucanase; β-1,6-glucanase-pustulanase; β-1,6-glucan hydrolase; β-1,6-glucan 6-glucanohydrolase; 1,6-β-D-glucan glucanohydrolase. Enzyme Commission Number: EC 3.2.1.75. CAS No. 37278-39-0. Pustulanase. Storage: Store it at +4 ?C for short term. For long term storage, store it at -20 ?C?-80 ?C. Form: Liquid or lyophilized powder. EXWM-3939; glucan endo-1,6-β-glucosidase; EC 3.2.1.75; 37278-39-0; endo-1,6-β-glucanase; β-1?6)-β-D-glucanase; β-1,6-glucanase-pustulanase; β-1,6-glucan hydrolase; β-1,6-glucan 6-glucanohydrolase; 1,6-β-D-glucan glucanohydrolase. Cat No: EXWM-3939. | |
| Glucan from Black Yeast | Glucan from Black Yeast. Group: Polymers. CAS No. 9012-72-0. Product ID: (2S,3R,4S,5S,6R)-2-[(2R,4R,5R,6S)-4,5-dihydroxy-2-(hydroxymethyl)-6-[(2R,4R,5R,6S)-4,5,6-trihydroxy-2-(hydroxymethyl)oxan-3-yl]oxyoxan-3-yl]oxy-6-(hydroxymethyl)oxane-3,4,5-triol. Molecular formula: 504.4g/mol. Mole weight: C18H32O16. C (C1C (C (C (C (O1)OC2C (OC (C (C2O)O)OC3C (OC (C (C3O)O)O)CO)CO)O)O)O)O. InChI=1S/C18H32O16/c19-1-4-7 (22)8 (23)12 (27)17 (31-4)34-15-6 (3-21)32-18 (13 (28)10 (15)25)33-14-5 (2-20)30-16 (29)11 (26)9 (14)24/h4-29H, 1-3H2/t4-, 5-, 6-, 7-, 8+, 9-, 10-, 11-, 12-, 13-, 14?, 15?, 16+, 17+, 18+/m1/s1. FYGDTMLNYKFZSV-URKRLVJHSA-N. |  |
| Glucanotransferase (Crude Enzyme) | This product with the indicated enzyme activity was briefly purified from engineered E. coli. Group: Enzymes. Enzyme Commission Number: EC 2.4.x.y. Activity: Undetermined. Appearance: Clear to translucent yellow solution. Storage: at -20 °C or lower, for at least 1 month. Source: E. coli. Glucanotransferase. Pack: 100ml. Cat No: NATE-1815. | |
| Glucansucrase 70B from Streptococcus mutans, Recombinant | A moderately thermostable Glucansucrase (4,6-Alpha-Glucanotransferase, reuteransucrase). The enzyme transfers glucose units from sucrose to make a highly branched, high molecular weight alpha-D-Glucan with α (1?4) glucosidic linkages and also some α (1?6) linked glucosyl units. Group: Enzymes. Synonyms: Alpha-glucanotransferase; glucosyltransferase; 4,6-alpha-Glucanotransferase; EC 2.4.1.-. Enzyme Commission Number: EC 2.4.1.5. CAS No. 9032-14-8. Purity: >90% by SDS-PAGE. Glucansucrase. Mole weight: 99.6 kDa. Storage: This enzyme is shipped at room temperature but should be stored at -20 °C. Form: 35 mM NaHepes buffer, pH 7.5, 750 mM NaCl, 200 mM imidazol, 3.5 mM CaCl2, 0.02% sodium azide and 25% (v/v) glycerol. Source: E. coli. Species: Streptococcus mutans. Alpha-glucanotransferase; glucosyltransferase; 4,6-alpha-Glucanotransferase; EC 2.4.1.5; Glucansucrase 70B. Cat No: NATE-1383. | |
| Glucansucrase 70C from Streptococcus mutans, Recombinant | A moderately thermostable Glucansucrase (4,6-Alpha-Glucanotransferase, reuteransucrase). The enzyme transfers glucose units from sucrose to make a highly branched, high molecular weight alpha-D-Glucan with α (1?4) glucosidic linkages and also some α (1?6) linked glucosyl units. Group: Enzymes. Synonyms: Alpha-glucanotransferase; glucosyltransferase; 4,6-alpha-Glucanotransferase; EC 2.4.1.-. Enzyme Commission Number: EC 2.4.1.5. CAS No. 9032-14-8. Purity: >90% by SDS-PAGE. Glucansucrase. Mole weight: 98.9 kDa. Storage: This enzyme is shipped at room temperature but should be stored at -20 °C. Form: 35 mM NaHepes buffer, pH 7.5, 750 mM NaCl, 200 mM imidazol, 3.5 mM CaCl2, 0.02% sodium azide and 25% (v/v) glycerol. Source: E. coli. Species: Streptococcus mutans. Alpha-glucanotransferase; glucosyltransferase; 4,6-alpha-Glucanotransferase; EC 2.4.1.5; Glucansucrase 70C. Cat No: NATE-1382. | |
| Glucansucrase 70D from Streptococcus mutans, Recombinant | A moderately thermostable Glucansucrase (4,6-Alpha-Glucanotransferase, reuteransucrase). The enzyme transfers glucose units from sucrose to make a highly branched, high molecular weight alpha-D-Glucan with α (1?4) glucosidic linkages and also some α (1?6) linked glucosyl units. Group: Enzymes. Synonyms: Alpha-glucanotransferase; glucosyltransferase; 4,6-alpha-Glucanotransferase; EC 2.4.1.-. Enzyme Commission Number: EC 2.4.1.5. CAS No. 9032-14-8. Purity: >90% by SDS-PAGE. Glucansucrase. Mole weight: 98.5 kDa. Storage: This enzyme is shipped at room temperature but should be stored at -20 °C. Form: 35 mM NaHepes buffer, pH 7.5, 750 mM NaCl, 200 mM imidazol, 3.5 mM CaCl2, 0.02% sodium azide and 25% (v/v) glycerol. Source: E. coli. Species: Streptococcus mutans. Alpha-glucanotransferase; glucosyltransferase; 4,6-alpha-Glucanotransferase; EC 2.4.1.5; Glucansucrase 70D. Cat No: NATE-1381. | |
Our database is helping our users find suppliers everyday.
