A directory of where to buy chemicals in the USA, including: distributors, industrial manufacturers, bulk supplies and wholesalers of raw ingredients & finished goods.
Search for products or services, then visit the suppliers website for prices or more information.
| Product | Description | |
|---|---|---|
| Globo-H hexasaccharide-sp-biotin | Globo-H Hexasaccharide-sp-biotin is a biomedical product used to aid in the treatment and detection of certain types of cancer, particularly breast and ovarian cancer. It acts as a therapeutic agent by targeting and delivering drugs to cancer cells while sparing healthy cells. Additionally, it serves as a diagnostic tool by enabling the visualization of cancer cells through a process known as immunoassay. Synonyms: Globo-H Hexaose-b-NAc-Spacer-biotin. Grades: 90%. Molecular formula: C61H102N8O35S. Mole weight: 1539.56. |  |
| Globo H pentenyl glycoside | Cas No. 284663-02-1. | |
| Globoisotetraose | Globoisotetraose is an extensively utilized synthetic compound, showcasing considerable potential in the precise targeting of tumor-associated carbohydrate antigens, with specific emphasis on the Globo H antigen, for the research of cancer. Synonyms: Isoglobotetraose; O-2-(Acetylamino)-2-deoxy-b-D-galactopyranosyl-(1?3)-O-a-D-galactopyranosyl-(1?3)-O-b-D-galactopyranosyl-(1?4)-D-glucose. CAS No. 75645-26-0. Molecular formula: C26H45NO21. Mole weight: 707.63. | |
| Globo-N-tetraose | Globo-N-tetraose is a potential compound exhibiting promising properties in the research of cancer, specifically in targeting cancer cells expressing the Globo H antigen. By blocking the interaction between Globo H and corresponding antibodies, Globo-N-tetraose shows potential as an antitumor compound. Synonyms: GalNAc-b-1,3-Gal-a-1,4-Gal-b-1,4-Glc. CAS No. 75660-79-6. Molecular formula: C26H45NO21. Mole weight: 707.63. | |
| Globo-N-tetraose-APD-HSA | | |
| Globo-N-tetraose GEL | | |
| Globopentaose | Globopentaose is a remarkable carbohydrate compound used for studying gastrointestinal afflictions, ranging from the debilitating grasp of inflammatory bowel syndrome to the treacherous clutches of bacterial invasions. Synonyms: Gal-b-1,3-GalNAc-b-1,3-Gal-a-1,4-Gal-b-1,4-Glc; SSEA-3a. CAS No. 71937-76-3. Molecular formula: C32H55NO26. Mole weight: 869.77. | |
| Globoside | Globoside is a glycosphingolipid abundantly present in human erythrocytes and diverse tissues, exhibiting multifaceted roles as a microbial toxin receptor and a regulator of cell adhesion and signal transduction. Synonyms: Globotetraosylceramide; Cytolipins; GlcNAc (b1-3)Gal (a1-4) Gal (b1-4) Glc b1-1 Cer. CAS No. 11034-93-8. Molecular formula: C56H102N2O23. Mole weight: 1171.41. | |
| globoside α-N-acetylgalactosaminyltransferase | This enzyme belongs to the family of glycosyltransferases, specifically the hexosyltransferases. Group: Enzymes. Synonyms: uridine diphosphoacetylgalactosamine-globoside α-acetylgalactosaminyltransferase; Forssman synthase; globoside acetylgalactosaminyltransferase; UDP-N-acetyl-D-galactosamine:N-acetyl-D-galactosaminyl-1,3-D-galactosyl-1,4-D-galactosyl-1,4-D-glucosylceramide α-N-acetyl-D-galactosaminyltransferase; UDP-N-acetyl-D-galactosamine:N-acetyl-D-galactosaminyl-(1?3)-D-galactosyl-(1?4)-D-galactosyl-(1?4)-D-glucosyl-(1<->1)-ceramide α-N-ace. Enzyme Commission Number: EC 2.4.1.88. CAS No. 52037-97-5. Storage: Store it at +4 ?C for short term. For long term storage, store it at -20 ?C?-80 ?C. Form: Liquid or lyophilized powder. EXWM-2628; globoside α-N-acetylgalactosaminyltransferase; EC 2.4.1.88; 52037-97-5; uridine diphosphoacetylgalactosamine-globoside α-acetylgalactosaminyltransferase; Forssman synthase; globoside acetylgalactosaminyltransferase; UDP-N-acetyl-D-galactosamine:N-acetyl-D-galactosaminyl-1,3-D-galactosyl-1,4-D-galactosyl-1,4-D-glucosylceramide α-N-acetyl-D-galactosaminyltransferase; UDP-N-acetyl-D-galactosamine:N-acetyl-D-galactosaminyl-(1?3)-D-galactosyl-(1?4)-D-galactosyl-(1?4)-D-glucosyl-(1<->1)-ceramide α-N-acetyl-D-galactosaminyltransferase. Cat No: EXWM-2628. |  |
| Globosuxanthone A | Globosuxanthone A is a fungal metabolite isolated from C. globosum which is a well-known mesophilic member of the mold family Chaetomiaceae. Globosuxanthone A is cytotoxic to various human solid tumor cell lines, including MCF-7, PC3, LNCap and DU145 cells. Synonyms: (1R,2R)-2,9-dihydro-1,2,8-trihydroxy-9-oxo-1H-xanthene-1-carboxylic acid, methyl ester; rel-methyl (1R,2R)-1,2,8-trihydroxy-9-oxo-2,9-dihydro-1H-xanthene-1-carboxylate. Grades: ≥95%. CAS No. 917091-74-8. Molecular formula: C15H12O7. Mole weight: 304.25. | |
| Globotriaosylceramide | Globotriaosylceramide is a synthetic compound utilized for studying Anderson-Fabry disease. Acting as a substrate for enzymes, it aids in the research of this lysosomal storage disorder. Synonyms: Gb3; a-D-Gal-(1?4)-b-D-Gal-(1?4)-b-D-Glc-1?O-ceramide; Ceramide trihexosides. CAS No. 71965-57-6. Molecular formula: C60H113NO18. Mole weight: 1136.54. | |
| globotriaosylceramide 3-β-N-acetylgalactosaminyltransferase | Globoside is a neutral glycosphingolipid in human erythrocytes and has blood-group-P-antigen activity. The enzyme requires a divalent cation for activity, with Mn2+ required for maximal activity. UDP-GalNAc is the only sugar donor that is used efficiently by the enzyme: UDP-Gal and UDP-GlcNAc result in very low enzyme activity. Lactosylceramide, globoside and gangliosides GM3 and GD3 are not substrates. For explanation of the superscripted '3' in the systematic name, see GL-5.3.4. Group: Enzymes. Synonyms: uridine diphosphoacetylgalactosamine-galactosylgalactosylglucosylceramide acetylgalactosaminyltransferase; globoside synthetase; UDP-N-acetylgalactosamine: globotriaosylceramide β-3-N-acetylgalactosaminyltransferase; galactosylgalactosylglucosylceramide β-D-acetylgalactosaminyltransferase; UDP-N-acetylgalactosamine: globotriaosylceramide β1,3-N-acetylgalactosaminyltrans. Enzyme Commission Number: EC 2.4.1.79. CAS No. 62213-46-1. Storage: Store it at +4 ?C for short term. For long term storage, store it at -20 ?C?-80 ?C. Form: Liquid or lyophilized powder. EXWM-2619; globotriaosylceramide 3-β-N-acetylgalactosaminyltransferase; EC 2.4.1.79; 62213-46-1; uridine diphosphoacetylgalactosamine-galactosylgalactosylglucosylceramide acetylgalactosaminyltransferase; globoside synthetase; UDP-N-acetylgala | |
| Globotriaosylsphingosine | Globotriaosylsphingosine (lyso-Gb3) inhibits the growth of fibroblasts, as well as their differentiation into myofibroblasts, and collagen expression. Globotriaosylsphingosine can be used for Fabry disease research [1]. Uses: Scientific research. Group: Natural products. Alternative Names: lyso-Gb3. CAS No. 126550-86-5. Pack Sizes: 1 mg; 5 mg. Product ID: HY-N12408. |  |
| Globotriaosylsphingosine | Globotriaosylsphingosine, or Gb3, is a crucial biomarker used in the biomedical industry to diagnose and monitor the progression of Fabry disease. This rare genetic disorder results from the deficiency of a specific enzyme, leading to the abnormal accumulation of Gb3 within various organs. Precise and sensitive detection of Gb3 helps physicians determine the severity of Fabry disease and devise personalized treatment plans accordingly. Synonyms: a-D-Gal-(1?4)-b-D-Gal-(1?4)-b-D-Glc-1?O-sphingosine; Lysoglobotriaosylceramide; Ceramide trihexoside; lysoGb3. Grades: >99%. CAS No. 126550-86-5. Molecular formula: C36H67NO17. Mole weight: 785.91. | |
| Globotriose | Globotriose is a carbohydrate product used in biomedicine to study the role of glycolipids in various diseases and drug development. It is commonly utilized as a mimic to study the biological interactions with globotriaosylceramide (Gb3), which is involved in the progression of certain infections, such as E. coli and Shiga toxin-producing bacteria. Globotriose provides valuable insights into the development of therapeutics targeting Gb3-mediated diseases. Synonyms: 4-O-(4-O-α-D-Galactopyranosyl-β-D-galactopyranosyl)-D-glucopyranose; Gal-a-1,4-Gal-b-1,4-Glc; pk-Antigen; Globotriaose; O-α-D-Galactopyranosyl-(1?4)-O-β-D-galactopyranosyl-(1?4)-D-glucose; alpha-D-Gal-(1->4)-beta-D-Gal-(1->4)-D-Glc; alpha-D-Galp-(1->4)-beta-D-Galp-(1->4)-D-Glcp; Globotriose. Grades: ≥95%. CAS No. 66580-68-5. Molecular formula: C18H32O16. Mole weight: 504.44. | |
| Globotriose 2-(2-carboxyethylthio)ethane | Globotriose 2-(2-carboxyethylthio)ethane is an extensively employed compound, serving as a cornerstone for research purposes in various ailments including hemolytic uremic syndrome and Escherichia coli-induced bacterial infections. Synonyms: 2-(2-Carboxyethylthio)-ethyl 4-O-[4-O(a-D-galactopyranosyl)-b-D-galactopyranosyl]-b-D-glucopyranoside. Molecular formula: C23H40O18S. Mole weight: 636.62. | |
| Globotriose-APE-HSA | | |
| Globotriose-GEL | | |
| Globotriose-HSA | | |
| Globotriose-HSA (3 atom spacer) | Globotriose-HSA (3 atom spacer) is a potential therapeutic agent used in the treatment of shiga toxin-producing E. coli infections. It comprises a synthetic molecule made of three sugar molecules connected to human serum albumin with a three-atom spacer. The compound can bind to the shiga toxin produced by E. coli, preventing it from attaching to cell receptors and causing damage to vital organs. | |
| Globotriose-sp-biotin | Globotriose-sp-biotin is a crucial component utilized for studying and detecting diseases caused by certain strains of Escherichia coli bacteria. As a specific ligand, it enhances the identification and quantification of bacterial binding to cell surfaces, aiding in the research of infections caused by these pathogens. Synonyms: Gala1-4Galb1-4Glcb-OCH2CH2NH-biotin. | |
| Glochidiol | Glochidiol is an orally active tubulin polymerization inhibitor with an IC50 of 2.76 μM. Glochidiol shows anti-cancer activity. Group: Inhibitors. CAS No. 6610-56-6. Molecular formula: C30H50O2. Mole weight: 442.7. Appearance: Powder. Purity: 0.98. IUPACName: (1R, 3aR, 5aR, 5bR, 7aS, 9R, 11R, 11aR, 11bS, 13aR, 13bR)-3a, 5a, 5b, 8, 8, 11a-hexamethyl-1-prop-1-en-2-yl-1, 2, 3, 4, 5, 6, 7, 7a, 9, 10, 11, 11b, 12, 13, 13a, 13b-hexadecahydrocyclopenta[a]chrysene-9, 11-diol. Canonical SMILES: CC (=C)C1CCC2 (C1C3CCC4C (C3 (CC2)C) (CCC5C4 (C (CC (C5 (C)C)O)O)C)C)C. Catalog: ACM6610566. |  |
| Glofitamab | Glofitamab (RO7082859) is a T-cell-engaging bispecific antibody possessing a novel 2:1 structure with bivalency for CD20 on B cells and monovalency for CD3 on T cells. Glofitamab leads to T-cell activation, proliferation, and tumor cell killing upon binding to CD20 on malignant cells. Glofitamab induces durable complete remissions in relapsed or refractory B-Cell non-Hodgkin lymphoma (B-NHL) [1] [2] [3] [4]. Uses: Scientific research. Group: Inhibitory antibodies. Alternative Names: RO7082859. CAS No. 2229047-91-8. Pack Sizes: 1 mg; 5 mg; 10 mg. Product ID: HY-P99024. | |
| Glofitamab | Glofitamab is a T-cell-engaging bispecific antibody possessing a novel 2:1 structure with bivalency for CD20 on B cells and monovalency for CD3 on T cells. Glofitamab is used as an effective therapy for relapsed or refractory diffuse large B-cell lymphoma. Synonyms: RO7082859; RG6026. CAS No. 2229047-91-8. | |
| Glogotriaosylsphingosine from porcine blood | Heterocyclic Organic Compound. Alternative Names: Lysogb3, Gb3 Lysosphingolipid, nchembio.191-comp3, Globotriaosyl lysosphingolipid, CID6449939, (R-(R*,S*-(E)))-2-Amino-3-hydroxy-4-octadecenyl O-alpha-D-galactopyranosyl-(1-4)-O-beta-D-galctopyranosyl-(1-4)-beta-D-glucopyranoside, 126550-86-5, alpha-D-Galactopyranosyl-(1,4)-beta-D-galactopyranosyl-(1,4)-beta-D-glucopyranosyl-(1,1)-(2S,3R,4E)-2-amino-octadec-4-ene-1,3-diol, beta-D-Glucopyranoside, 2-amino-3-hydroxy-4-octadecenyl O-alpha-D-galactopyranosyl-(1-4)-O-beta-D-galctopyranosyl-(1-4)-, (R-(R*,S*-(E)))-. CAS No. 126550-86-5. Molecular formula: C36H67NO17. Mole weight: 785.91. Purity: 0.96. IUPACName: (2R,3R,4S,5R,6R)-2-[(2R,3R,4R,5R,6S)-6-[(2R,3S,4R,5R,6R)-6-[(E,2S,3R)-2-amino-3-hydroxyoctadec-4-enoxy]-4,5-dihydroxy-2-(hydroxymethyl)oxan-3-yl]oxy-4,5-dihydroxy-2-(hydroxymethyl)oxan-3-yl]oxy-6-(hydroxymethyl)oxane-3,4,5-triol. Density: 1.37g/cm³. Catalog: ACM126550865. | |
| Glomecidin | It is produced by the strain of Streptomyces lavendulae H698 SY2. It has antibacterial activity on several plant pathogenic fungi, including Glomerella cingulata, Colletotrichum gloeosporioides and C. lagenarium with MIC (μg/mL) of 0.78, 0.78 and 1.56, respectively. It has no effect on other fungi, yeast and bacteria. Molecular formula: C27H37N7O7. Mole weight: 571.62. | |
| Glomellic acid | Synonyms: Benzoic acid, 2-hydroxy-4-[[2-hydroxy-4-methoxy-6-(2-oxopentyl)benzoyl]oxy]-6-(2-oxopentyl)-; Glomellsaeure. CAS No. 52589-14-7. Molecular formula: C25H28O9. Mole weight: 472.48. | |
| Glomelliferonic acid | Glomelliferonic acid is a depside from the Lichen Neofuscelia subincerta. Synonyms: ACMC-20miur; 11H-Dibenzo[b,e][1,4]dioxepin-7-carboxylic acid, 8-hydroxy-3-methoxy-11-oxo-1-(2-oxopentyl)-6-pentyl-; 8-Hydroxy-3-methoxy-11-oxo-1-(2-oxopentyl)-6-pentyl-11H-dibenzo[b,e][1,4]dioxepine-7-carboxylic acid. CAS No. 113706-23-3. Molecular formula: C25H28O8. Mole weight: 456.48. | |
| Glomeratose A | Botanical Source: Group: Biochemicals. Grades: Plant Grade. CAS No. 202471-84-9. Pack Sizes: 10mg, 20mg. US Biological Life Sciences. |  Worldwide |
| Glomeratose A | Glomeratose A is a phenylpropanoid isolated from Polygala tenuifolia. Synonyms: GlomeratoseA; BCP25315; FT-0777097. Grades: 98%. CAS No. 202471-84-9. Molecular formula: C24H34O15. Mole weight: 562.52. | |
| Glomerular Microvascular Endothelial Cells, Human (Frozen) | Passage 2 cells are shipped in proliferating culture with a confluence of >90%. ENDO-Growth medium containing 5% serum and growth supplement is recommended for culture. Cells have an average population doubling level of >16 when cultured. Group: Biologicals. Grades: Cell Culture Grade. Pack Sizes: 1ml. US Biological Life Sciences. | Worldwide |
| Glomerular Microvascular Endothelial Cells, Human (T-25 flask) | Passage 2 cells are shipped in proliferating culture with a confluence of >90%. ENDO-Growth medium containing 5% serum and growth supplement is recommended for culture. Cells have an average population doubling level of >16 when cultured. Group: Biologicals. Grades: Cell Culture Grade. Pack Sizes: T-25 flask. US Biological Life Sciences. | Worldwide |
| Glomosporin | It is produced by the strain of Glomospora sp. BAUA 2825. It is a cyclic ester peptide antifungal antibiotic, and it has moderate anti-aspergillus flavus (including aspergillus Niger and Aspergillus Niger), yeast activity (MIC is 16 μg/mL). Synonyms: [(3R,18R)-9,12-bis(2-amino-2-oxoethyl)-3-[(1R)-1-hydroxyethyl]-6,21-bis(hydroxymethyl)-25-(2-hydroxytetradecan-2-yl)-18-methyl-2,5,8,11,14,17,20,23-octaoxo-1-oxa-4,7,10,13,16,19,22-heptaazacyclopentacosan-15-yl]acetic acid. CAS No. 288631-37-8. Molecular formula: C42H71N9O17. Mole weight: 974.06. | |
| GlowDot | GlowDot. Uses: Cell imaging, ph sensing, fluorescence, drug delivery and etc. Group: other quantum dots. |  |
| Gloxazone | Gloxazone is an effective anaplasmacide. Group: Inhibitors. Alternative Names: Contrapar, Gloxazon, GLOXAZONE, KTS, pharmaceutical, Kethoxal bis(thiosemicarbazone), NSC82116, AIDS125723, AIDS-125723, BW 356C61, CID9571200, KC 1331, WR 9838, (1-Ethoxyethyl)glyoxal bis(thiosemicarbazone). alpha.-Ethoxyethylglyoxal dithiosemicarbazone, 3-Ethoxy-2-oxobutyraldehyde bis(thiosemicarbazone), Butyraldehyde, 3-ethoxy-2-oxo-, bis(thiosemicarbazone), 2-((Aminocarbothioyl)hydrazono)-3-ethoxybutanal thiosemicarbazone, Butyraldehyde, 3-ethoxy-2-oxo-, bis(thiosemicarbazone, hemihydrate, 2507-91-7, Hydrazinecarbothioamide, 2, {2-[1-(1-ethoxyethyl)-1,2-ethanediylidene]bis-}. CAS No. 2507-91-7. Molecular formula: C8H16N6OS2. Mole weight: 276.38. Appearance: Solid. Purity: 0.96. IUPACName: [(E)-[(1E)-1-(carbamothioylhydrazinylidene)-3-ethoxybutan-2-ylidene]amino]thiourea. Canonical SMILES: CC(C(/C=N/NC(N)=S)=N\NC(N)=S)OCC. Density: 1.41g/cm³. Catalog: ACM2507917. | |
| GLP-1 (1-36) amide (human, bovine, guinea pig, mouse, rat) | GLP-1 (1-36) amide is a promising peptide hormone unlocking avenues for type 2 diabetes mellitus research. Its extraordinary resemblance to the native GLP-1 facilitates heightened glucose-dependent insulin secretion. Synonyms: Preproglucagon (92-127) amide (human, bovine, guinea pig, mouse, rat); Glucagon-like peptide 1 (1-36) amide (human, bovine, guinea pig, mouse, rat); H-His-Asp-Glu-Phe-Glu-Arg-His-Ala-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Val-Ser-Ser-Tyr-Leu-Glu-Gly-Gln-Ala-Ala-Lys-Glu-Phe-Ile-Ala-Trp-Leu-Val-Lys-Gly-Arg-NH2; L-histidyl-L-alpha-aspartyl-L-alpha-glutamyl-L-phenylalanyl-L-alpha-glutamyl-L-arginyl-L-histidyl-L-alanyl-L-alpha-glutamyl-glycyl-L-threonyl-L-phenylalanyl-L-threonyl-L-seryl-L-alpha-aspartyl-L-valyl-L-seryl-L-seryl-L-tyrosyl-L-leucyl-L-alpha-glutamyl-glycyl-L-glutaminyl-L-alanyl-L-alanyl-L-lysyl-L-alpha-glutamyl-L-phenylalanyl-L-isoleucyl-L-alanyl-L-tryptophyl-L-leucyl-L-valyl-L-lysyl-glycyl-L-argininamide. Grades: ≥95%. CAS No. 99658-04-5. Molecular formula: C184H273N51O57. Mole weight: 4111.44. | |
| GLP-1(32-36)amide | GLP-1(32-36)amide, a pentapeptide, derived from the C terminus of the glucoregulatory hormone GLP-1. GLP-1(32-36)amide could inhibit weight gain and modulate whole body glucose metabolism in diabetic mice [1] [2]. Uses: Scientific research. Group: Peptides. CAS No. 1417302-71-6. Pack Sizes: 5 mg; 10 mg. Product ID: HY-P3102. | |
| GLP-1(7-36) amide | GLP-1(7-36) amide is a glucose-dependent insulinotropic peptide displaying high affinity for GLP-1 receptors expressed in rat insulinoma-derived RINm5F cells (Kd = 204 pM). GLP-1 (7-36) amide exhibits antiapoptotic effects in hippocampal neurons and reduces food intake in fasted rats following central administration. Synonyms: GLP-1; GLP-1 (7-36) amide; Insulinotropin. Grades: 98%. CAS No. 107444-51-9. Molecular formula: C149H226N40O45. Mole weight: 3297.67. | |
| GLP-1(7-36), amide | GLP-1(7-36), amide is a physiological incretin hormone that stimulates insulin secretion. Uses: Scientific research. Group: Peptides. Alternative Names: Glucagon-like peptide-1 (GLP-1)(7-36), amide; Human GLP-1 (7-36), amide. CAS No. 107444-51-9. Pack Sizes: 1 mg. Product ID: HY-P0054A. | |
| GLP-1(7-36), amide acetate | GLP-1(7-36), amide acetate is a major intestinal hormone that stimulates glucose-induced insulin secretion from β cells. Uses: Scientific research. Group: Peptides. Alternative Names: Glucagon-like peptide-1 (GLP-1)(7-36), amide acetate; Human GLP-1 (7-36), amide acetate. CAS No. 1119517-19-9. Pack Sizes: 500 μg; 1 mg; 5 mg; 10 mg. Product ID: HY-P0054. | |
| GLP-1 (7-36) amide (chicken, common turkey) | Synonyms: Preproglucagon (118-147) amide (chicken, common turkey); H-His-Ala-Glu-Gly-Thr-Tyr-Thr-Ser-Asp-Ile-Thr-Ser-Tyr-Leu-Glu-Gly-Gln-Ala-Ala-Lys-Glu-Phe-Ile-Ala-Trp-Leu-Val-Asn-Gly-Arg-NH2; L-histidyl-L-alanyl-L-alpha-glutamyl-glycyl-L-threonyl-L-tyrosyl-L-threonyl-L-seryl-L-alpha-aspartyl-L-isoleucyl-L-threonyl-L-seryl-L-tyrosyl-L-leucyl-L-alpha-glutamyl-glycyl-L-glutaminyl-L-alanyl-L-alanyl-L-lysyl-L-alpha-glutamyl-L-phenylalanyl-L-isoleucyl-L-alanyl-L-tryptophyl-L-leucyl-L-valyl-L-asparagyl-glycyl-L-argininamide; Glucagon-Like Peptide 1 (7-36) amide (chicken, common turkey). Grades: ≥95% by HPLC. CAS No. 1802078-26-7. Molecular formula: C149H224N40O47. Mole weight: 3327.66. | |
| GLP-1 (7-36) amide trifluoroacetate salt | GLP-1 (7-36) amide is an important peptide hormone that displays a strong insulinotropic effect. It binds the GLP-1 receptor (pIC50 = 8.5) in the pancreas and shows various antidiabetic effects. Synonyms: Glucagon-like Peptide 1 (7-36) amide. Mole weight: 3297.6. | |
| GLP-1 (7-36)-Lys(6-FAM) amide (human, bovine, guinea pig, mouse, rat) | Synonyms: Preproglucagon (98-127)-Lys(6-FAM)amide (human, bovine, guinea pig, mouse, rat); H-His-Ala-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Val-Ser-Ser-Tyr-Leu-Glu-Gly-Gln-Ala-Ala-Lys-Glu-Phe-Ile-Ala-Trp-Leu-Val-Lys-Gly-Arg-Lys(fluorescein-6-carbonyl)-NH2; Proglucagon (78-107)-Lys(6-FAM)amide (human, bovine, guinea pig, mouse, rat); Glucagon-Like Peptide 1 (7-36)-Lys(6-FAM)amide (human, bovine, guinea pig, mouse, rat). Grades: ≥95%. CAS No. 1802089-53-7. Molecular formula: C176H248N42O52. Mole weight: 3784.16. | |
| GLP-1 (7-36)-Lys(biotinyl) amide (human, bovine, guinea pig, mouse, rat) | Synonyms: Preproglucagon (98-127)-Lys(biotinyl) amide (human, bovine, guinea pig, mouse, rat); H-His-Ala-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Val-Ser-Ser-Tyr-Leu-Glu-Gly-Gln-Ala-Ala-Lys-Glu-Phe-Ile-Ala-Trp-Leu-Val-Lys-Gly-Arg-Lys(biotinyl)-NH2; Proglucagon (78-107)-Lys(biotinyl)amide (human, bovine, guinea pig, mouse, rat); Glucagon-Like Peptide 1 (7-36)-Lys(biotinyl)amide (human, bovine, guinea pig, mouse, rat). Grades: ≥95%. CAS No. 1802086-70-9. Molecular formula: C165H252N44O48S. Mole weight: 3652.15. | |
| GLP-1(7-37) | GLP-1(7-37) is an intestinal insulinotropic hormone that augments glucose induced insulin secretion. Uses: Scientific research. Group: Peptides. CAS No. 106612-94-6. Pack Sizes: 1 mg; 5 mg; 10 mg; 25 mg. Product ID: HY-P0055. | |
| GLP-1(7-37) | GLP-1 (7-37) is an insulinotropic peptide generated from the precursor peptide GLP-1 (1-37). It is a potent stimulator of insulin secretion at concentrations as low as 5 X 10(-11) M and has no effect on insulin secretion even at concentrations as high as 5 X 10(-7) M. It participates in the physiological regulation of insulin secretion. Uses: Glp-1 (7-37) acetate participates in the physiological regulation of insulin secretion. Synonyms: Proglucagon (78-108) (human, bovine, guinea pig, mouse, rat); Insulinotropin (human, bovine, guinea pig, mouse, rat); Glucagon-Like Peptide 1 (7-37) (human, bovine, guinea pig, mouse, rat); Preproglucagon (98-128) (human, bovine, guinea pig, mouse, rat); GLP-1 (7-37) human; Glucagon-like Peptide-1 (7-37); H-His-Ala-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Val-Ser-Ser-Tyr-Leu-Glu-Gly-Gln-Ala-Ala-Lys-Glu-Phe-Ile-Ala-Trp-Leu-Val-Lys-Gly-Arg-Gly-OH; L-histidyl-L-alanyl-L-alpha-glutamyl-glycyl-L-threonyl-L-phenylalanyl-L-threonyl-L-seryl-L-alpha-aspartyl-L-valyl-L-seryl-L-seryl-L-tyrosyl-L-leucyl-L-alpha-glutamyl-glycyl-L-glutaminyl-L-alanyl-L-alanyl-L-lysyl-L-alpha-glutamyl-L-phenylalanyl-L-isoleucyl-L-alanyl-L-tryptophyl-L-leucyl-L-valyl-L-lysyl-glycyl-L-arginyl-glycine. Grades: 98%. CAS No. 106612-94-6. Molecular formula: C151H228N40O47. Mole weight: 3355.67. | |
| Glp-1(7-37)acetate | Heterocyclic Organic Compound. Alternative Names: GLP-1 (7-37) acetate;GLP-1 (7-36) amide Acetate (GMP);GLP-1 (7-37) human;GLP-1 (7-37) (human, bovine, guinea pig, mouse, rat);Glucagon-like peptide 1 (7-37) (human). CAS No. 106612-94-6. Molecular formula: C151H228N40O47. Mole weight: 3355.67. Purity: >95%. Catalog: ACM106612946. | |
| GLP-1(7-37) acetate | GLP-1(7-37) acetate is an intestinal insulinotropic hormone that augments glucose induced insulin secretion [1]. Uses: Scientific research. Group: Peptides. CAS No. 1450806-98-0. Pack Sizes: 5 mg; 10 mg; 25 mg; 50 mg; 100 mg. Product ID: HY-P0055A. | |
| GLP-1 (9-36) amide | GLP-1 (9-36) amide is an N-terminal truncated metabolite of glucagon-like peptide GLP-1-(7-36) formed by dipeptidyl peptidase-IV cleavage. GLP-1 (9-36) amide functions as a human GLP-1 receptor antagonist. Synonyms: Glucagon-like peptide-1 (9-36) amide; Glucagon-like peptide-1 (9 36) amide. CAS No. 161748-29-4. Molecular formula: C140H214N36O43. Mole weight: 3089.44. | |
| GLP-1(9-36)amide | GLP-1(9-36)amide is a major metabolite of glucagon-like peptide-1-(7-36) amide formed by the enzyme dipeptidyl peptidase-4 (DPP-4). GLP-1(9-36)amide acts as an antagonist to the human pancreatic GLP-1 receptor [1] [2]. Uses: Scientific research. Group: Peptides. CAS No. 161748-29-4. Pack Sizes: 1 mg; 5 mg. Product ID: HY-P1141. | |
| GLP-1 antagonist | A glucagon-like peptide-1 (GLP-1) receptor antagonist. Synonyms: GLP-1 antagonist; GLP 1 antagonist; N-[[4,5-dimethyl-1-[(2-methylphenyl)methyl]imidazol-2-yl]methyl]-2,4-dimethoxy-N-(3-methylbutyl)benzamide. Grades: 99%. CAS No. 475466-57-0. Molecular formula: C28H37N3O3. Mole weight: 463.61. | |
| GLP-1R agonist 4 | GLP-1R agonist 4 is a potent agonist of GLP-1R. Glucagon-like peptide-1 (GLP-1) is an intestinal hypoglycemic hormone secreted by L-cells in the lower gastrointestinal tract. GLP-1R agonist 4 has the potential for the research of diabetes (extracted from patent WO2019239319A1, compound 96) [1]. Uses: Scientific research. Group: Signaling pathways. CAS No. 2401894-26-4. Pack Sizes: 1 mg; 5 mg; 10 mg; 25 mg; 50 mg. Product ID: HY-144035. | |
| GLP-1R agonist DMB | GLP-1R agonist DMB is a glucagon-like peptide-1 (GLP-1) receptor agonist used potentially for the treatment of type 2 diabetes. Uses: Potential treatment of type 2 diabetes. Synonyms: N-(tert-Butyl)-6,7-dichloro-3-(methylsulfonyl)quinoxalin-2-amine. Grades: 99%. CAS No. 281209-71-0. Molecular formula: C13H15Cl2N3O2S. Mole weight: 348.25. | |
| GLP-1 receptor agonist 10 | GLP-1 receptor agonist 10 (compound 42) is an agonist of GLP Receptor. GLP-1 receptor agonist 10 inhibits food intake and reduces glucose excursion in mice. GLP-1 receptor agonist 10 can be used in the study of type 2 diabetes (T2DM) and obesity [1]. Uses: Scientific research. Group: Signaling pathways. CAS No. 3015555-46-8. Pack Sizes: 10 mM * 1 mL; 5 mg; 10 mg; 25 mg; 50 mg; 100 mg. Product ID: HY-153798. | |
| GLP-1 receptor agonist 12 | GLP-1 receptor agonist 12 (compound 20A) is an agonist of GLP Receptor. GLP-1 receptor agonist 12 can be used in the study of diseases such as diabetes [1]. Uses: Scientific research. Group: Signaling pathways. CAS No. 2775376-50-4. Pack Sizes: 1 mg; 5 mg; 10 mg. Product ID: HY-153816. | |
| GLP-1 receptor agonist 2 | GLP-1 receptor agonist 2 is a glucagon-like peptide-1 receptor (GLP-1R) agonist. Uses: Scientific research. Group: Signaling pathways. CAS No. 2230197-64-3. Pack Sizes: 10 mM * 1 mL; 5 mg; 10 mg. Product ID: HY-112679. | |
| GLP-1 receptor agonist 7 | GLP-1 receptor agonist 7 is a potent agonist of glucagon-like peptide-1 ( GLP-1 ). GLP-1 receptor agonist 7 has the potential for the research of GLP-1-associated diseases, disorders, and conditions including diabetes mellitus (extracted from patent WO2021219019A1, compound 130b) [1]. Uses: Scientific research. Group: Signaling pathways. CAS No. 2736447-04-2. Pack Sizes: 5 mg; 10 mg. Product ID: HY-145412. | |
| GLP-2 (1-33) (human) | GLP-2 (human) is an endogenous peptide that acts as an intestinal epithelium-specific growth factor. It stimulates cell proliferation and inhibits apoptosis, and also modulates intestinal glucose transport, food intake, and gastric acid secretion. Synonyms: Glucagon-like peptide 2 (human); GLP-2 (human); GLP 2 (human). Grades: >98%. CAS No. 223460-79-5. Molecular formula: C165H254N44O55S. Mole weight: 3766.1. | |
| GLP-2 (1-34) (human) | GLP-2 (1-34) (human) is a human-derived mimic of glucagon-like peptide 2 employed in studying gastrointestinal disorders such as short bowel syndrome (SBS). Synonyms: Preproglucagon (146-179) (human); H-His-Ala-Asp-Gly-Ser-Phe-Ser-Asp-Glu-Met-Asn-Thr-Ile-Leu-Asp-Asn-Leu-Ala-Ala-Arg-Asp-Phe-Ile-Asn-Trp-Leu-Ile-Gln-Thr-Lys-Ile-Thr-Asp-Arg-OH; L-histidyl-L-alanyl-L-alpha-aspartyl-glycyl-L-seryl-L-phenylalanyl-L-seryl-L-alpha-aspartyl-L-alpha-glutamyl-L-methionyl-L-asparagyl-L-threonyl-L-isoleucyl-L-leucyl-L-alpha-aspartyl-L-asparagyl-L-leucyl-L-alanyl-L-alanyl-L-arginyl-L-alpha-aspartyl-L-phenylalanyl-L-isoleucyl-L-asparagyl-L-tryptophyl-L-leucyl-L-isoleucyl-L-glutaminyl-L-threonyl-L-lysyl-L-isoleucyl-L-threonyl-L-alpha-aspartyl-L-arginine. Grades: 95%. CAS No. 99120-49-7. Molecular formula: C171H266N48O56S1. Mole weight: 3922.29. | |
| GLP-2 (3-33) | Synonyms: Glucagon-Like Peptide 2-(3-33); L-Aspartic acid, L-α-aspartylglycyl-L-seryl-L-phenylalanyl-L-seryl-L-α-aspartyl-L-α-glutamyl-L-methionyl-L-asparaginyl-L-threonyl-L-isoleucyl-L-leucyl-L-α-aspartyl-L-asparaginyl-L-leucyl-L-alanyl-L-alanyl-L-arginyl-L-α-aspartyl-L-phenylalanyl-L-isoleucyl-L-asparaginyl-L-tryptophyl-L-leucyl-L-isoleucyl-L-glutaminyl-L-threonyl-L-lysyl-L-isoleucyl-L-threonyl-; H-Asp-Gly-Ser-Phe-Ser-Asp-Glu-Met-Asn-Thr-Ile-Leu-Asp-Asn-Leu-Ala-Ala-Arg-Asp-Phe-Ile-Asn-Trp-Leu-Ile-Gln-Thr-Lys-Ile-Thr-Asp-OH; L-alpha-aspartyl-glycyl-L-seryl-L-phenylalanyl-L-seryl-L-alpha-aspartyl-L-alpha-glutamyl-L-methionyl-L-asparagyl-L-threonyl-L-isoleucyl-L-leucyl-L-alpha-aspartyl-L-asparagyl-L-leucyl-L-alanyl-L-alanyl-L-arginyl-L-alpha-aspartyl-L-phenylalanyl-L-isoleucyl-L-asparagyl-L-tryptophyl-L-leucyl-L-isoleucyl-L-glutaminyl-L-threonyl-L-lysyl-L-isoleucyl-L-threonyl-L-aspartic acid. Grades: ≥95%. CAS No. 275801-62-2. Molecular formula: C156H242N40O53S. Mole weight: 3557.89. | |
| GLP-2(3-33) | GLP-2(3-33), generated naturally by dipeptidylpeptidase IV (DPPIV), acts as a partial agonist on GLP-2 receptor ( EC 50 =5.8 nM) [1] [2]. Uses: Scientific research. Group: Peptides. CAS No. 275801-62-2. Pack Sizes: 1 mg; 5 mg. Product ID: HY-P2625. | |
| Glp-2(rat) | GLP-2(rat) is an intestinal growth factor. GLP-2(rat) stimulates cell proliferation and inhibits apoptosis. GLP-2(rat) enhances mucosal mass and function in residual small intestine after massive small bowel resection (MSBR). Group: Inhibitors. Alternative Names: GLUCAGON-LIKE PEPTIDE 2 (RAT);GLUCAGON-LIKE PEPTIDE II RAT;GLP-2 (RAT); H-HIS-ALA-ASP-GLY-SER-PHE-SER-ASP-GLU-MET-ASN-THR-ILE-LEU-ASP-ASN-LEU-ALA-THR-ARG-ASP-PHE-ILE-ASN-TRP-LEU-ILE-GLN-THR-LYS-ILE-THR-ASP-OH; HADGSFSDEMNTILDNLATRDFINWLIQTKITD; PREPROGLUCAG. CAS No. 195262-56-7. Molecular formula: C166H256N44O56S. Mole weight: 3796.14. Appearance: Solid. Purity: 0.9804. Catalog: ACM195262567. | |
| GLP-2 (rat) | GLP-2 (rat) is an endogenous peptide that acts as an intestinal epithelium-specific growth factor. It stimulates cell proliferation and inhibits apoptosis, and also modulates intestinal glucose transport, food intake, and gastric acid secretion. Synonyms: Preproglucagon (146-178) (rat); H-His-Ala-Asp-Gly-Ser-Phe-Ser-Asp-Glu-Met-Asn-Thr-Ile-Leu-Asp-Asn-Leu-Ala-Thr-Arg-Asp-Phe-Ile-Asn-Trp-Leu-Ile-Gln-Thr-Lys-Ile-Thr-Asp-OH; Glucagon-like Peptide 2 (rat); L-histidyl-L-alanyl-L-alpha-aspartyl-glycyl-L-seryl-L-phenylalanyl-L-seryl-L-alpha-aspartyl-L-alpha-glutamyl-L-methionyl-L-asparagyl-L-threonyl-L-isoleucyl-L-leucyl-L-alpha-aspartyl-L-asparagyl-L-leucyl-L-alanyl-L-threonyl-L-arginyl-L-alpha-aspartyl-L-phenylalanyl-L-isoleucyl-L-asparagyl-L-tryptophyl-L-leucyl-L-isoleucyl-L-glutaminyl-L-threonyl-L-lysyl-L-isoleucyl-L-threonyl-L-aspartic acid. Grades: ≥95%. CAS No. 195262-56-7. Molecular formula: C166H256N44O56S. Mole weight: 3796.17. | |
| GLP-2(rat) | GLP-2(rat) is an intestinal growth factor. GLP-2(rat) stimulates cell proliferation and inhibits apoptosis. GLP-2(rat) enhances mucosal mass and function in residual small intestine after massive small bowel resection (MSBR) [1] [2]. Uses: Scientific research. Group: Peptides. CAS No. 195262-56-7. Pack Sizes: 5 mg; 10 mg. Product ID: HY-P1142. | |
| GLP-2 (rat) trifluoroacetate salt | GLP-2 is a gut peptide hormone that is primarily produced by enteroendocrine L cells of the small and large intestine. GLP-2 is an antagonist of the GLP-2 receptor (GLP-2R; Ki = 60 pM). Synonyms: Glucagon-like Peptide 2. Grades: ≥95%. Molecular formula: C166H256N44O56S·xCF3COOH. Mole weight: 3796.14. | |
| GLPG-0187 | GLPG-0187 is a small molecule integrin receptor antagonist (IRA) with nanomolar affinity for the RGD-integrin receptors αvβ1, αvβ3, αvβ5, αvβ6 and α5β1 (IC50s = 1.2-3.7 nM). Integrin receptors are expressed on the surface of tumor vessel endothelial cells and some types of cancer cells, and play a crucial role in endothelial cell adhesion and migration. This compound shows an inhibitory activity of angiogenesis, bone-resorption and tumor, which is hopefully used as an anticancer drug. Uses: An integrin receptor antagonist (ira) can be used as an anticancer drug. Synonyms: GLPG0187; GLPG 0187; GLPG-0187; UNII-43A5P87Z4T; 43A5P87Z4T; SCHEMBL2372722; CHEMBL3319236; (2S) -3-[[2, 5-dimethyl-6-[4- (5, 6, 7, 8-tetrahydro-1, 8-naphthyridin-2-yl) piperidin-1-yl]pyrimidin-4-yl]amino]-2-[ (4-methoxyphenyl) sulfonylamino]propanoic acid. Grades: ≥98 %. CAS No. 1320346-97-1. Molecular formula: C29H37N7O5S. Mole weight: 595.719. | |
| GLPG0492 | GLPG0492, a selective androgen receptor modulator, could be effective in decreasing muscle loss. The treatment study against Duchenne muscular dystrophy of it has alreadt been discontinued. Uses: Glpg0492 is a selective androgen receptor modulator that could be effective in decreasing muscle loss. Synonyms: DT-200; DT 200; DT200; GLPG0492; SCHEMBL2021011; CHEMBL2178100; GLPG 0492; GLPG-0492; VAJGULUVTFDTAS-GOSISDBHSA-N. Grades: 98%. CAS No. 1215085-92-9. Molecular formula: C19H14F3N3O3. Mole weight: 389.33. | |
| GLPG0492 R enantiomer | The R-enantiomer of GLPG0492 which is a selective androgen receptor modulator, could be effective in decreasing muscle loss. Uses: The r-enantiomer of glpg0492 which is a selective androgen receptor modulator that could be effective in decreasing muscle loss. Synonyms: GLPG-0492 R enantiomer; GLPG 0492 R enantiomer; GLPG0492 R enantiomer. Grades: 98%. CAS No. 1215085-93-0. Molecular formula: C19H14F3N3O3. Mole weight: 389.33. | |
| GLPG0634 analog | GLPG0634 analog (Compoun 176) is a broad spectrum JAK inhibitor with IC 50 values of <100 nM against JAK1, JAK2 and JAK3 [1]. Uses: Scientific research. Group: Signaling pathways. CAS No. 1206101-20-3. Pack Sizes: 10 mM * 1 mL; 5 mg; 10 mg; 50 mg. Product ID: HY-13961. | |
| GLPG0634 analogue | A potent and selective JAK1 inhibitor with IC50 values of 10, 28, 810, and 116 nM for JAK1, JAK2, JAK3, and TYK2, respectively. Synonyms: GLPG0634 analog; N-[5-[4-[(6-cyanopyridin-3-yl)methoxy]phenyl]-[1,2,4]triazolo[1,5-a]pyridin-2-yl]cyclopropanecarboxamide. Grades: >98%. CAS No. 1206101-20-3. Molecular formula: C23H18N6O2. Mole weight: 410.43. | |
Our database is helping our users find suppliers everyday.
