American Chemical Suppliers

A directory of where to buy chemicals in the USA, including: distributors, industrial manufacturers, bulk supplies and wholesalers of raw ingredients & finished goods.

Search for products or services, then visit the suppliers website for prices or more information.

Product
Globotriaosylsphingosine Globotriaosylsphingosine (lyso-Gb3) inhibits the growth of fibroblasts, as well as their differentiation into myofibroblasts, and collagen expression. Globotriaosylsphingosine can be used for Fabry disease research [1]. Uses: Scientific research. Group: Natural products. Alternative Names: lyso-Gb3. CAS No. 126550-86-5. Pack Sizes: 1 mg; 5 mg. Product ID: HY-N12408. MedChemExpress MCE
Globotriose Globotriose is a carbohydrate product used in biomedicine to study the role of glycolipids in various diseases and drug development. It is commonly utilized as a mimic to study the biological interactions with globotriaosylceramide (Gb3), which is involved in the progression of certain infections, such as E. coli and Shiga toxin-producing bacteria. Globotriose provides valuable insights into the development of therapeutics targeting Gb3-mediated diseases. Synonyms: 4-O-(4-O-α-D-Galactopyranosyl-β-D-galactopyranosyl)-D-glucopyranose; Gal-a-1,4-Gal-b-1,4-Glc; pk-Antigen; Globotriaose; O-α-D-Galactopyranosyl-(1?4)-O-β-D-galactopyranosyl-(1?4)-D-glucose; alpha-D-Gal-(1->4)-beta-D-Gal-(1->4)-D-Glc; alpha-D-Galp-(1->4)-beta-D-Galp-(1->4)-D-Glcp; Globotriose. Grades: ≥95%. CAS No. 66580-68-5. Molecular formula: C18H32O16. Mole weight: 504.44. BOC Sciences 12
Globotriose 2-(2-carboxyethylthio)ethane Globotriose 2-(2-carboxyethylthio)ethane is an extensively employed compound, serving as a cornerstone for research purposes in various ailments including hemolytic uremic syndrome and Escherichia coli-induced bacterial infections. Synonyms: 2-(2-Carboxyethylthio)-ethyl 4-O-[4-O(a-D-galactopyranosyl)-b-D-galactopyranosyl]-b-D-glucopyranoside. Molecular formula: C23H40O18S. Mole weight: 636.62. BOC Sciences 12
Globotriose-APE-HSA BOC Sciences 12
Globotriose-GEL BOC Sciences 12
Globotriose-HSA BOC Sciences 12
Globotriose-HSA (3 atom spacer) Globotriose-HSA (3 atom spacer) is a potential therapeutic agent used in the treatment of shiga toxin-producing E. coli infections. It comprises a synthetic molecule made of three sugar molecules connected to human serum albumin with a three-atom spacer. The compound can bind to the shiga toxin produced by E. coli, preventing it from attaching to cell receptors and causing damage to vital organs. BOC Sciences 12
Globotriose-sp-biotin Globotriose-sp-biotin is a crucial component utilized for studying and detecting diseases caused by certain strains of Escherichia coli bacteria. As a specific ligand, it enhances the identification and quantification of bacterial binding to cell surfaces, aiding in the research of infections caused by these pathogens. Synonyms: Gala1-4Galb1-4Glcb-OCH2CH2NH-biotin. BOC Sciences 12
Globulins Cohn fraction II, III human lyophilized powder. Group: Fluorescence/luminescence spectroscopy. Alfa Chemistry Analytical Products 3
Glochidiol Glochidiol is an orally active tubulin polymerization inhibitor with an IC50 of 2.76 μM. Glochidiol shows anti-cancer activity. Uses: Designed for use in research and industrial production. Product Category: Inhibitors. Appearance: Powder. CAS No. 6610-56-6. Molecular formula: C30H50O2. Mole weight: 442.7. Purity: 0.98. IUPACName: (1R,3aR,5aR,5bR,7aS,9R,11R,11aR,11bS,13aR,13bR)-3a,5a,5b,8,8,11a-hexamethyl-1-prop-1-en-2-yl-1,2,3,4,5,6,7,7a,9,10,11,11b,12,13,13a,13b-hexadecahydrocyclopenta[a]chrysene-9,11-diol. Canonical SMILES: CC(=C)C1CCC2(C1C3CCC4C(C3(CC2)C)(CCC5C4(C(CC(C5(C)C)O)O)C)C)C. Product ID: ACM6610566. Alfa Chemistry — ISO 9001:2015 Certified. Categories: Glochidion marianum. Alfa Chemistry.
Glofitamab Glofitamab (RO7082859) is a T-cell-engaging bispecific antibody possessing a novel 2:1 structure with bivalency for CD20 on B cells and monovalency for CD3 on T cells. Glofitamab leads to T-cell activation, proliferation, and tumor cell killing upon binding to CD20 on malignant cells. Glofitamab induces durable complete remissions in relapsed or refractory B-Cell non-Hodgkin lymphoma (B-NHL) [1] [2] [3] [4]. Uses: Scientific research. Group: Inhibitory antibodies. Alternative Names: RO7082859. CAS No. 2229047-91-8. Pack Sizes: 1 mg; 5 mg; 10 mg. Product ID: HY-P99024. MedChemExpress MCE
Glofitamab Glofitamab is a T-cell-engaging bispecific antibody possessing a novel 2:1 structure with bivalency for CD20 on B cells and monovalency for CD3 on T cells. Glofitamab is used as an effective therapy for relapsed or refractory diffuse large B-cell lymphoma. Synonyms: RO7082859; RG6026. CAS No. 2229047-91-8. BOC Sciences 11
Glomecidin It is produced by the strain of Streptomyces lavendulae H698 SY2. It has antibacterial activity on several plant pathogenic fungi, including Glomerella cingulata, Colletotrichum gloeosporioides and C. lagenarium with MIC (μg/mL) of 0.78, 0.78 and 1.56, respectively. It has no effect on other fungi, yeast and bacteria. Molecular formula: C27H37N7O7. Mole weight: 571.62. BOC Sciences 5
Glomellic acid Synonyms: Benzoic acid, 2-hydroxy-4-[[2-hydroxy-4-methoxy-6-(2-oxopentyl)benzoyl]oxy]-6-(2-oxopentyl)-; Glomellsaeure. CAS No. 52589-14-7. Molecular formula: C25H28O9. Mole weight: 472.48. BOC Sciences 6
Glomelliferonic acid Glomelliferonic acid is a depside from the Lichen Neofuscelia subincerta. Synonyms: ACMC-20miur; 11H-Dibenzo[b,e][1,4]dioxepin-7-carboxylic acid, 8-hydroxy-3-methoxy-11-oxo-1-(2-oxopentyl)-6-pentyl-; 8-Hydroxy-3-methoxy-11-oxo-1-(2-oxopentyl)-6-pentyl-11H-dibenzo[b,e][1,4]dioxepine-7-carboxylic acid. CAS No. 113706-23-3. Molecular formula: C25H28O8. Mole weight: 456.48. BOC Sciences 6
Glomeratose A Glomeratose A is a phenylpropanoid isolated from Polygala tenuifolia. Synonyms: GlomeratoseA; BCP25315; FT-0777097. Grades: 98%. CAS No. 202471-84-9. Molecular formula: C24H34O15. Mole weight: 562.52. BOC Sciences 9
Glomeratose A Botanical Source: Group: Biochemicals. Grades: Plant Grade. CAS No. 202471-84-9. Pack Sizes: 10mg, 20mg. US Biological Life Sciences. USBiological 9
Worldwide
Glomerular Microvascular Endothelial Cells, Human (Frozen) Passage 2 cells are shipped in proliferating culture with a confluence of >90%. ENDO-Growth medium containing 5% serum and growth supplement is recommended for culture. Cells have an average population doubling level of >16 when cultured. Group: Biologicals. Grades: Cell Culture Grade. Pack Sizes: 1ml. US Biological Life Sciences. USBiological 9
Worldwide
Glomerular Microvascular Endothelial Cells, Human (T-25 flask) Passage 2 cells are shipped in proliferating culture with a confluence of >90%. ENDO-Growth medium containing 5% serum and growth supplement is recommended for culture. Cells have an average population doubling level of >16 when cultured. Group: Biologicals. Grades: Cell Culture Grade. Pack Sizes: T-25 flask. US Biological Life Sciences. USBiological 9
Worldwide
Glomosporin It is produced by the strain of Glomospora sp. BAUA 2825. It is a cyclic ester peptide antifungal antibiotic, and it has moderate anti-aspergillus flavus (including aspergillus Niger and Aspergillus Niger), yeast activity (MIC is 16 μg/mL). Synonyms: [(3R,18R)-9,12-bis(2-amino-2-oxoethyl)-3-[(1R)-1-hydroxyethyl]-6,21-bis(hydroxymethyl)-25-(2-hydroxytetradecan-2-yl)-18-methyl-2,5,8,11,14,17,20,23-octaoxo-1-oxa-4,7,10,13,16,19,22-heptaazacyclopentacosan-15-yl]acetic acid. CAS No. 288631-37-8. Molecular formula: C42H71N9O17. Mole weight: 974.06. BOC Sciences 5
GlowDot GlowDot. Uses: Cell imaging, ph sensing, fluorescence, drug delivery and etc. Group: other quantum dots. Alfa Chemistry Materials 3
Gloxazone Gloxazone is an effective anaplasmacide. Uses: Designed for use in research and industrial production. Additional or Alternative Names: Contrapar, Gloxazon, GLOXAZONE, KTS, pharmaceutical, Kethoxal bis(thiosemicarbazone), NSC82116, AIDS125723, AIDS-125723, BW 356C61, CID9571200, KC 1331, WR 9838, (1-Ethoxyethyl)glyoxal bis(thiosemicarbazone). alpha.-Ethoxyethylglyoxal dithiosemicarbazone, 3-Ethoxy-2-oxobutyraldehyde bis(thiosemicarbazone), Butyraldehyde, 3-ethoxy-2-oxo-, bis(thiosemicarbazone), 2-((Aminocarbothioyl)hydrazono)-3-ethoxybutanal thiosemicarbazone, Butyraldehyde, 3-ethoxy-2-oxo-, bis(thiosemicarbazone, hemihydrate, 2507-91-7, Hydrazinecarbothioamide, 2, {2-[1-(1-ethoxyethyl)-1,2-ethanediylidene]bis-}. Product Category: Inhibitors. Appearance: Solid. CAS No. 2507-91-7. Molecular formula: C8H16N6OS2. Mole weight: 276.38. Purity: 0.96. IUPACName: [(E)-[(1E)-1-(carbamothioylhydrazinylidene)-3-ethoxybutan-2-ylidene]amino]thiourea. Canonical SMILES: CC(C(/C=N/NC(N)=S)=N\NC(N)=S)OCC. Density: 1.41g/cm³. Product ID: ACM2507917. Alfa Chemistry — ISO 9001:2015 Certified. Alfa Chemistry.
Glp-1(1-36)amide(human,bovine,guinea pig,mouse,rat) Glp-1(1-36)amide(human,bovine,guinea pig,mouse,rat). Uses: Designed for use in research and industrial production. Additional or Alternative Names: GLP-1 (1-36) amide (human, bovine, guinea pig, mouse, rat);Glucagon-like peptide 1 amide. Product Category: Heterocyclic Organic Compound. CAS No. 99658-04-5. Molecular formula: C184H273N51O57. Mole weight: 4111.44. Purity: 0.96. Product ID: ACM99658045. Alfa Chemistry — ISO 9001:2015 Certified. Alfa Chemistry. 4
GLP-1 (1-36) amide (human, bovine, guinea pig, mouse, rat) GLP-1 (1-36) amide is a promising peptide hormone unlocking avenues for type 2 diabetes mellitus research. Its extraordinary resemblance to the native GLP-1 facilitates heightened glucose-dependent insulin secretion. Synonyms: Preproglucagon (92-127) amide (human, bovine, guinea pig, mouse, rat); Glucagon-like peptide 1 (1-36) amide (human, bovine, guinea pig, mouse, rat); H-His-Asp-Glu-Phe-Glu-Arg-His-Ala-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Val-Ser-Ser-Tyr-Leu-Glu-Gly-Gln-Ala-Ala-Lys-Glu-Phe-Ile-Ala-Trp-Leu-Val-Lys-Gly-Arg-NH2; L-histidyl-L-alpha-aspartyl-L-alpha-glutamyl-L-phenylalanyl-L-alpha-glutamyl-L-arginyl-L-histidyl-L-alanyl-L-alpha-glutamyl-glycyl-L-threonyl-L-phenylalanyl-L-threonyl-L-seryl-L-alpha-aspartyl-L-valyl-L-seryl-L-seryl-L-tyrosyl-L-leucyl-L-alpha-glutamyl-glycyl-L-glutaminyl-L-alanyl-L-alanyl-L-lysyl-L-alpha-glutamyl-L-phenylalanyl-L-isoleucyl-L-alanyl-L-tryptophyl-L-leucyl-L-valyl-L-lysyl-glycyl-L-argininamide. Grades: ≥95%. CAS No. 99658-04-5. Molecular formula: C184H273N51O57. Mole weight: 4111.44. BOC Sciences 6
GLP-1(32-36)amide GLP-1(32-36)amide, a pentapeptide, derived from the C terminus of the glucoregulatory hormone GLP-1. GLP-1(32-36)amide could inhibit weight gain and modulate whole body glucose metabolism in diabetic mice [1] [2]. Uses: Scientific research. Group: Peptides. CAS No. 1417302-71-6. Pack Sizes: 5 mg; 10 mg. Product ID: HY-P3102. MedChemExpress MCE
GLP-1(7-36) amide GLP-1(7-36) amide is a glucose-dependent insulinotropic peptide displaying high affinity for GLP-1 receptors expressed in rat insulinoma-derived RINm5F cells (Kd = 204 pM). GLP-1 (7-36) amide exhibits antiapoptotic effects in hippocampal neurons and reduces food intake in fasted rats following central administration. Synonyms: GLP-1; GLP-1 (7-36) amide; Insulinotropin. Grades: 98%. CAS No. 107444-51-9. Molecular formula: C149H226N40O45. Mole weight: 3297.67. BOC Sciences 8
GLP-1(7-36), amide GLP-1(7-36), amide is a physiological incretin hormone that stimulates insulin secretion. Uses: Scientific research. Group: Peptides. Alternative Names: Glucagon-like peptide-1 (GLP-1)(7-36), amide; Human GLP-1 (7-36), amide. CAS No. 107444-51-9. Pack Sizes: 1 mg. Product ID: HY-P0054A. MedChemExpress MCE
GLP-1(7-36), amide acetate GLP-1(7-36), amide acetate is a major intestinal hormone that stimulates glucose-induced insulin secretion from β cells. Uses: Scientific research. Group: Peptides. Alternative Names: Glucagon-like peptide-1 (GLP-1)(7-36), amide acetate; Human GLP-1 (7-36), amide acetate. CAS No. 1119517-19-9. Pack Sizes: 500 μg; 1 mg; 5 mg; 10 mg. Product ID: HY-P0054. MedChemExpress MCE
GLP-1 (7-36) amide (chicken, common turkey) Synonyms: Preproglucagon (118-147) amide (chicken, common turkey); H-His-Ala-Glu-Gly-Thr-Tyr-Thr-Ser-Asp-Ile-Thr-Ser-Tyr-Leu-Glu-Gly-Gln-Ala-Ala-Lys-Glu-Phe-Ile-Ala-Trp-Leu-Val-Asn-Gly-Arg-NH2; L-histidyl-L-alanyl-L-alpha-glutamyl-glycyl-L-threonyl-L-tyrosyl-L-threonyl-L-seryl-L-alpha-aspartyl-L-isoleucyl-L-threonyl-L-seryl-L-tyrosyl-L-leucyl-L-alpha-glutamyl-glycyl-L-glutaminyl-L-alanyl-L-alanyl-L-lysyl-L-alpha-glutamyl-L-phenylalanyl-L-isoleucyl-L-alanyl-L-tryptophyl-L-leucyl-L-valyl-L-asparagyl-glycyl-L-argininamide; Glucagon-Like Peptide 1 (7-36) amide (chicken, common turkey). Grades: ≥95% by HPLC. CAS No. 1802078-26-7. Molecular formula: C149H224N40O47. Mole weight: 3327.66. BOC Sciences 6
GLP-1 (7-36) amide trifluoroacetate salt GLP-1 (7-36) amide is an important peptide hormone that displays a strong insulinotropic effect. It binds the GLP-1 receptor (pIC50 = 8.5) in the pancreas and shows various antidiabetic effects. Synonyms: Glucagon-like Peptide 1 (7-36) amide. Mole weight: 3297.6. BOC Sciences 10
GLP-1 (7-36)-Lys(6-FAM) amide (human, bovine, guinea pig, mouse, rat) Synonyms: Preproglucagon (98-127)-Lys(6-FAM)amide (human, bovine, guinea pig, mouse, rat); H-His-Ala-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Val-Ser-Ser-Tyr-Leu-Glu-Gly-Gln-Ala-Ala-Lys-Glu-Phe-Ile-Ala-Trp-Leu-Val-Lys-Gly-Arg-Lys(fluorescein-6-carbonyl)-NH2; Proglucagon (78-107)-Lys(6-FAM)amide (human, bovine, guinea pig, mouse, rat); Glucagon-Like Peptide 1 (7-36)-Lys(6-FAM)amide (human, bovine, guinea pig, mouse, rat). Grades: ≥95%. CAS No. 1802089-53-7. Molecular formula: C176H248N42O52. Mole weight: 3784.16. BOC Sciences 6
GLP-1 (7-36)-Lys(biotinyl) amide (human, bovine, guinea pig, mouse, rat) Synonyms: Preproglucagon (98-127)-Lys(biotinyl) amide (human, bovine, guinea pig, mouse, rat); H-His-Ala-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Val-Ser-Ser-Tyr-Leu-Glu-Gly-Gln-Ala-Ala-Lys-Glu-Phe-Ile-Ala-Trp-Leu-Val-Lys-Gly-Arg-Lys(biotinyl)-NH2; Proglucagon (78-107)-Lys(biotinyl)amide (human, bovine, guinea pig, mouse, rat); Glucagon-Like Peptide 1 (7-36)-Lys(biotinyl)amide (human, bovine, guinea pig, mouse, rat). Grades: ≥95%. CAS No. 1802086-70-9. Molecular formula: C165H252N44O48S. Mole weight: 3652.15. BOC Sciences 6
GLP-1(7-37) GLP-1(7-37) is an intestinal insulinotropic hormone that augments glucose induced insulin secretion. Uses: Scientific research. Group: Peptides. CAS No. 106612-94-6. Pack Sizes: 1 mg; 5 mg; 10 mg; 25 mg. Product ID: HY-P0055. MedChemExpress MCE
GLP-1(7-37) GLP-1 (7-37) is an insulinotropic peptide generated from the precursor peptide GLP-1 (1-37). It is a potent stimulator of insulin secretion at concentrations as low as 5 X 10(-11) M and has no effect on insulin secretion even at concentrations as high as 5 X 10(-7) M. It participates in the physiological regulation of insulin secretion. Uses: Glp-1 (7-37) acetate participates in the physiological regulation of insulin secretion. Synonyms: Proglucagon (78-108) (human, bovine, guinea pig, mouse, rat); Insulinotropin (human, bovine, guinea pig, mouse, rat); Glucagon-Like Peptide 1 (7-37) (human, bovine, guinea pig, mouse, rat); Preproglucagon (98-128) (human, bovine, guinea pig, mouse, rat); GLP-1 (7-37) human; Glucagon-like Peptide-1 (7-37); H-His-Ala-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Val-Ser-Ser-Tyr-Leu-Glu-Gly-Gln-Ala-Ala-Lys-Glu-Phe-Ile-Ala-Trp-Leu-Val-Lys-Gly-Arg-Gly-OH; L-histidyl-L-alanyl-L-alpha-glutamyl-glycyl-L-threonyl-L-phenylalanyl-L-threonyl-L-seryl-L-alpha-aspartyl-L-valyl-L-seryl-L-seryl-L-tyrosyl-L-leucyl-L-alpha-glutamyl-glycyl-L-glutaminyl-L-alanyl-L-alanyl-L-lysyl-L-alpha-glutamyl-L-phenylalanyl-L-isoleucyl-L-alanyl-L-tryptophyl-L-leucyl-L-valyl-L-lysyl-glycyl-L-arginyl-glycine. Grades: 98%. CAS No. 106612-94-6. Molecular formula: C151H228N40O47. Mole weight: 3355.67. BOC Sciences 8
Glp-1(7-37)acetate Glp-1(7-37)acetate. Uses: Designed for use in research and industrial production. Additional or Alternative Names: GLP-1 (7-37) acetate;GLP-1 (7-36) amide Acetate (GMP);GLP-1 (7-37) human;GLP-1 (7-37) (human, bovine, guinea pig, mouse, rat);Glucagon-like peptide 1 (7-37) (human). Product Category: Heterocyclic Organic Compound. CAS No. 106612-94-6. Molecular formula: C151H228N40O47. Mole weight: 3355.67. Purity: >95%. Product ID: ACM106612946. Alfa Chemistry — ISO 9001:2015 Certified. Categories: GLP-1(7-37) Acetate. Alfa Chemistry. 4
GLP-1(7-37) acetate GLP-1(7-37) acetate is an intestinal insulinotropic hormone that augments glucose induced insulin secretion [1]. Uses: Scientific research. Group: Peptides. CAS No. 1450806-98-0. Pack Sizes: 5 mg; 10 mg; 25 mg; 50 mg; 100 mg. Product ID: HY-P0055A. MedChemExpress MCE
GLP-1 (9-36) amide GLP-1 (9-36) amide is an N-terminal truncated metabolite of glucagon-like peptide GLP-1-(7-36) formed by dipeptidyl peptidase-IV cleavage. GLP-1 (9-36) amide functions as a human GLP-1 receptor antagonist. Synonyms: Glucagon-like peptide-1 (9-36) amide; Glucagon-like peptide-1 (9 36) amide. CAS No. 161748-29-4. Molecular formula: C140H214N36O43. Mole weight: 3089.44. BOC Sciences 10
GLP-1(9-36)amide GLP-1(9-36)amide is a major metabolite of glucagon-like peptide-1-(7-36) amide formed by the enzyme dipeptidyl peptidase-4 (DPP-4). GLP-1(9-36)amide acts as an antagonist to the human pancreatic GLP-1 receptor [1] [2]. Uses: Scientific research. Group: Peptides. CAS No. 161748-29-4. Pack Sizes: 1 mg; 5 mg. Product ID: HY-P1141. MedChemExpress MCE
GLP-1 antagonist A glucagon-like peptide-1 (GLP-1) receptor antagonist. Synonyms: GLP-1 antagonist; GLP 1 antagonist; N-[[4,5-dimethyl-1-[(2-methylphenyl)methyl]imidazol-2-yl]methyl]-2,4-dimethoxy-N-(3-methylbutyl)benzamide. Grades: 99%. CAS No. 475466-57-0. Molecular formula: C28H37N3O3. Mole weight: 463.61. BOC Sciences 10
GLP-1R agonist 4 GLP-1R agonist 4 is a potent agonist of GLP-1R. Glucagon-like peptide-1 (GLP-1) is an intestinal hypoglycemic hormone secreted by L-cells in the lower gastrointestinal tract. GLP-1R agonist 4 has the potential for the research of diabetes (extracted from patent WO2019239319A1, compound 96) [1]. Uses: Scientific research. Group: Signaling pathways. CAS No. 2401894-26-4. Pack Sizes: 1 mg; 5 mg; 10 mg; 25 mg; 50 mg. Product ID: HY-144035. MedChemExpress MCE
GLP-1R agonist DMB GLP-1R agonist DMB is a glucagon-like peptide-1 (GLP-1) receptor agonist used potentially for the treatment of type 2 diabetes. Uses: Potential treatment of type 2 diabetes. Synonyms: N-(tert-Butyl)-6,7-dichloro-3-(methylsulfonyl)quinoxalin-2-amine. Grades: 99%. CAS No. 281209-71-0. Molecular formula: C13H15Cl2N3O2S. Mole weight: 348.25. BOC Sciences 10
GLP-1 receptor agonist 10 GLP-1 receptor agonist 10 (compound 42) is an agonist of GLP Receptor. GLP-1 receptor agonist 10 inhibits food intake and reduces glucose excursion in mice. GLP-1 receptor agonist 10 can be used in the study of type 2 diabetes (T2DM) and obesity [1]. Uses: Scientific research. Group: Signaling pathways. CAS No. 3015555-46-8. Pack Sizes: 10 mM * 1 mL; 5 mg; 10 mg; 25 mg; 50 mg; 100 mg. Product ID: HY-153798. MedChemExpress MCE
GLP-1 receptor agonist 12 GLP-1 receptor agonist 12 (compound 20A) is an agonist of GLP Receptor. GLP-1 receptor agonist 12 can be used in the study of diseases such as diabetes [1]. Uses: Scientific research. Group: Signaling pathways. CAS No. 2775376-50-4. Pack Sizes: 1 mg; 5 mg; 10 mg. Product ID: HY-153816. MedChemExpress MCE
GLP-1 receptor agonist 2 GLP-1 receptor agonist 2 is a glucagon-like peptide-1 receptor (GLP-1R) agonist. Uses: Scientific research. Group: Signaling pathways. CAS No. 2230197-64-3. Pack Sizes: 10 mM * 1 mL; 5 mg; 10 mg. Product ID: HY-112679. MedChemExpress MCE
GLP-1 receptor agonist 7 GLP-1 receptor agonist 7 is a potent agonist of glucagon-like peptide-1 ( GLP-1 ). GLP-1 receptor agonist 7 has the potential for the research of GLP-1-associated diseases, disorders, and conditions including diabetes mellitus (extracted from patent WO2021219019A1, compound 130b) [1]. Uses: Scientific research. Group: Signaling pathways. CAS No. 2736447-04-2. Pack Sizes: 5 mg; 10 mg. Product ID: HY-145412. MedChemExpress MCE
GLP-2 (1-33) (human) GLP-2 (human) is an endogenous peptide that acts as an intestinal epithelium-specific growth factor. It stimulates cell proliferation and inhibits apoptosis, and also modulates intestinal glucose transport, food intake, and gastric acid secretion. Synonyms: Glucagon-like peptide 2 (human); GLP-2 (human); GLP 2 (human). Grades: >98%. CAS No. 223460-79-5. Molecular formula: C165H254N44O55S. Mole weight: 3766.1. BOC Sciences 3
GLP-2 (1-34) (human) GLP-2 (1-34) (human) is a human-derived mimic of glucagon-like peptide 2 employed in studying gastrointestinal disorders such as short bowel syndrome (SBS). Synonyms: Preproglucagon (146-179) (human); H-His-Ala-Asp-Gly-Ser-Phe-Ser-Asp-Glu-Met-Asn-Thr-Ile-Leu-Asp-Asn-Leu-Ala-Ala-Arg-Asp-Phe-Ile-Asn-Trp-Leu-Ile-Gln-Thr-Lys-Ile-Thr-Asp-Arg-OH; L-histidyl-L-alanyl-L-alpha-aspartyl-glycyl-L-seryl-L-phenylalanyl-L-seryl-L-alpha-aspartyl-L-alpha-glutamyl-L-methionyl-L-asparagyl-L-threonyl-L-isoleucyl-L-leucyl-L-alpha-aspartyl-L-asparagyl-L-leucyl-L-alanyl-L-alanyl-L-arginyl-L-alpha-aspartyl-L-phenylalanyl-L-isoleucyl-L-asparagyl-L-tryptophyl-L-leucyl-L-isoleucyl-L-glutaminyl-L-threonyl-L-lysyl-L-isoleucyl-L-threonyl-L-alpha-aspartyl-L-arginine. Grades: 95%. CAS No. 99120-49-7. Molecular formula: C171H266N48O56S1. Mole weight: 3922.29. BOC Sciences 6
GLP-2 (3-33) Synonyms: Glucagon-Like Peptide 2-(3-33); L-Aspartic acid, L-α-aspartylglycyl-L-seryl-L-phenylalanyl-L-seryl-L-α-aspartyl-L-α-glutamyl-L-methionyl-L-asparaginyl-L-threonyl-L-isoleucyl-L-leucyl-L-α-aspartyl-L-asparaginyl-L-leucyl-L-alanyl-L-alanyl-L-arginyl-L-α-aspartyl-L-phenylalanyl-L-isoleucyl-L-asparaginyl-L-tryptophyl-L-leucyl-L-isoleucyl-L-glutaminyl-L-threonyl-L-lysyl-L-isoleucyl-L-threonyl-; H-Asp-Gly-Ser-Phe-Ser-Asp-Glu-Met-Asn-Thr-Ile-Leu-Asp-Asn-Leu-Ala-Ala-Arg-Asp-Phe-Ile-Asn-Trp-Leu-Ile-Gln-Thr-Lys-Ile-Thr-Asp-OH; L-alpha-aspartyl-glycyl-L-seryl-L-phenylalanyl-L-seryl-L-alpha-aspartyl-L-alpha-glutamyl-L-methionyl-L-asparagyl-L-threonyl-L-isoleucyl-L-leucyl-L-alpha-aspartyl-L-asparagyl-L-leucyl-L-alanyl-L-alanyl-L-arginyl-L-alpha-aspartyl-L-phenylalanyl-L-isoleucyl-L-asparagyl-L-tryptophyl-L-leucyl-L-isoleucyl-L-glutaminyl-L-threonyl-L-lysyl-L-isoleucyl-L-threonyl-L-aspartic acid. Grades: ≥95%. CAS No. 275801-62-2. Molecular formula: C156H242N40O53S. Mole weight: 3557.89. BOC Sciences 5
GLP-2(3-33) GLP-2(3-33), generated naturally by dipeptidylpeptidase IV (DPPIV), acts as a partial agonist on GLP-2 receptor ( EC 50 =5.8 nM) [1] [2]. Uses: Scientific research. Group: Peptides. CAS No. 275801-62-2. Pack Sizes: 1 mg; 5 mg. Product ID: HY-P2625. MedChemExpress MCE
Glp-2(rat) GLP-2(rat) is an intestinal growth factor. GLP-2(rat) stimulates cell proliferation and inhibits apoptosis. GLP-2(rat) enhances mucosal mass and function in residual small intestine after massive small bowel resection (MSBR). Uses: Designed for use in research and industrial production. Additional or Alternative Names: GLUCAGON-LIKE PEPTIDE 2 (RAT);GLUCAGON-LIKE PEPTIDE II RAT;GLP-2 (RAT);H-HIS-ALA-ASP-GLY-SER-PHE-SER-ASP-GLU-MET-ASN-THR-ILE-LEU-ASP-ASN-LEU-ALA-THR-ARG-ASP-PHE-ILE-ASN-TRP-LEU-ILE-GLN-THR-LYS-ILE-THR-ASP-OH;HADGSFSDEMNTILDNLATRDFINWLIQTKITD;PREPROGLUCAG. Product Category: Inhibitors. Appearance: Solid. CAS No. 195262-56-7. Molecular formula: C166H256N44O56S. Mole weight: 3796.14. Purity: 0.9804. Product ID: ACM195262567. Alfa Chemistry — ISO 9001:2015 Certified. Alfa Chemistry.
GLP-2 (rat) GLP-2 (rat) is an endogenous peptide that acts as an intestinal epithelium-specific growth factor. It stimulates cell proliferation and inhibits apoptosis, and also modulates intestinal glucose transport, food intake, and gastric acid secretion. Synonyms: Preproglucagon (146-178) (rat); H-His-Ala-Asp-Gly-Ser-Phe-Ser-Asp-Glu-Met-Asn-Thr-Ile-Leu-Asp-Asn-Leu-Ala-Thr-Arg-Asp-Phe-Ile-Asn-Trp-Leu-Ile-Gln-Thr-Lys-Ile-Thr-Asp-OH; Glucagon-like Peptide 2 (rat); L-histidyl-L-alanyl-L-alpha-aspartyl-glycyl-L-seryl-L-phenylalanyl-L-seryl-L-alpha-aspartyl-L-alpha-glutamyl-L-methionyl-L-asparagyl-L-threonyl-L-isoleucyl-L-leucyl-L-alpha-aspartyl-L-asparagyl-L-leucyl-L-alanyl-L-threonyl-L-arginyl-L-alpha-aspartyl-L-phenylalanyl-L-isoleucyl-L-asparagyl-L-tryptophyl-L-leucyl-L-isoleucyl-L-glutaminyl-L-threonyl-L-lysyl-L-isoleucyl-L-threonyl-L-aspartic acid. Grades: ≥95%. CAS No. 195262-56-7. Molecular formula: C166H256N44O56S. Mole weight: 3796.17. BOC Sciences 10
GLP-2(rat) GLP-2(rat) is an intestinal growth factor. GLP-2(rat) stimulates cell proliferation and inhibits apoptosis. GLP-2(rat) enhances mucosal mass and function in residual small intestine after massive small bowel resection (MSBR) [1] [2]. Uses: Scientific research. Group: Peptides. CAS No. 195262-56-7. Pack Sizes: 5 mg; 10 mg. Product ID: HY-P1142. MedChemExpress MCE
GLP-2 (rat) trifluoroacetate salt GLP-2 is a gut peptide hormone that is primarily produced by enteroendocrine L cells of the small and large intestine. GLP-2 is an antagonist of the GLP-2 receptor (GLP-2R; Ki = 60 pM). Synonyms: Glucagon-like Peptide 2. Grades: ≥95%. Molecular formula: C166H256N44O56S·xCF3COOH. Mole weight: 3796.14. BOC Sciences 10
GLPG-0187 GLPG-0187 is a small molecule integrin receptor antagonist (IRA) with nanomolar affinity for the RGD-integrin receptors αvβ1, αvβ3, αvβ5, αvβ6 and α5β1 (IC50s = 1.2-3.7 nM). Integrin receptors are expressed on the surface of tumor vessel endothelial cells and some types of cancer cells, and play a crucial role in endothelial cell adhesion and migration. This compound shows an inhibitory activity of angiogenesis, bone-resorption and tumor, which is hopefully used as an anticancer drug. Uses: An integrin receptor antagonist (ira) can be used as an anticancer drug. Synonyms: GLPG0187; GLPG 0187; GLPG-0187; UNII-43A5P87Z4T; 43A5P87Z4T; SCHEMBL2372722; CHEMBL3319236; (2S) -3-[[2, 5-dimethyl-6-[4- (5, 6, 7, 8-tetrahydro-1, 8-naphthyridin-2-yl) piperidin-1-yl]pyrimidin-4-yl]amino]-2-[ (4-methoxyphenyl) sulfonylamino]propanoic acid. Grades: ≥98 %. CAS No. 1320346-97-1. Molecular formula: C29H37N7O5S. Mole weight: 595.719. BOC Sciences 9
GLPG0492 GLPG0492, a selective androgen receptor modulator, could be effective in decreasing muscle loss. The treatment study against Duchenne muscular dystrophy of it has alreadt been discontinued. Uses: Glpg0492 is a selective androgen receptor modulator that could be effective in decreasing muscle loss. Synonyms: DT-200; DT 200; DT200; GLPG0492; SCHEMBL2021011; CHEMBL2178100; GLPG 0492; GLPG-0492; VAJGULUVTFDTAS-GOSISDBHSA-N. Grades: 98%. CAS No. 1215085-92-9. Molecular formula: C19H14F3N3O3. Mole weight: 389.33. BOC Sciences 10
GLPG0492 R enantiomer The R-enantiomer of GLPG0492 which is a selective androgen receptor modulator, could be effective in decreasing muscle loss. Uses: The r-enantiomer of glpg0492 which is a selective androgen receptor modulator that could be effective in decreasing muscle loss. Synonyms: GLPG-0492 R enantiomer; GLPG 0492 R enantiomer; GLPG0492 R enantiomer. Grades: 98%. CAS No. 1215085-93-0. Molecular formula: C19H14F3N3O3. Mole weight: 389.33. BOC Sciences 10
GLPG0634 analog GLPG0634 analog (Compoun 176) is a broad spectrum JAK inhibitor with IC 50 values of <100 nM against JAK1, JAK2 and JAK3 [1]. Uses: Scientific research. Group: Signaling pathways. CAS No. 1206101-20-3. Pack Sizes: 10 mM * 1 mL; 5 mg; 10 mg; 50 mg. Product ID: HY-13961. MedChemExpress MCE
GLPG0634 analogue A potent and selective JAK1 inhibitor with IC50 values of 10, 28, 810, and 116 nM for JAK1, JAK2, JAK3, and TYK2, respectively. Synonyms: GLPG0634 analog; N-[5-[4-[(6-cyanopyridin-3-yl)methoxy]phenyl]-[1,2,4]triazolo[1,5-a]pyridin-2-yl]cyclopropanecarboxamide. Grades: >98%. CAS No. 1206101-20-3. Molecular formula: C23H18N6O2. Mole weight: 410.43. BOC Sciences 11
GLPG 0974 GLPG 0974 is a potent FFA2 antagonist (IC50 = 9 nM) with selectivity for FFA2 over FFA3. It was shown that GLPG 0974 inhibited acetate-induced human neutrophil migration in plasma or buffer, and also suppressed FFA2-induced expression of CD11b activation-specific epitope (AE) in human whole blood. Synonyms: GLPG0974; GLPG 0974; GLPG-0974. 4-[[[(2R)-1-(Benzo[b]thien-3-ylcarbonyl)-2-methyl-2-azetidinyl]carbonyl][(3-chlorophenyl)methyl]amino]butanoic acid. Grades: ≥98% by HPLC. CAS No. 1391076-61-1. Molecular formula: C25H25ClN2O4S. Mole weight: 485. BOC Sciences 9
GLPG-1690 Cas No. 1628260-79-6. BOC Sciences 8
GLPG1837 GLPG1837 is a potent, orally available potentiator of cystic fibrosis transmembrane conductance regulator (CFTR) with EC50 of 3 nM and 339 nM on F508del and G551D CFTR, respectively. Synonyms: ABBV-974; N-[3-(aminocarbonyl)-4,7-dihydro-5,5,7,7-tetramethyl-5H-thieno[2,3-c]pyran-2-yl]-1H-pyrazole-3-carboxamide. Grades: ≥98%. CAS No. 1654725-02-6. Molecular formula: C16H20N4O3S. Mole weight: 348.42. BOC Sciences 10
GLPG2938 GLPG2938 is an antagonists of sphingosine-1-phosphate (S1P) receptor for prophylaxis and?/or treatment of diseases including fibrotic, inflammatory, autoimmune, metabolic, cardiovascular, and?/or proliferative diseases. GLPG2938 displayed S1P inhibitory activity.with EC50 value of 9.5 nM (S1P2 antagonist EC50)?. Uses: Designed for use in research and industrial production. Additional or Alternative Names: MUN96006; MUN-96006; MUN 96006; GLPG2938; GLPG-2938; GLPG 2938. Product Category: Antagonists. Appearance: Solid powder. CAS No. 2130996-00-6. Molecular formula: C20H19F6N7O2. Mole weight: 503.41. Purity: >98%. IUPACName: 1-(2-ethoxy-6-(trifluoromethyl)pyridin-4-yl)-3-((5-methyl-6-(1-methyl-3-(trifluoromethyl)-1H-pyrazol-4-yl)pyridazin-3-yl)methyl)urea. Canonical SMILES: O=C(NCC1=NN=C(C2=CN(C)N=C2C(F)(F)F)C(C)=C1)NC3=CC(OCC)=NC(C(F)(F)F)=C3. Product ID: ACM2130996006. Alfa Chemistry — ISO 9001:2015 Certified. Alfa Chemistry.
GLPG3667 GLPG3667 is a reversible, ATP-competitive and orally active TYK2 inhibitor with an IC 50 of 2.3 nM. GLPG3667 inhibits IFNα/pSTAT1, and the IC 50 values ??in human peripheral blood mononuclear cell (PBMC) and whole blood assays are 70 nM and 623 nM, respectively. GLPG3667 has the potential for the study of inflammatory and autoimmune diseases [1]. Uses: Scientific research. Group: Signaling pathways. CAS No. 2308520-97-8. Pack Sizes: 1 mg; 5 mg; 10 mg; 25 mg; 50 mg; 100 mg. Product ID: HY-156961. MedChemExpress MCE
GLS1 Inhibitor-1 GLS1 Inhibitor-1 (Compound 27) is an orally active inhibitor for glutaminase 1 ( GLS1 ) with an IC 50 of 0.021 μM. GLS1 Inhibitor-1 inhibits the proliferation of PC-3 with an IC 50 of 0.3 nM. GLS1 Inhibitor-1 exhibits antitumor efficacy against NCI-H1703 with GI 50 of 0.011 μM. GLS1 Inhibitor-1 exhibits moderate pharmacokinetic characteristics [1]. Uses: Scientific research. Group: Signaling pathways. CAS No. 1832646-52-2. Pack Sizes: 5 mg; 10 mg. Product ID: HY-136704. MedChemExpress MCE
Glu-14-Calcitonin Glu-14-Calcitonin is an impurity of Calcitonin salmon, which is a calcium regulating hormone used to be an effective alternative for the treatment of postmenopausal osteoporosis. Synonyms: H-Cys-Ser-Asn-Leu-Ser-Thr-Cys-Val-Leu-Gly-Lys-Leu-Ser-Glu-Glu-Leu-His-Lys-Leu-Gln-Thr-Tyr-Pro-Arg-Thr-Asn-Thr-Gly-Ser-Gly-Thr-Pro-NH2 (Disulfide bond between Cys1 and Cys7); L-cysteinyl-L-seryl-L-asparagyl-L-leucyl-L-seryl-L-threonyl-L-cysteinyl-L-valyl-L-leucyl-glycyl-L-lysyl-L-leucyl-L-seryl-L-alpha-glutamyl-L-alpha-glutamyl-L-leucyl-L-histidyl-L-lysyl-L-leucyl-L-glutaminyl-L-threonyl-L-tyrosyl-L-prolyl-L-arginyl-L-threonyl-L-asparagyl-L-threonyl-glycyl-L-seryl-glycyl-L-threonyl-L-prolinamide (1->7)-disulfide; RPR 108969; Calcitonin (salmon), 14-L-glutamic acid-. CAS No. 187476-38-6. Molecular formula: C145H239N43O49S2. Mole weight: 3432.88. BOC Sciences 8
Glu-20-Calcitonin Glu-20-Calcitonin is an impurity of Calcitonin salmon, which is a calcium regulating hormone used to be an effective alternative for the treatment of postmenopausal osteoporosis. Synonyms: H-Cys-Ser-Asn-Leu-Ser-Thr-Cys-Val-Leu-Gly-Lys-Leu-Ser-Gln-Glu-Leu-His-Lys-Leu-Glu-Thr-Tyr-Pro-Arg-Thr-Asn-Thr-Gly-Ser-Gly-Thr-Pro-NH2 (Disulfide bond between Cys1 and Cys7); L-cysteinyl-L-seryl-L-asparagyl-L-leucyl-L-seryl-L-threonyl-L-cysteinyl-L-valyl-L-leucyl-glycyl-L-lysyl-L-leucyl-L-seryl-L-glutaminyl-L-alpha-glutamyl-L-leucyl-L-histidyl-L-lysyl-L-leucyl-L-alpha-glutamyl-L-threonyl-L-tyrosyl-L-prolyl-L-arginyl-L-threonyl-L-asparagyl-L-threonyl-glycyl-L-seryl-glycyl-L-threonyl-L-prolinamide (1->7)-disulfide; RPR 108970; Calcitonin (salmon), 20-L-glutamic acid-. CAS No. 187476-39-7. Molecular formula: C145H239N43O49S2. Mole weight: 3432.88. BOC Sciences 8
Glu(4)-AVP Glu4-AVP is an impurity of Vasopressin, which is an antidiuretic hormone secreted from the posterior pituitary. Synonyms: Glu(4)-Arg-Vasopressin; Glu(4)-Vasopressin; Glu4-AVP; H-Cys-Tyr-Phe-Glu-Asn-Cys-Pro-Arg-Gly-NH2 (Disulfide bridge: Cys1-Cys6); L-cysteinyl-L-tyrosyl-L-phenylalanyl-L-glutamyl-L-asparagyl-L-cysteinyl-L-prolyl-L-arginyl-glycinamide (1->6)-disulfide. CAS No. 2075712-12-6. Molecular formula: C46H64N14O13S2. Mole weight: 1085.22. BOC Sciences 8
Glu 4-Oxytocin Glu 4-Oxytocin is an impurity of Oxytocin, which is a mammalian neurohypophysial hormone used as a vasodilator agent. Synonyms: L-cystyl-L-tyrosyl-L-isoleucyl-L-glutamyl-L-asparginyl-L-cystyl-L-leucyl-L-prolyl-L-glycinamide (disulfide bridge between cysteines); H-Cys-Tyr-Ile-Glu-Asn-Cys-Pro-Leu-Gly-NH2 (Disulfide bridge: Cys1-Cys6); [Glu4]-Oxytocin; L-cysteinyl-L-tyrosyl-L-isoleucyl-L-alpha-glutamyl-L-asparagyl-L-cysteinyl-L-prolyl-L-leucyl-glycinamide (1->6)-disulfide; Oxytocin, 4-L-glutamic acid-; Oxytocin, 4-glutamic acid. Grades: ≥95%. CAS No. 4314-67-4. Molecular formula: C43H65N11O13S2. Mole weight: 1008.18. BOC Sciences 8
Glu-Asp-OH Synonyms: L-α-Glutamyl-L-aspartic acid. Grades: ≥ 98% (TLC). CAS No. 3918-84-1. Molecular formula: C9H14N2O7. Mole weight: 262.22. BOC Sciences 5
Glu-Asp-OH 98+% (TLC) Glu-Asp-OH 98+% (TLC). Group: Biochemicals. Grades: Reagent Grade. Pack Sizes: 250mg, 1g, 2.5g. US Biological Life Sciences. USBiological 5
Worldwide

Would you like to list your products on USA Chemical Suppliers?

Our database is helping our users find suppliers everyday.

Add Your Products