A directory of where to buy chemicals in the USA, including: distributors, industrial manufacturers, bulk supplies and wholesalers of raw ingredients & finished goods.
Search for products or services, then visit the suppliers website for prices or more information.
| Product | Description | |
|---|---|---|
| L-talarate dehydratase | Requires Mg2+. The enzyme, isolated from the bacteria Salmonella typhimurium and Polaromonas sp. JS666, also has activity with galactarate (cf. EC 4.2.1.42, galactarate dehydratase). Group: Enzymes. Synonyms: L-talarate hydro-lyase. Enzyme Commission Number: EC 4.2.1.156. Storage: Store it at +4 ?C for short term. For long term storage, store it at -20 ?C?-80 ?C. Form: Liquid or lyophilized powder. EXWM-4997; L-talarate dehydratase; EC 4.2.1.156; L-talarate hydro-lyase. Cat No: EXWM-4997. |  |
| L-Talitol | L-Talitol is a biomedical compound used in the treatment of diabetes-related nerve damage and fibromyalgia symptoms. As a polyol, it acts as a sugar substitute and exhibits antioxidant properties. L-Talitol aids in inhibiting advanced glycation end products (AGEs) formation and reducing oxidative stress, thus preserving nerve function and alleviating pain associated with these conditions. Synonyms: (2S,3R,4S,5S)-Hexane-1,2,3,4,5,6-hexaol; (2S,3S,4R,5S)-hexane-1,2,3,4,5,6-hexol; Altritol, L-; (2S,3R,4S,5S)-HEXANE-1,2,3,4,5,6-HEXOL. CAS No. 60660-58-4. Molecular formula: C6H14O6. Mole weight: 182.17. |  |
| L-Talose | L-Talose is an extraordinary biomedical product, aiding in studying intricate metabolic disorders. Notably, the prodigious implications of L-Talose burgeon in the realm of studying diabetes and diverse metabolic predicaments, courtesy of its active engagement in the multifaceted labyrinth of carbohydrate metabolism pathways. Synonyms: L-Talose; 23567-25-1; L-(-)-TALOSE; (2R,3R,4R,5S)-2,3,4,5,6-pentahydroxyhexanal; aldehydo-L-talose; EINECS 245-744-9; L(-)-Talose; SCHEMBL16164349; CHEBI:86058; DTXSID701319160; GEO-04669; MFCD00135850; AKOS027320154; HY-W145580; AS-56035; CS-0214572; FT-0624556; T1767; D92524; A878210; W-201988; Q27158868. CAS No. 23567-25-1. Molecular formula: C6H12O6. Mole weight: 180.16. | |
| L (+)-Tartaric acid | L (+)-Tartaric acid. Uses: For analytical and research use. Group: Impurity standards. CAS No. 87-69-4. Molecular Formula: C4H6O6. Mole Weight: 150.09. Catalog: APB87694. |  |
| L-Tartaric acid | 1kg Pack Size. Group: Aroma Chemicals, Ligands. Formula: HO2CCH(OH)CH(OH)CO2H. CAS No. 87-69-4. Prepack ID 36724317-1kg. Molecular Weight 150.09. See USA prepack pricing. |  |
| L+Tartaric Acid | Complexing agent. Group: Biochemicals. Alternative Names: 2,3-dihydroxybutanedioic acid; (2R,3R)-2,3-Dihydroxysuccinic acid. Grades: ACS Grade. CAS No. 87-69-4. Pack Sizes: 100g, 500g, 2.5Kg, 5Kg. Molecular Formula: C4H6O6, Molecular Weight: 150.09. US Biological Life Sciences. |  Worldwide |
| L(+)-Tartaric acid 99+% ACS | Purity (Titration): Group: Biochemicals. Grades: ACS Grade. CAS No. 87-69-4. Pack Sizes: 100g, 500g, 1Kg, 5Kg, 10Kg. US Biological Life Sciences. | Worldwide |
| L-Tartaric Acid, crystal | L-Tartaric Acid, crystal. Grades: NF. CAS No. 87-69-4. Pack Sizes: Gram Quantities: 6 x 500 gm, 4 x 2.5 kg. Order Number: 26362. |  www.prochemonline.com |
| L-(+)-Tartaric acid FCC, 99.7% | L-(+)-Tartaric acid FCC, 99.7%. CAS No: 87-69-4 |  Sarchem Laboratories New Jersey NJ |
| L(+)-tartrate dehydratase | The enzyme exists in an inactive low-molecular-mass form, which is converted into active enzyme in the presence of Fe2+ and thiol. cf. EC 4.2.1.81 D(-)-tartrate dehydratase. Group: Enzymes. Synonyms: tartrate dehydratase; tartaric acid dehydrase; L-tartrate dehydratase; L-(+)-tartaric acid dehydratase; (R,R)-tartrate hydro-lyase. Enzyme Commission Number: EC 4.2.1.32. CAS No. 9014-40-8. Storage: Store it at +4 ?C for short term. For long term storage, store it at -20 ?C?-80 ?C. Form: Liquid or lyophilized powder. EXWM-5023; L(+)-tartrate dehydratase; EC 4.2.1.32; 9014-40-8; tartrate dehydratase; tartaric acid dehydrase; L-tartrate dehydratase; L-(+)-tartaric acid dehydratase; (R,R)-tartrate hydro-lyase. Cat No: EXWM-5023. | |
| L-Taurine | L-Taurine. Categories: taurine; 2-aminoethanesulfonic acid. |  CA, FL & NJ |
| L-TBOA ammonia salt | L-TBOA is a potent and competitive blocker of human excitatory amino acid transporters (EAAT1-3; IC50 values 23 μM, 3.8 μM, 7.0 μM for EAAT1, EAAT2, and EAAT3, respectively). L-TBOA is the most active isomer of DL-TBOA, and exhibits high selectivity for EAATs over ionotropic and metabotropic glutamate receptors. Synonyms: (2S,3S)-2-amino-3-phenylmethoxybutanedioic acid ammonia salt. Grades: 99%. Molecular formula: C11H13NO5.NH3. Mole weight: 256.26. | |
| L-tert-Leucine | L-tert-Leucine. Group: Biochemicals. Alternative Names: (S)-2-Amino-3,3-dimethylbutyric acid; L-a-tert-Butylglycine. Grades: Highly Purified. CAS No. 20859-02-3. Pack Sizes: 25g, 50g, 100g, 250g, 500g. Molecular Formula: C6H13NO2. US Biological Life Sciences. | Worldwide |
| L-tert-Leucine Methyl Ester Hydrochloride | L-tert-Leucine Methyl Ester Hydrochloride is a leucine derivative [1]. Uses: Scientific research. Group: Peptides. CAS No. 63038-27-7. Pack Sizes: 25 g. Product ID: HY-I0172. |  |
| L-tert-Leucine N-methylamide | Synonyms: H-Tle-NHMe; H-(tBu)Gly-NHMe; L-α-(t-Butyl)glycine N-methylamide. CAS No. 89226-12-0. Molecular formula: C7H16N2O. Mole weight: 144.21. | |
| L-tert-Leucine t-butyl ester hydrochloride | Synonyms: H-Tle-OtBu HCl; H-(tBu)Gly-OtBu HCl; L-α-(t-Butyl)glycine t-butyl ester hydrochloride. Grades: 95%. CAS No. 119483-45-3. Molecular formula: C10H22ClNO2. Mole weight: 223.75. | |
| L-tert-Leucine t-butyl ester hydrochrolide;L-α-t-Butylglycine t-butyl ester hydrochrolide | Heterocyclic Organic Compound. Alternative Names: H-TLE-OTBU HCL, SCHEMBL627921, MolPort-020-003-852, OOJKHARXMDMOCG-OGFXRTJISA-N, L-tert-leucine-t-butyl ester hydrochloride, L-tert-leucine tert-butyl ester hydrochloride, K-1375, tert-butyl (2S)-2-amino-3,3-dimethylbutanoate hydrochloride, 119483-45-3. CAS No. 119483-45-3. Molecular formula: C10H22ClNO2. Mole weight: 223.75. Purity: 0.96. IUPACName: tert-butyl (2S)-2-amino-3,3-dimethylbutanoate;hydrochloride. Canonical SMILES: CC(C)(C)C(C(=O)OC(C)(C)C)N.Cl. Catalog: ACM119483453. |  |
| L-tert-Leucinol | Synonyms: H-Tle-ol; H-(tBu)Gly-ol; (S)-2-Amino-3,3-dimethyl-1-butanol; S-Tert-Leucinol; L-t-butyl leucinol. Grades: ≥ 97%. CAS No. 112245-13-3. Molecular formula: C6H15NO. Mole weight: 117.19. | |
| L-Tert-Leucinol 98+% (GC) | L-Tert-Leucinol 98+% (GC). Group: Biochemicals. Grades: GC. Pack Sizes: 1g, 5g. US Biological Life Sciences. | Worldwide |
| L-tert-Leucinol hydrochloride | Synonyms: H-Tle-ol HCl; H-(tBu)Gly-ol HCl; (S)-2-Amino-3,3-dimethyl-1-butanol hydrochloride; (S)-t-butyl-leucinol hydrochloride. CAS No. 352545-44-9. Molecular formula: C6H16ClNO. Mole weight: 153.65. | |
| L-Tetrahydrofolic Acid | Tetrahydrofolic acid is a folic acid derivative. It is a cofactor in many bio-reactions, especially in the metabolism of amino acids and nucleic acids. Uses: A cofactor in many bio-reactions, especially in the metabolism of amino acids and nucleic acids. Synonyms: N-[4-[[(2-Amino-3,4,5,6,7,8-hexahydro-4-oxo-6-pteridinyl)methyl]amino]benzoyl]-L-glutamic Acid; (-)-L-5,6,7,8-Tetrahydrofolic Acid; THFA; Tetrahydropteroylglutamic Acid. Grades: ≥70% (when packaged). CAS No. 135-16-0. Molecular formula: C19H23N7O6. Mole weight: 445.43. | |
| L-Tetrahydropalmatine | L-Tetrahydropalmatine. Group: Biochemicals. Alternative Names: (S)-form; Rotundine. Grades: Plant Grade. CAS No. 483-14-7. Pack Sizes: 20mg. Molecular Formula: C21H25NO4, Molecular Weight: 355.428. US Biological Life Sciences. | Worldwide |
| L-Tetrandrine | Heterocyclic Organic Compound. Alternative Names: L-TETRANDRINE;PHAENTHINE. CAS No. 1263-79-2. Molecular formula: C38H42N2O6. Mole weight: 622.75. Catalog: ACM1263792. | |
| L-Theanine | L-Theanine is a glutamine analog found in the green tea plant. It can bind to glutamate receptors and inhibit glutamate transporters, which exhibits a neuroprotective effect. It promotes self-renewal of human embryonic stem cells (hESCs). Uses: Ingredient of health care products. Synonyms: N-Ethyl-L-glutamine; (2S)-2-amino-5-(ethylamino)-5-oxopentanoic acid. Grades: Assay: 98%-102%. CAS No. 3081-61-6. Molecular formula: C7H14N2O3. Mole weight: 174.2. | |
| L-Theanine | A non-protein amino acid mainly found naturally in the green tea plant. It may have activity in modulating the metabolism of cancer chemotherapeutics agents. Group: Biochemicals. Grades: Highly Purified. Pack Sizes: 250mg. US Biological Life Sciences. | Worldwide |
| L-Theanine | L-Theanine (L-Glutamic Acid γ-ethyl amide) is a non-protein amino acid contained in green tea leaves, which blocks the binding of L-glutamic acid to glutamate receptors in the brain, and with neuroprotective, anticancer and anti-oxidative activities. L-Theanine can pass through the blood - brain barrier and is orally active [1] [2] [3]. Uses: Scientific research. Group: Natural products. Alternative Names: L-Glutamic Acid γ-ethyl amide; Nγ-Ethyl-L-glutamine. CAS No. 3081-61-6. Pack Sizes: 10 mM * 1 mL; 100 mg; 200 mg. Product ID: HY-15121. | |
| L-Theanine | L-Theanine - Product ID: NST-10-145. Category: Alkaloids. Alternative Names: N-Ethyl-L-glutamine, (S)-2-Amino-5-(ethylamino)-5-oxopentanoic acid, L-Theanine, Suntheanine, Theanin, Theanine. Purity: 98%. Test method: HPLC. CAS No. 3081-61-6. Pack Sizes: 10g, 20g, 50g, 100g. Appearance: White to beige colored Powder. Molecular formula: C7H14N2O3. Mole weight: 174.2. Storage: +2 +8 °C. |  |
| L-Theanine | L-Theanine. CAS No. Molecular formula: 3081-61-6. |  |
| L-Theanine | L-Theanine. Categories: l-theanine; 3081-61-6. | CA, FL & NJ |
| L-Theanine 99% | L-Theanine 99%. | CA, FL & NJ |
| L-Theanine-d5 (N-ethyl-d5) | Deuterium Labeled Products-Medical Research. Alternative Names: L-Glutamic Acid γ-(ethylamide); Nγ-Ethyl-L-glutamine. CAS No. 1217451-85-8. Molecular formula: CD3CD2NHCOCH2CH2CH(NH2)COOH. Mole weight: 179.23. IUPACName: (2S)-2,3,3-trideuterio-2-(dideuterioamino)-5-(ethylamino)-5-oxopentanoic acid. Canonical SMILES: [2H][C@@] (C (=O)O) (C ([2H]) ([2H])CC (=O)NCC)N ([2H])[2H]. Catalog: ACM1217451858. | |
| L-Theanine (-) L-Serine (-) L-Histidine (-) L-Glutamine | Heterocyclic Organic Compound. CAS No. 123-23-3. Catalog: ACM123233. | |
| L-Theanine (N-Ethyl-L-glutamine) | A non-protein amino acid mainly found naturally in the green tea plant. It may have activity in modulating the metabolism of cancer chemotherapeutics agents. Group: Biochemicals. Alternative Names: N-Ethyl-L-glutamine; Nγ-Ethyl-L-glutamine; Suntheanine; Theanin; Theanine; NSC 21308. Grades: Highly Purified. CAS No. 3081-61-6. Pack Sizes: 10g, 25g, 50g, 100g, 250g. Molecular Formula: C?H??N?O?, Molecular Weight: 174.2. US Biological Life Sciences. | Worldwide |
| L-Theanine (Standard) | L-Theanine (Standard) is the analytical standard of L-Theanine. This product is intended for research and analytical applications. L-Theanine (L-Glutamic Acid γ-ethyl amide) is a non-protein amino acid contained in green tea leaves, which blocks the binding of L-glutamic acid to glutamate receptors in the brain, and with neuroprotective, anticancer and anti-oxidative activities. L-Theanine can pass through the blood - brain barrier and is orally active [1] [2] [3]. Uses: Scientific research. Group: Natural products. CAS No. 3081-61-6. Pack Sizes: 10 mg; 25 mg; 50 mg; 100 mg. Product ID: HY-15121R. | |
| L-Thiaproline ≥98.5% | L-Thiaproline ≥98.5%. Group: Biochemicals. Grades: Reagent Grade. Pack Sizes: 25g, 100g, 500g, 1Kg. US Biological Life Sciences. | Worldwide |
| L-Thiazolidin-2-one-4-carboxylic acid | L-Thiazolidin-2-one-4-carboxylic acid. Group: Biochemicals. Alternative Names: L-2-Oxothiazolidine-4-carboxylic acid; (R)-2-Oxothiazolidine-4-carboxylic acid. Grades: Highly Purified. CAS No. 19771-63-2. Pack Sizes: 2g, 5g, 10g, 25g, 50g. US Biological Life Sciences. | Worldwide |
| L-Thiazolidin-2-one-4-carboxylic acid ≥95% (NMR) | L-Thiazolidin-2-one-4-carboxylic acid ≥95% (NMR). Group: Biochemicals. Grades: Reagent Grade. Pack Sizes: 1g, 5g, 25g, 100g. US Biological Life Sciences. | Worldwide |
| L(-)-Thiazolidine-4-carboxylic acid | L(-)-Thiazolidine-4-carboxylic acid. Group: Biochemicals. Grades: Highly Purified. CAS No. 34592-47-7. Pack Sizes: 100g, 250g, 500g, 1kg, 2kg. US Biological Life Sciences. | Worldwide |
| L-Thioproline | L-Thioproline is a proline derivative [1]. Uses: Scientific research. Group: Peptides. CAS No. 34592-47-7. Pack Sizes: 100 g; 500 g. Product ID: HY-W012676. | |
| L-Thioproline | L-Thioproline. Categories: l-thioproline; 34592-47-7. | CA, FL & NJ |
| L-Threitol | L-Threitol is a useful synthetic intermediate. It was used to synthesize novel aza-sugar-based metalloproteinase MMP/ADAM inhibitors. It is also a diastereomer of Erythritol which is a food additive. Synonyms: 1,3,5-orthoformate-myo-inositol; meso-D-myo-inositol-1,3,5-O-orthoformate; L-1,2,3,4-Butanetetrol; myo-inositol 1,3,5-monoorthoformate; (2s,3s)-butane-1,2,3,4-tetraol. Grades: ≥ 95%. CAS No. 2319-57-5. Molecular formula: C4H10O4. Mole weight: 122.12. | |
| L-threo-(+)-2-amino-1-(4-nitrophenyl)-1,3-propanediol | L-threo-(+)-2-amino-1-(4-nitrophenyl)-1,3-propanediol. Group: Biochemicals. Alternative Names: (1S,2S)-(+)-2-Amino-1-(4-nitrophenyl)-1,3-propanediol. Grades: Highly Purified. CAS No. 2964-48-9. Pack Sizes: 50g, 100g, 250g, 500g, 1kg. Molecular Formula: C9H12N2O4. US Biological Life Sciences. | Worldwide |
| L-threo-2-deoxy-pentose | L-threo-2-deoxy-pentose, a pivotal compound applied in the biomedical sector, manifests utmost indispensability as a fundamental constituent in the synthesis of nucleic acids and glycoproteins. Its paramount significance lies in the augmentation of antiviral therapeutics and the remediation of viral afflictions including HIV and hepatitis C. Synonyms: (3S,4S)-3,4,5-Trihydroxypentanal. CAS No. 1818355-20-2. Molecular formula: C5H10O4. Mole weight: 134.13. | |
| L-(+)-Threo-2-(N,N-dimethylamino)-1-(4-aminophenyl)-1,3-propanediol | Heterocyclic Organic Compound. Alternative Names: L-(+)-THREO-2-(N,N-DIMETHYLAMINO)-1-(4-AMINOPHENYL)-1,3-PROPANEDIOL. CAS No. 129170-43-0. Molecular formula: C11H18N2O2. Mole weight: 210.27. Catalog: ACM129170430. | |
| L-threo-3-deoxy-hexylosonate aldolase | The enzyme takes part in a D-galacturonate degradation pathway in the fungi Aspergillus niger and Trichoderma reesei (Hypocrea jecorina). Group: Enzymes. Synonyms: GAAC; LGA1. Enzyme Commission Number: EC 4.1.2.54. Storage: Store it at +4 ?C for short term. For long term storage, store it at -20 ?C?-80 ?C. Form: Liquid or lyophilized powder. EXWM-4891; L-threo-3-deoxy-hexylosonate aldolase; EC 4.1.2.54; GAAC; LGA1. Cat No: EXWM-4891. | |
| L-Threo-3-hexulosonic acid,2-[[2-[(1-carboxy-2-phenylethyl)amino]-2-oxoethyl]imino]-2-deoxy-,-gamma--lactone,(S)-(9ci) | Heterocyclic Organic Compound. CAS No. 118665-36-4. Catalog: ACM118665364. | |
| L-(-)-threo-3-Hydroxyaspartic acid | L-(-)-threo-3-Hydroxyaspartic acid. Group: Biochemicals. Grades: Purified. CAS No. 7298-99-9. Pack Sizes: 10mg. US Biological Life Sciences. | Worldwide |
| L-threo-3-Hydroxyaspartic acid | L-threo-3-Hydroxyaspartic acid is a potent EAAT inhibitor with K i s of 11, 19 and 14 μM for EAAT1, EAAT2 and EAAT3, respectively in HEK293 cell lines [1]. Uses: Scientific research. Group: Signaling pathways. CAS No. 7298-99-9. Pack Sizes: 1 mg; 5 mg; 10 mg. Product ID: HY-100801. | |
| L-threo-α-Phenyl- | L-threo-α-Phenyl-. Group: Biochemicals. Alternative Names: (αS,2S)-α-phenyl-2-piperidineacetamide, α-phenyl-. Grades: Highly Purified. CAS No. 160707-38-0. Pack Sizes: 5mg. Molecular Formula: C13H18N2O, Molecular Weight: 218.29. US Biological Life Sciences. | Worldwide |
| L-threo-β-Hydroxyaspartic acid | L-threo-β-Hydroxyaspartic acid is an amino acid antibiotic produced by Arthrinium phaeospermum T-53 and Streptomyces sp. 7540-MC1. It has the activity of inhibiting Bacillus subtilis, Xanthomonas oryzae, Mycobacterium phlei and Botrytis cinerea. Synonyms: (3R)-3-hydroxy-L-aspartic acid; Erythro-beta-hydroxy-L-aspartic acid; erythro-beta-Hydroxyaspartic acid; (3R)-3-Hydroxyaspartate. Grades: 95%. CAS No. 7298-98-8. Molecular formula: C4H7NO5. Mole weight: 149.10. | |
| L-(+)-threo-chloramphenicol | L-(+)-threo-chloramphenicol. Group: Biochemicals. Alternative Names: 2, 2-Dichloro-N-[ (1S, 2S) -2-hydroxy-1- (hydroxymethyl) -2- (4-nitrophenyl) ethyl]acetamide; (+)-Chloramphenicol; (1S,2S)-2-(2,2-Dichloroacetamido)-1-(4-nitrophenyl)-1,3-propanediol. Grades: Highly Purified. CAS No. 134-90-7. Pack Sizes: 50mg, 100mg, 250mg, 500mg, 1g. Molecular Formula: C11H12Cl2N2O5. US Biological Life Sciences. | Worldwide |
| L-threo-droxidopa | L-threo-droxidopa. Group: Biochemicals. Alternative Names: Droxidopa; L-threo 3,4-Dihydroxyphenylserine. Grades: Highly Purified. CAS No. 23651-95-8. Pack Sizes: 250mg, 500mg, 1g, 2g, 5g. Molecular Formula: C9H11NO5. US Biological Life Sciences. | Worldwide |
| L-threo Lysosphingomyelin (d18:1) | L-threo Lysosphingomyelin (d18:1) is an endogenous bioactive sphingolipid and an agonist of sphingosine-1-phosphate (S1P) receptors 1-3. Synonyms: L-threo Lyso SM (18:1); L-threo Lysosphingomyelin (18:1); L-threo Sphingosine-1-Phosphocholine (d18:1); L-threo-Sphingosylphosphorylcholine; [(E,2S,3S)-2-amino-3-hydroxyoctadec-4-enyl] 2-(trimethylazaniumyl)ethyl phosphate. Grades: ≥98%. CAS No. 105615-55-2. Molecular formula: C23H49N2O5P. Mole weight: 464.62. | |
| L-threo-methylphenidate hydrochloride | L-threo-methylphenidate hydrochloride. Group: Biochemicals. Alternative Names: (2S,2'S)-(-)-threo-methyl a-phenyl-a-(2-piperidyl)acetate hydrochloride. Grades: Highly Purified. CAS No. 40572-71-2. Pack Sizes: 1mg, 2mg, 5mg, 10mg, 25mg. Molecular Formula: C14H20ClNO2. US Biological Life Sciences. | Worldwide |
| L-threonate 3-dehydrogenase | This enzyme belongs to the family of oxidoreductases, specifically those acting on the CH-OH group of donor with NAD+ or NADP+ as acceptor. The systematic name of this enzyme class is L-threonate:NAD+ 3-oxidoreductase. Other names in common use include threonate dehydrogenase, and L-threonic acid dehydrogenase. This enzyme participates in ascorbate and aldarate metabolism. Group: Enzymes. Synonyms: threonate dehydrogenase; L-threonic acid dehydrogenase. Enzyme Commission Number: EC 1.1.1.129. CAS No. 37250-59-2. Storage: Store it at +4 ?C for short term. For long term storage, store it at -20 ?C?-80 ?C. Form: Liquid or lyophilized powder. EXWM-0032; L-threonate 3-dehydrogenase; EC 1.1.1.129; 37250-59-2; threonate dehydrogenase; L-threonic acid dehydrogenase. Cat No: EXWM-0032. | |
| L-Threonic acid | L-Threonic acid is an esteemed biomedical compound, used for studying the formidable adversaries of oxidative stress and neurodegenerative disorders. Remarkably, its antioxidant prowess studys cellular detriments and assuages inflammation affiliated with the onerous triad of Alzheimer's, Parkinson's and cardiovascular afflictions. Synonyms: (2R,3S)-2,3,4-trihydroxybutanoic acid. CAS No. 7306-96-9. Molecular formula: C4H8O5. Mole weight: 136.10. | |
| L-Threonic acid-1,4-lactone | L-Threonic acid-1,4-lactone, a vital constituent in the biomedical sector, possesses immense therapeutic potential. Its efficacy has been observed in managing a spectrum of health conditions, encompassing diabetes, cardiovascular disorders, and neurodegenerative ailments. In the realm of medicinal intervention, L-Threonic acid-1,4-lactone serves as an indispensable forerunner for synthesizing pharmacological agents attuned to combatting these afflictions, thereby presenting promising avenues for enhancing patient well-being. Synonyms: L-Threono-1,4-lactone; Threonolactone; Threonic acid-1,4-lactone; (3R,4S)-3,4-dihydroxydihydrofuran-2(3H)-one; (3R-trans)-Dihydro-3,4-dihydroxy-2(3H)-furanone; L-Threonic Acid γ-Lactone; L-Threono-γ-lactone. Grades: ≥95%. CAS No. 21730-93-8. Molecular formula: C4H6O4. Mole weight: 118.09. | |
| L-Threonic acid calcium salt 99+% | L-Threonic acid calcium salt 99+%. Group: Biochemicals. Grades: Reagent Grade. Pack Sizes: 1g, 5g, 25g, 100g. US Biological Life Sciences. | Worldwide |
| L-Threonic acid magnesium | L-Threonic acid magnesium salt is the enantiomer of Threonic acid and a metabolite of vitamin C. L-Ascorbic acid (L-Ascorbate), an electron donor, is an endogenous antioxidant agent [1]. Uses: Scientific research. Group: Signaling pathways. Alternative Names: Magnesium L-threonate. CAS No. 778571-57-6. Pack Sizes: 5 mg; 10 mg; 25 mg; 50 mg; 100 mg. Product ID: HY-134240. | |
| L-Threoninamide | Cas No. 49705-99-9. Molecular formula: C4H10N2O2. Mole weight: 118.1. | |
| L-Threoninamide,d-phenylalanyl-L-cysteinyl-L-tyrosyl-D-tryptophyl-L-arginyl-L-threonyl-3-mercapto-L-valyl-,cyclic(2®7)-disulfide | Heterocyclic Organic Compound. CAS No. 103429-32-9. Molecular formula: C51H69N13O11S2. Mole weight: 1104.3. Catalog: ACM103429329. | |
| L-Threoninamide,d-phenylalanyl-L-cysteinyl-L-tyrosyl-D-tryptophyl-L-ornithyl-L-threonyl-3-mercapto-L-valyl-,cyclic(2®7)-disulfide | Heterocyclic Organic Compound. CAS No. 103429-31-8. Molecular formula: C50H67N11O11S2. Mole weight: 1062.26. Purity: >95 %. Catalog: ACM103429318. | |
| L-Threoninamide,glycyl-L-tryptophyl-L-threonyl-L-Leucyl-L-asparaginyl-L-seryl-L-alanylglycyl-L-tyrosyl-L-Leucyl-L-Leucylglycyl-L-prolyl-L-histidyl-L-alanyl-L-isoleucyl-l-a-aspartyl-l-asparaginyl-l-his | Heterocyclic Organic Compound. Alternative Names: GWTLNSAGYLLGPHAIDNHRSFSDKHGLT-NH2; GLY-TRP-THR-LEU-ASN-SER-ALA-GLY-TYR-LEU-LEU-GLY-PRO-HIS-ALA-ILE-ASP-ASN-HIS-ARG-SER-PHE-SER-ASP-LYS-HIS-GLY-LEU-THR-NH2; Rat galanin; H-Gly-Trp-Thr-Leu-Asn-Ser-Ala-Gly-Tyr-Leu-Leu-Gly-Pro-His-Ala-Ile-Asp-Asn-His-Arg-Ser-. CAS No. 114547-31-8. Molecular formula: C141H211N43O41. Mole weight: 3164.45. Appearance: White lyophilized powder. Purity: 0.96. IUPACName: Galanin (1-29) (rat, mouse). Canonical SMILES: CCC (C)C (C (=O)NC (CC (=O)O)C (=O)NC (CC (=O)N)C (=O)NC (CC1=CNC=N1)C (=O)NC (CCCNC (=N)N)C (=O)NC (CO)C (=O)NC (CC2=CC=CC=C2)C (=O)NC (CO)C (=O)NC (CC (=O)O)C (=O)NC (CCCCN)C (=O)NC (CC3=CNC=N3)C (=O)NCC (=O)NC (CC (C)C)C (=O)NC (C (C)O)C (=O)N)NC (=O)C (C)NC (=O)C (CC4=CNC=N4)NC (=O)C5CCCN5C (=O)CNC (=O)C (CC (C)C)NC (=O)C (CC (C)C)NC (=O)C (CC6=CC=C (C=C6)O)NC (=O)CNC (=O)C (C)NC (=O)C (CO)NC (=O)C (CC (=O)N)NC (=O)C (CC (C)C)NC (=O)C (C (C)O)NC (=O)C (CC7=CNC8=CC=CC=C87)NC (=O)CN. Catalog: ACM114547318. | |
| L-Threonine | 500g Pack Size. Group: Amino Acids. Formula: C4H9NO3. CAS No. 72-19-5. Prepack ID 29578582-500g. Molecular Weight 119.12. See USA prepack pricing. | |
| L-Threonine | 100g Pack Size. Group: Amino Acids. Formula: C4H9NO3. CAS No. 72-19-5. Prepack ID 29578582-100g. Molecular Weight 119.12. See USA prepack pricing. | |
| L-Threonine | L-enantiomer. Group: Biochemicals. Alternative Names: (S)-Threonine; H-Thr-OH; 2-Amino-3-hydroxybutyric Acid. Grades: Cell Culture Grade. CAS No. 72-19-5. Pack Sizes: 100g, 250g, 500g, 1Kg, 2.5Kg, 10Kg. US Biological Life Sciences. | Worldwide |
| L-Threonine | L-Threonine is a natural amino acid, can be produced by microbial fermentation, and is used in food, medicine, or feed [1] [2]. Uses: Scientific research. Group: Natural products. CAS No. 72-19-5. Pack Sizes: 10 mM * 1 mL; 100 mg. Product ID: HY-N0658. | |
| L-Threonine | L-Threonine is an essential amino acid found in high-protein foods. Protein supplement in health care products. Uses: Ingredient of health care products. Synonyms: Threonine; H-Thr-OH; Threonin. Grades: 98%. CAS No. 72-19-5. Molecular formula: C4H9NO3. Mole weight: 119.12. | |
| L- Threonine | L- Threonine. Group: Food ingredients. Pack Sizes: 25 Kgs. |  |
| L-(-)-Threonine | L-enantiomer. Group: Heterocyclic organic compound. Alternative Names: L-Threonine, PharmaGrade, Ajinomoto, EP, JP, USP, manufactured under appropriate GMP controls for Pharma or Biopharmaceutical production, suitable for cell culture; CAS-72-19-5; Certified Reference Material; L-2-Amino-3-hydroxybutyric acid; KS-00000AAW; UNII-TFM6DU5S6A component AYFVYJQAPQTCCC-GBXIJSLDSA-N; L-(U-14C)Threonine; Treonina; 2-Amino-3-hydroxybutanoate; [R-(R*,S*)]-2-Amino-3-hydroxybutanoic acid. CAS No. 72-19-5. Molecular formula: C4H9NO3;C4H9NO3. Mole weight: 119.12g/mol. IUPACName: (2S,3R)-2-amino-3-hydroxybutanoic acid. Canonical SMILES: CC(C(C(=O)O)N)O. ECNumber: 200-774-1. Catalog: ACM72195. | |
Our database is helping our users find suppliers everyday.
