A directory of where to buy chemicals in the USA, including: distributors, industrial manufacturers, bulk supplies and wholesalers of raw ingredients & finished goods.
Search for products or services, then visit the suppliers website for prices or more information.
| Product | Description | |
|---|---|---|
| MPI-5a | MPI-5a is a cell-permeable and potent histone deacetylase 6 (HDAC6) inhibitor. It is a cytoplasmic enzyme that targets α-tubulin, cortactin, and heat shock protein 90, leading to inhibition of cancer development, proliferation and invasion. Synonyms: N-hydroxy-2-(1-methyl-1H-pyrrole-2-carbonyl)-1,2,3,4-tetrahydroisoquinoline-6-carboxamide. Grades: ≥95%. CAS No. 1259296-46-2. Molecular formula: C16H17N3O3. Mole weight: 299.3. |  |
| MPLA | Monophosphoryl Lipid A (Synthetic) The product is a synthetic structural analog of monophosphoryl Lipid A (MPLA) that has been shown to boost the immune system through activation of the toll-like receptor 4 (TLR4) resulting in the production of proinflammatory cytokines and antigen-specific effector CD4+ and memory CD8+ T cells. Also referred to as GLA, this adjuvant has been administered to well over 1000 human subjects without serious adverse events. Group: Bioactive lipids. Alternative Names: PHAD® phosphorylated hexaacyl disaccharide Glycopyranoside Lipid A (GLA). CAS No. 1246298-63-4. Molecular formula: C96H184N3O22P. Mole weight: 1763.469. Purity: > 99%. Catalog: ACM1246298634. |  |
| MPLA (Synthetic) Sterile Solution (Monophosphoryl Lipid A, Phosphorylated Hexaacyl Disaccharide, Glycopyranoside Lipid A, Glucopyranosyl Lipid Adjuvant, GLA) | Toll-like receptor 4 (TLR4) activator. Activates TLR4 but does not activate TLR2 even at high concentrations. Defined structure of MPLA. Synthetic lipid A is structurally very similar to natural MPLA but does not exist in nature. Group: Biochemicals. Grades: Cell Culture Grade. CAS No. 1246298-63-4. Pack Sizes: 100ug. US Biological Life Sciences. |  Worldwide |
| Mp_mastoparan MP | Mp_mastoparan MP was found in Venom, wasps, Mischocyttarusphthisicus. Mp_mastoparan MP has antimicrobial activity. | |
| MPO-IN-28 | MPO-IN-28 is a myeloperoxidase (MPO) inhibitor with IC50 of 44 nM. Synonyms: GNF-Pf-3346; 1-(7-methoxy-4-methylquinazolin-2-yl)guanidine; (7-methoxy-4-methyl-quinazolin-2-yl)-guanidine. CAS No. 37836-90-1. Molecular formula: C11H13N5O. Mole weight: 231.25. | |
| MPP dihydrochloride | MPP dihydrochloride is a selective, high affinity silent antagonist at ERα receptors, with > 200-fold selectivity for ERα over Erβ (Ki= 2.7 and 1800 nM at ERα and ERβ receptors respectively). It cannot block EE2 induced luciferase activity with any isoform of zebrafish estrogen receptor. Synonyms: 1,3-Bis(4-hydroxyphenyl)-4-methyl-5-[4-(2-piperidinylethoxy)phenol]-1H-pyrazole dihydrochloride. Grades: ≥98% by HPLC. CAS No. 911295-24-4. Molecular formula: C29H31N3O3.2HCl. Mole weight: 542.5. | |
| MPP dihydrochloride | MPP dihydrochloride is a potent and selective ER (estrogen receptor) modulator. MPP dihydrochloride induces significant apoptosis in the endometrial cancer and oLE cell lines. MPP dihydrochloride reverses the positive effects of beta-estradiol. MPP dihydrochloride has mixed agonist/antagonist action on murine uterine ERalpha in vivo [1] [2] [3]. Uses: Scientific research. Group: Signaling pathways. CAS No. 911295-24-4. Pack Sizes: 10 mM * 1 mL; 5 mg; 10 mg; 25 mg; 50 mg; 100 mg. Product ID: HY-103454. |  |
| MPPG | MPPG is a potent antagonist of L-AP4-induced effects in rat spinal cord, thalamic and hippocampal neurons, showing selectivity over (1S,3S)-ACPD-induced effects. MPPG should be useful in determining the roles of group II and III mGluRs in the central nervous system. Synonyms: (RS)-α-Methyl-4-phosphonophenylglycine. CAS No. 169209-65-8. Molecular formula: C9H12NO5P. Mole weight: 245.17. | |
| MPPG | MPPG. Group: Biochemicals. Grades: Purified. CAS No. 169209-65-8. Pack Sizes: 10mg, 50mg. US Biological Life Sciences. | Worldwide |
| MPP hydrochloride | MPP hydrochloride is a potent and selective ER (estrogen receptor) modulator. MPP hydrochloride induces significant apoptosis in the endometrial cancer and oLE cell lines. MPP hydrochloride reverses the the positive effects of beta-estradiol. MPP hydrochloride has mixed agonist/antagonist action on murine uterine ERalpha in vivo [1]. Uses: Scientific research. Group: Signaling pathways. CAS No. 2863676-89-3. Pack Sizes: 10 mM * 1 mL; 5 mg; 10 mg; 25 mg; 50 mg; 100 mg. Product ID: HY-103454B. | |
| MPP+ iodide | MPP+ iodide, a toxic metabolite of the neurotoxin MPTP, causes symptom of Parkinson's disease in animal models by selectively destroying dopaminergic neurons in substantia nigra. MPP+ iodide is taken up by the dopamine transporter into dopaminergic neurons where it exerts its neurotoxic action on mitochondria by affecting complex I of the respiratory chain. MPP+ iodide is also a high affinity substrate for the serotonin transporter (SERT) [1] [2]. Uses: Scientific research. Group: Signaling pathways. CAS No. 36913-39-0. Pack Sizes: 10 mM * 1 mL; 10 mg; 25 mg; 50 mg; 100 mg. Product ID: HY-W008719. | |
| MPS | MPS. CAS No. 55750-62-4. Pack Sizes: Milligram Quantities: 100 mg. Order Number: CL228. |  www.prochemonline.com |
| Mps1-IN-1 | Mps1-IN-1 is a highly potent and selectibe Mpsl inhibitor with IC50 of 367 nM; >1000-fold selectivity relative to the 352 member kinase panel with the major exceptions of Alk and Ltk. Synonyms: Mps1-IN-1; 1125593-20-5; 1-(4-(4-(2-(Isopropylsulfonyl)phenylamino)-1H-pyrrolo[2,3-b]pyridin-6-ylamino)-3-methoxyphenyl)piperidin-4-ol; 1-[3-methoxy-4-[[4-(2-propan-2-ylsulfonylanilino)-1H-pyrrolo[2,3-b]pyridin-6-yl]amino]phenyl]piperidin-4-ol; 1MPS1-IN-1; 3gfw; 1-(4-((4-((2-(isopropylsulfonyl)phenyl)amino)-1H-pyrrolo[2,3-b]pyridin-6-yl)amino)-3-methoxyphenyl)piperidin-4-ol; MLS003230944; GTPL9271; SCHEMBL4051419; CHEMBL1235786; BDBM36485; CHEBI:91379; DTXSID60649015; AVB59320; BCP27688; AKOS027422816; CS-3776; NCGC00387463-01; NCGC00387463-04; HY-13298; MS-29898; SMR001913509; F85109; A925638; J-503190; Q27087728; 1-(3-methoxy-4-{[4-({2-[(1-methylethyl)sulfonyl]phenyl}amino)-1H-pyrrolo[2,3-b]pyridin-6-yl]amino}phenyl)piperidin-4-ol; 1-[3-Methoxy-4-({4-[2-(propane-2-sulfonyl)anilino]-1H-pyrrolo[2,3-b]pyridin-6-yl}amino)phenyl]piperidin-4-ol; s22. Grades: >98%. CAS No. 1125593-20-5. Molecular formula: C28H33N5O4S. Mole weight: 535.66. | |
| Mps1-IN-1 dihydrochloride | Mps1-IN-1 is a selective inhibitor of monopolar spindle 1 (Mps1) kinase (IC50 = 367 nM), which displays >1000 fold-selectivity against a panel of 352 kinases with the exceptions of ALK and Ltk. Synonyms: 1-[3-Methoxy-4-[[4-[[2-[(1-methylethyl)sulfonyl]phenyl]amino]-1H-pyrrolo[2,3-b]pyridin-6-yl]amino]phenyl]-4-piperidinol dihydrochloride. Grades: ≥98% by HPLC. CAS No. 1883548-93-3. Molecular formula: C28H35Cl2N5O4S. Mole weight: 608.58. | |
| Mps1-IN-1 dihydrochloride | Mps1-IN-1 dihydrochloride. Group: Biochemicals. Grades: Purified. Pack Sizes: 10mg. US Biological Life Sciences. | Worldwide |
| Mps1-IN-2 | Small-molecule inhibitor of Mps1 kinase (IC50 values 145 nM) with greater than 1000-fold selectivity relative to the 352-member kinase panel, with the major exceptions of Gak and Plk1 (Ambit essay Kd values 12 nM, 140 nM, and 61 nM for Mps1, Gak, and Plk1, respectively). Mps1-IN-2 induces bypass of a checkpoint-mediated mitotic arrest and provides a unique tool to investigate the combined inhibition of Plk1 and Mps1. Synonyms: Mps1-IN-2. Grades: >98%. CAS No. 1228817-38-6. Molecular formula: C26H36N6O3. Mole weight: 480.6. | |
| Mps1-IN-3 | MPS1-IN-3 is a selective and potent MPS1 inhibitor with phenotypic consequences similar to those reported for published MPS1 inhibitors such as MPS1-IN-1, MPS1-IN-2, and AZD3146. Treatment with MPS1-IN-3 at 5 μM sensitized all glioblastoma cells to 3 nM of vincristine as measured by cell counts 11 days posttreatment. U251-FM cells were stereotactically injected into the brain of nude mice. Ten days postinjection, 2 mg/kg of MPS1-IN-3 and/or 0.5 mg/kg of vincristine were administered concomitantly by intravenous injections twice per week for 3 weeks. Synonyms: Mps1-IN-3; Mps1 IN3; Mps1-IN3. Grades: >98%. CAS No. 1609584-72-6. Molecular formula: C26H31N7O4S. Mole weight: 537.63. | |
| Mps1-IN-3 | Mps1-IN-3 is a potent and selective MPS1 kinase inhibitor, with an IC 50 of 50 nM. Uses: Scientific research. Group: Signaling pathways. CAS No. 1609584-72-6. Pack Sizes: 10 mM * 1 mL; 5 mg; 10 mg; 25 mg; 50 mg; 100 mg. Product ID: HY-12401. | |
| Mps1-IN-3 hydrochloride | Mps1-IN-3 hydrochloride is a potent and selective Mps1 inhibitor with an IC 50 value of 50 nM. Mps1-IN-3 hydrochloride can inhibit the proliferation of glioblastoma cells, and effectively sensitizes glioblastomas to Vincristine in orthotopic glioblastoma xenograft model [1]. Uses: Scientific research. Group: Signaling pathways. CAS No. 2989453-29-2. Pack Sizes: 5 mg; 10 mg; 25 mg; 50 mg; 100 mg. Product ID: HY-12401A. | |
| Mps1-IN-5 | Mps1-IN-5, also called as BAY1161909, a derivative of triazolopyridine, is an inhibitor of Mps1 kinase (IC50< 10 nmol/L) and in combination with antimitotic cancer drugs it can enhance their efficacy and potentially overcome resistance. Synonyms: BAY1161909; BAY-1161909; BAY 1161909; Empesertib, Mps1-IN-5; (2R)-2-(4-fluorophenyl)-N-[4-[2-(2-methoxy-4-methylsulfonylanilino)-[1,2,4]triazolo[1,5-a]pyridin-6-yl]phenyl]propanamideMps1-IN-5SCHEMBL15036597. CAS No. 1443763-60-7. Molecular formula: C29H26FN5O4S. Mole weight: 559.61. | |
| MPS1 Inhibitor, NMS-P715 ( (N- (2, 6-diethylphenyl) -1-methyl-8- ({4-[ (1-methylpiperidin-4-yl) carbamoyl]-2- (trifluoromethoxy) phenyl}amino) -4, 5-dihydro-1H-pyrazolo[4, 3-h]quinazoline-3-carboxamide) ) | An orally bioavailable, ATP-competitive, pyrazolo-quinazoline, MPS1 inhibitor (IC50=182nM, Ki=0.99nM) that is shown to act in a reversible and time-dependent manner. It demonstrates selectivity for MPS1 against a panel of 60 kinases, displaying activity against only three kinases, CK2, MELK, and NEK6 (<10uM), but not against other mitotic kinases including PLK1, CDK1, Aurora A, Aurora B, or the SAC kinase BUB1, in an in vitro kinase assay. It promotes massive SAC (spindle assembly checkpoint) override (EC50=65nM) in nocodazole-arrested U20S cells and elicits a reduction in the G1 and G2/M phase of the cell cycle in A2780 ovarian cancer cells, similar to RNAi-mediated MPS1 silencing. In addition, it is shown to inactivate SAC, delocalize kinetochore components, and inhibit the proliferation of select cancer cell lines (IC50 ~1uM), without marked activity among a panel of 127 normal cell lines. Also, it inhibits A2780 tumor xenograft growth in mice (90mg/kg/day, o.s., in vivo) by 53% wit Group: Biochemicals. Grades: Highly Purified. Pack Sizes: 5mg. US Biological Life Sciences. | Worldwide |
| MPS1/TTK Inhibitor | MPS1/TTK inhibitor is an inhibitor of monopolar spindle 1 (MPS1/TTK), a dual-specificity kinase playing an essential role in mitotic spindle checkpoint signaling that is overexpressed in certain cancerous tumors. Synonyms: N-(2,6-diethylphenyl)-4,5-dihydro-8-[[2-methoxy-4-(4-methyl-1-piperazinyl)phenyl]amino]-1-methyl-1H-pyrazolo[4,3-h]quinazoline-3-carboxamide. Grades: ≥98%. CAS No. 1202055-39-7. Molecular formula: C33H40N8O2. Mole weight: 580.72. | |
| Mps BAY 2a | Mps BAY 2a is a potent and selective Mps1 inhibitor (IC50 = 1 nM for human enzyme), which is selective for Mps1 over a panel of 220 kinases. It exhibits anticancer activity in human cancer cells, preparation of combination containing imidazopyridazine derivative useful for the treatment of cancer. Synonyms: N-Cyclopropyl-4-[8-[(2-methylpropyl)amino]-6-(5-quinolinyl)imidazo[1,2-a]pyrazin-3-yl]benzamide; MpsBAY2a; Mps-BAY-2a; Mps BAY 2a. Grades: ≥98% by HPLC. CAS No. 1382477-96-4. Molecular formula: C29H28N6O. Mole weight: 476.57. | |
| MPS-Gαi3 | It is a cell penetrating peptide. Synonyms: H-Ala-Ala-Val-Ala-Leu-Leu-Pro-Ala-Val-Leu-Leu-Ala-Leu-Leu-Ala-Lys-Asn-Asn-Leu-Lys-Glu-Cys-Gly-Leu-Tyr-OH. Grades: >95%. Molecular formula: C120H205N29O31S. Mole weight: 2582.19. | |
| MPT0B098 | MPT0B098 is a potent microtubule inhibitor through binding to the colchicine-binding site of tubulin. MPT0B098 is active against the growth of various human cancer cells, including chemoresistant cells with IC50 values ranging from 70 to 150 nmol/L. MPT0B098 arrests cells in the G2-M phase and subsequently induces cell apoptosis. In addition, MPT0B098 effectively suppresses VEGF-induced cell migration and capillary-like tube formation of HUVECs. Distinguished from other microtubule inhibitors, MPT0B098 not only inhibited the expression levels of HIF-1α protein but also destabilized HIF-1α mRNA. The mechanism of causing unstable of HIF-1α mRNA by MPT0B098 is through decreasing RNA-binding protein, HuR, translocation from the nucleus to the cytoplasm. Notably, MPT0B098 effectively suppresses tumor growth and microvessel density of tumor specimens in vivo. Taken together, our results provide a novel mechanism of inhibiting HIF-1α of a microtubule inhibitor MPT0B098. MPT0B098 is a promising anticancer drug candidate with potential for the treatment of human malignancies. Synonyms: MPT 0B098; MPT-0B098; 1-(4-methoxyphenylsulfonyl)-7-(pyridin-4-yl)indoline. CAS No. 1254363-89-7. Molecular formula: C20H18N2O3S. Mole weight: 366.43. | |
| MPT0B214 | MPT0B214 is a novel and potent microtubule inhibitor with potential anticancer activity. MPT0B214 inhibited tubulin polymerization through strongly binding to the tubulin's colchicine-binding site and had cytotoxic activity in a variety of human tumor cell lines. After treatment with MPT0B214, KB cells were arrested in the G2-M phase before cell death occurred, which were associated with upregulation of cyclin B1, dephosphorylation of Cdc2, phosphorylation of Cdc25C and elevated expression of the mitotic marker MPM-2. Furthermore, the compound induced apoptotic cell death through mitochondria/caspase 9-dependent pathway. Notably, several KB-derived multidrug-resistant cancer cell lines were also sensitive to MPT0B214 treatment. Synonyms: MPT0B214; MPT 0B214; MPT-0B214. Grades: 98%. CAS No. 1215208-65-3. Molecular formula: C20H20N2O5. Mole weight: 368.38. | |
| MPT0E028 | MPT0E028 is a novel N-hydroxyacrylamide-derived HDAC inhibitor, inhibited human colorectal cancer HCT116 cell growth in vitro and in vivo. The results of NCI-60 screening showed that MPT0E028 inhibited proliferation in both solid and hematological tumor cell lines at micromolar concentrations, and was especially potent in HCT116 cells. MPT0E028 had a stronger apoptotic activity and inhibited HDACs activity more potently than SAHA, the first therapeutic HDAC inhibitor proved by FDA. In vivo murine model, the growth of HCT116 tumor xenograft was delayed and inhibited after treatment with MPT0E028 in a dose-dependent manner. Based on in vivo study, MPT0E028 showed stronger anti-cancer efficacy than SAHA. No significant body weight difference or other adverse effects were observed in both MPT0E028-and SAHA-treated groups. Taken together, our results demonstrate that MPT0E028 has several properties and is potential as a promising anti-cancer therapeutic drug. Synonyms: 3-(1-(Benzenesulfonyl)-2,3-dihydro-1H-indol-5-yl)-N-hydroxyacrylamide; MPT-0E028; MPT 0E028. Grades: 98%. CAS No. 1338320-94-7. Molecular formula: C17H16N2O4S. Mole weight: 344.38. | |
| MPT0G211 | MPT0G211 is a potent, orally active and selective HDAC6 inhibitor ( IC 50=0.291 nM). MPT0G211 displays >1000-fold selective for HDAC6 over other HDAC isoforms. MPT0G211 can penetrate the blood-brain barrier. MPT0G211 ameliorates tau phosphorylation and cognitive deficits in an Alzheimers disease model. MPT0G211 has anti-metastatic and neuroprotective effects. Anticancer activities [1] [2] [3]. Uses: Scientific research. Group: Signaling pathways. CAS No. 2151853-97-1. Pack Sizes: 10 mM * 1 mL; 5 mg; 10 mg. Product ID: HY-123976. | |
| MPTP hydrochloride | MPTP hydrochloride is a brain penetrant dopamine neurotoxin. MPTP hydrochloride can be used to induces Parkinsons Disease model. MPTP hydrochloride, a precusor of MPP + , induces apoptosis [1] [2] [3]. MPTP hydrochloride has been verified by MCE with professional biological experiments. Uses: Scientific research. Group: Signaling pathways. CAS No. 23007-85-4. Pack Sizes: 10 mM * 1 mL; 5 mg; 10 mg; 25 mg; 50 mg; 100 mg; 200 mg; 500 mg. Product ID: HY-15608. | |
| MPTP hydrochloride | MPTP hydrochloride Inhibitor. Uses: Scientific use. Product Category: T4081. CAS No. 23007-85-4. |  |
| MPTP hydrochloride | A dopaminergic neurotoxin that causes permanent symptoms of Parkinson's disease by killing certain neurons in the substantia nigra of the brain. Useful tool compound for Parkinson's disease related studies. Synonyms: MPTP. Grades: >98%. CAS No. 23007-85-4. Molecular formula: C12H16ClN. Mole weight: 209.72. | |
| MPTP Hydrochloride (Dopaminergic Neurotoxin, MPTP) | A neurotoxin that is a precusor of MPP+ which is toxic to dopaminergic neurons and causes Parkinsonism. Widely used in research to induce Parkinson's disease models in primates. Group: Biochemicals. Grades: Highly Purified. CAS No. 23007-85-4. Pack Sizes: 10mg. Molecular Formula: C??H??N·HCl. US Biological Life Sciences. | Worldwide |
| MP-VB1 | MP-VB1 showed strong antimicrobial activities against bacteria and fungi and induced mast cell degranulation, but displayed almost no hemolytic activity towards human blood red cells. | |
| MQAE | MQAE is a chloride ion (Cl - ) fluorescent probe that can be used to measure chloride concentrations. The fluorescence intensity of MQAE decreases proportionally as Cl - ions increase. MQAE has high cell permeability and is suitable for fluorescence detection such as confocal microscopy and flow cytometry (Ex/Em=350/460 nm) [1] [2]. Uses: Scientific research. Group: Fluorescent dye. CAS No. 162558-52-3. Pack Sizes: 50 mg; 100 mg; 200 mg; 500 mg. Product ID: HY-D0090. | |
| MQRGNFRNQRKIVKCFNCGKEGHTARNCRAPRKKGC WKCGKEGHQMKDCTERQAN | It is an HIV retrovirus NC peptide with superior cell membrane penetration activity. Synonyms: HIV-NC peptide SEQ ID NO: 12. | |
| m-Quaterphenyl | White powder. Synonyms: 3,3'-Diphenylbiphenyl. CAS No. 1166-18-3. Pack Sizes: 0.1g, 1g. Product ID: FR-2035. M.P. 82.5-84. Mole weight: 306.41. |  Frinton Laboratories |
| MR10 | | |
| MR 16728 hydrochloride | MR 16728 hydrochloride. Group: Biochemicals. Grades: Purified. CAS No. 207403-36-9. Pack Sizes: 10mg, 50mg. US Biological Life Sciences. | Worldwide |
| MR 16728 hydrochloride | MR 16728 hydrochloride, an analog of cetiedil, enhanced acetylcholine (ACh) release (up to 145% of control) from Torpedo synaptosomes when the release was triggered by a Ca2+ ionophore, A23187 or ionomycin, in the presence of 4 mM Ca2+ in the release medium, but inhibited ACh release induced by KCl depolarization of the presynaptic membrane. Synonyms: Benzeneacetamide, α-cyclohexyl-N-[3-(hexahydro-1H-azepin-1-yl)propyl]-, hydrochloride (1:1); Benzeneacetamide, α-cyclohexyl-N-[3-(hexahydro-1H-azepin-1-yl)propyl]-, monohydrochloride; NSC 662128; α-Cyclohexyl-N-[3-(hexahydro-1H-azepin-1-yl)propyl]benzeneacetamide monohydrochloride; MR-16728 hydrochloride; MR16728 hydrochloride; N-(3-(Azepan-1-yl)propyl)-2-cyclohexyl-2-phenylacetamide monohydrochloride. Grades: ≥95%. CAS No. 207403-36-9. Molecular formula: C23H36N2O.HCl. Mole weight: 393.01. | |
| MR304A | MR304A is extracted from Trichoderma harzianum. It can inhibit the formation of melanin by Mushroom tyrosinase, Streptomyces bikiniensis and B16 melanoma cells, with IC50 (μg/L) of 7.5, 2.5 and 1.0, respectively. Synonyms: MR-304A; MR 304A. Molecular formula: C8H11NO4. Mole weight: 185.18. | |
| MR-387-A | MR-387-A is an AP-N inhibitor produced by the strain of Streptomyces neyagawaensis SL-387. It is used to inhibit AP-N activity in cells derived from porcine kidney microsomes, human fibrosarcoma HT-1080 and human myeloid leukemia K562. Molecular formula: C25H36N4O7. Mole weight: 504.57. | |
| MR-387-B | MR-387-B is an AP-N inhibitor produced by the strain of Streptomyces neyagawaensis SL-387. It is used to inhibit AP-N activity in cells derived from porcine kidney microsomes, human fibrosarcoma HT-1080 and human myeloid leukemia K562. Molecular formula: C25H36N4O6. Mole weight: 488.58. | |
| MR-566A | It is produced by the strain of Trichoderma harzianus KCTC 0114BP. MR-566A inhibited mushroom enzyminase and melanin biosynthesis in B16 melanoma cells with IC50 (μmol/L) of 1.72 and 0.1, respectively. Synonyms: SCHEMBL20203773. Molecular formula: C8H10ClNO3. Mole weight: 203.62. | |
| MR-566B | It is produced by the strain of Trichoderma harzianus KCTC 0114BP. MR-566B inhibited mushroom enzyminase and melanin biosynthesis in B16 melanoma cells with IC50 (μmol/L) of 47 and 2.2, respectively. Synonyms: SCHEMBL20203767. Molecular formula: C8H11NO4. Mole weight: 185.18. | |
| Mram 8 | Mram 8 is isolated from Viola philippica which is a plant from the Violaceae family. | |
| m-Ranolazine | m-Ranolazine is one of Ranolazine impurities. Ranolazine is an anti-ischemic agent which modulates myocardial metabolism. Synonyms: N-(2,6-Dimethylphenyl)-4-[2-hydroxy-3-(3-methoxyphenoxy)propyl]-1-piperazineacetamide; Ranolazine Impurity 11. CAS No. 1393717-46-8. Molecular formula: C24H33N3O4. Mole weight: 427.54. | |
| MRE-269 | MRE-269 is an orally available and long-acting prostacyclin receptor agonist prodrug used for the treatment of pulmonary arterial hypertension. Uses: Prostacyclin receptor agonist. Synonyms: MRE-269; MRE269; MRE 269; ACT-333679; ACT 333679; ACT333679. [4-[(5,6-diphenylpyrazinyl)(1-methylethyl)amino]butoxy]-acetic acid; 2-[4-[(5,6-Diphenyl-2-pyrazinyl)(1-methylethyl)amino]butoxy]-acetic Acid. Grades: ≥98%. CAS No. 475085-57-5. Molecular formula: C25H29N3O3. Mole weight: 419.5. | |
| MRE 3008F20 | MRE 3008F20. Group: Biochemicals. Grades: Purified. CAS No. 252979-43-4. Pack Sizes: 10mg. US Biological Life Sciences. | Worldwide |
| MRE 3008F20 | MRE 3008F20 is a potent adenosine A3 receptor competitive antagonist, which is selective for human A3 receptors over human A1 and A2A receptors (Ki= 0.29, 141 and 1197 nM respectively). MRE 3008F20 has also been studied extensively in recent advances in adenosine receptor ligand in pulmonary diseases. Synonyms: N-[2-(2-Furanyl)-8-propyl-8H-pyrazolo[4,3-e][1,2,4]triazolo[1,5-c]pyrimidin-5-yl]-N'-(4-methoxyphenyl)urea; MRE 3008-F20; MRE 3008F20; MRE 3008 F20; MRE-3008-F20; MRE3008F20; MRE3008F20; MCP-NECA; MCP NECA; MCPNECA. Grades: ≥98% by HPLC. CAS No. 252979-43-4. Molecular formula: C21H20N8O3. Mole weight: 432.44. | |
| MreB Perturbing Compound A22 | MreB perturbing compound A22 is a benzylisothiourea compound that rapidly and reversibly perturbs MreB. It converts normal bacterial rod-shape cells to coccoid cells. It interferes with chromosome segregation in C. crescentus by blocking the binding of MreB to chromosomes. Synonyms: 2-(3,4-Dichloro-benzyl)-isothiourea hydrochloride; S-(3,4-Dichlorobenzyl)isothiourea HCl; 3,4-dichlorobenzyl carbamimidothioate hydrochloride. Grades: ≥95%. CAS No. 22816-60-0. Molecular formula: C8H8Cl2N2S·HCl. Mole weight: 271.6. | |
| MRK003 | MRK003 is a γ-secretase inhibitor exhibits promising in vitro pre-clinical activity in multiple myeloma and non-Hodgkin's lymphoma. MRK003 treatment induced caspase-dependent apoptosis and inhibited proliferation of MM and NHL cell lines and patient cells. Examination of signaling events after treatment showed time-dependent decrease in levels of the notch intracellular domain, Hes1 and c-Myc. MRK003 downregulated cyclin D1, Bcl-Xl and Xiap levels in NHL cells and p21, Bcl-2 and Bcl-Xl in MM cells. In addition, MRK003 caused an upregulation of pAkt, indicating crosstalk with the PI3K/Akt pathway. Uses: Gamma secretase inhibitors and modulators. Synonyms: MRK-003; MRK 003. CAS No. 623165-93-5. Molecular formula: C25H31F6N3O2S. Mole weight: 551.59. | |
| MRK 016 | MRK-016 is a selective α5 subunit-containing GABAA negative allosteric modulator with EC50 value of 3 nM. It has nootropic properties. MRK-016 can produce rapid, ketamine-like antidepressant effects in animal models of depression. Uses: Antidepressant effect. Synonyms: MRK-016; MRK016; 3-(1,1-Dimethylethyl)-7-(5-methyl-3-isoxazolyl)-2-[(1-methyl-1H-1,2,4-triazol-5-yl)methoxy]-pyrazolo[1,5-d][1,2,4]triazine; 3-(9-(tert-Butyl)-8-((1-methyl-1H-1,2,4-triazol-5-yl)methoxy)pyrazolo[1,5-d][1,2,4]triazin-2-yl)-5-methylisoxazole; 3-t-butyl-7-(5-methylisoxazol-3-yl)-2-(1-methyl-1h-1,2,4-triazol-5-ylmethoxy)-pyrazolo[1,5-d]-[1,2,4]triazine; 7-(5-Methyl-1,2-oxazol-3-yl)-3-(2-methyl-2-propanyl)-2-[(1-methyl-1H-1,2,4-triazol-5-yl)methoxy]pyrazolo[1,5-d][1,2,4]triazine. Grades: >98%. CAS No. 783331-24-8. Molecular formula: C17H20N8O2. Mole weight: 368.40. | |
| MRK 560 | MRK 560, under the IUPAC name N-((1r,4r)-4-((4-chlorophenyl)sulfonyl)-4-(2,5-difluorophenyl)cyclohexyl)-1,1,1-trifluoromethanesulfonamide, is a novel orally bioavailable γ-secretase inhibitor and inhibites the production of Aβ40 and Aβ42 (in vitro: IC50 = 0.65 nM). in vivo: Reduces Aβ in the brain (ED50 = 6 mg/kg) and cerebrospinal fluid (CSF) (ED50 = 10 mg/kg) in the rat markedly. Synonyms: N-((1r,4r)-4-((4-chlorophenyl)sulfonyl)-4-(2,5-difluorophenyl)cyclohexyl)-1,1,1-trifluoromethanesulfonamide; MRK560; MRK 560; MRK-560; 677772-84-8. CAS No. 677772-84-8. Molecular formula: C19H17ClF5NO4S2. Mole weight: 517.92. | |
| MRK-560 | MRK-560 is an orally bioavailable gamma-secretase inhibitor with the ability to markedly reduce Abeta peptide in the brain and CSF of the rat and confirm the utility of the rat for assessing the effects of gamma-secretase inhibitors on central nervous system. Group: Fluorinated apis. Alternative Names: N-[4-(4-chlorophenyl)sulfonyl-4-(2,5-difluorophenyl)cyclohexyl]-1,1,1-trifluoromethanesulfonamide. CAS No. 677772-84-8. Molecular formula: C19H17ClF5NO4S2. Mole weight: 517.92. Appearance: White to off-white solid powder. Purity: >98%. IUPACName: N-[4-(4-chlorophenyl)sulfonyl-4-(2,5-difluorophenyl)cyclohexyl]-1,1,1-trifluoromethanesulfonamide. Catalog: OFC677772848. | |
| MRL-494 hydrochloride | MRL-494 hydrochloride, an antibacterial agent, is a inhibitor of β-barrel assembly machine A (BamA) impervious to efflux and the outer membrane permeability barrier. MRL-494 hydrochloride can inhibits Gram-positive (MIC of 12.5 μM for Staphylococcus aureus COL) and Gram-negative (MIC of 25 μM for E. coli JCM158) bacterias [1]. Uses: Scientific research. Group: Signaling pathways. CAS No. 2699937-04-5. Pack Sizes: 10 mM * 1 mL; 5 mg; 10 mg; 25 mg; 50 mg; 100 mg. Product ID: HY-128773A. | |
| mRNA (2'-O-methyladenosine-N6-)-methyltransferase | This enzyme belongs to the family of transferases, specifically those transferring one-carbon group methyltransferases. Group: Enzymes. Synonyms: messenger ribonucleate 2'-O-methyladenosine NG-methyltransferase; S-adenosyl-L-methionine:mRNA (2'-O-methyladenosine-6-N-)-methyltransferase. Enzyme Commission Number: EC 2.1.1.62. CAS No. 68009-87-0. Storage: Store it at +4 ?C for short term. For long term storage, store it at -20 ?C?-80 ?C. Form: Liquid or lyophilized powder. EXWM-1964; mRNA (2'-O-methyladenosine-N6-)-methyltransferase; EC 2.1.1.62; 68009-87-0; messenger ribonucleate 2'-O-methyladenosine NG-methyltransferase; S-adenosyl-L-methionine:mRNA (2'-O-methyladenosine-6-N-)-methyltransferase. Cat No: EXWM-1964. |  |
| mRNA(cytosine6666) deaminase | The apolipoprotein B mRNA editing enzyme complex catalyses the editing of apolipoprotein B mRNA at cytidine6666 to uridine, thereby transforming the codon for glutamine-2153 to a termination codon. Editing results in translation of a truncated apolipoprotein B isoform (apoB-48) with distinct functions in lipid transport. The catalytic component (APOBEC-1) contains zinc at the active site. Group: Enzymes. Synonyms: APOBEC-1 (catalytic component of an RNA-editing complex); APOBEC1 (catalytic subunit); apolipoprotein B mRNA-editing enzyme 1 (catalytic component of an RNA-editing complex); apoB mRNA-editing enzyme catalytic polypeptide 1 (catalytic component of an RNA-editing complex); apoB mRNA editing complex; apolipoprotein B mRNA editing enzyme; REPR. Enzyme Commission Number: EC 3.5.4.36. Storage: Store it at +4 ?C for short term. For long term storage, store it at -20 ?C?-80 ?C. Form: Liquid or lyophilized powder. EXWM-4564; mRNA(cytosine6666) deaminase; EC 3.5.4.36; APOBEC-1 (catalytic component of an RNA-editing complex); APOBEC1 (catalytic subunit); apolipoprotein B mRNA-editing enzyme 1 (catalytic component of an RNA-editing complex); apoB mRNA-editing enzyme catalytic polypeptide 1 (catalytic component of an RNA-editing complex); apoB mRNA editing complex; apolipoprotein B mRNA editing enzyme; REPR. Cat No: EXWM-4564. | |
| mRNA (guanine-N7)-methyltransferase | The nucleoside next to the terminal guanosine may be either guanosine or adenosine. Group: Enzymes. Synonyms: messenger ribonucleate guanine 7-methyltransferase; guanine-7-methyltransferase; messenger RNA guanine 7-methyltransferase; S-adenosyl-L-methionine:mRNA (guanine-7-N)-methyltransferase. Enzyme Commission Number: EC 2.1.1.56. CAS No. 56941-25-4. Storage: Store it at +4 ?C for short term. For long term storage, store it at -20 ?C?-80 ?C. Form: Liquid or lyophilized powder. EXWM-1958; mRNA (guanine-N7)-methyltransferase; EC 2.1.1.56; 56941-25-4; messenger ribonucleate guanine 7-methyltransferase; guanine-7-methyltransferase; messenger RNA guanine 7-methyltransferase; S-adenosyl-L-methionine:mRNA (guanine-7-N)-methyltransferase. Cat No: EXWM-1958. | |
| mRNA guanylyltransferase | The enzyme can also modify synthetic poly(A) and poly(G) to form the structures m7G(5')pppAn and m7G(5')pppGn. Group: Enzymes. Synonyms: mRNA capping enzyme; messenger RNA guanylyltransferase; Protein λ2. Enzyme Commission Number: EC 2.7.7.50. CAS No. 56941-23-2. Storage: Store it at +4 ?C for short term. For long term storage, store it at -20 ?C?-80 ?C. Form: Liquid or lyophilized powder. EXWM-3263; mRNA guanylyltransferase; EC 2.7.7.50; 56941-23-2; mRNA capping enzyme; messenger RNA guanylyltransferase; Protein λ2. Cat No: EXWM-3263. | |
| mRNA N1-methyladenine demethylase | Contains iron(II). Catalyses oxidative demethylation of mRNA N1-methyladenine. The enzyme is also involved in alkylation repair in DNA. Group: Enzymes. Synonyms: ALKBH3. Enzyme Commission Number: EC 1.14.11.54. Storage: Store it at +4 ?C for short term. For long term storage, store it at -20 ?C?-80 ?C. Form: Liquid or lyophilized powder. EXWM-0673; mRNA N1-methyladenine demethylase; EC 1.14.11.54; ALKBH3. Cat No: EXWM-0673. | |
| mRNA N6-methyladenine demethylase | Contains iron(II). Catalyses oxidative demethylation of mRNA N6-methyladenine. The FTO enzyme from human can also demethylate N3-methylthymine from single stranded DNA and N3-methyluridine from single stranded RNA with low activity. Group: Enzymes. Synonyms: ALKBH5; FTO. Enzyme Commission Number: EC 1.14.11.53. Storage: Store it at +4 ?C for short term. For long term storage, store it at -20 ?C?-80 ?C. Form: Liquid or lyophilized powder. EXWM-0672; mRNA N6-methyladenine demethylase; EC 1.14.11.53; ALKBH5; FTO. Cat No: EXWM-0672. | |
| MroN I | One unit of the enzyme is the amount required to hydrolyze 1 μg of Adenovirus-2 DNA in 1 hour at 37°C in a total reaction volume of 50 μl. Applications: After 5-fold overdigestion with enzyme more than 90% of the ad-2 dna fragments can be ligated and recut. Group: Restriction Enzymes. Purity: 500 U; 2500U. G↑CCGGC CGGCC↓G. Activity: 5000u.a./ml. Appearance: 10 X SE-buffer B. Storage: -20°C. Form: Liquid. Source: Micrococcus roseus N0. Pack: 10 mM Tris-HCl (pH 7.5); 250 mM NaCl; 0.1 mM EDTA; 7 mM 2-mercaptoethanol; 200 μg/ml BSA; 50% glycerol. Cat No: ET-1137RE. | |
| MroX I | One unit of the enzyme is the amount required to hydrolyze 1 μg of Lambda DNA in 1 hour at 37°C in a total reaction volume of 50 μl. Applications: After 5-fold overdigestion with enzyme more than 50% of the dna fragments can be ligated and recut. Group: Restriction Enzymes. Purity: 200U; 1000U. GAANN↑NNTTC CTTNN↓NNAAG. Activity: 5000u.a./ml. Appearance: 10 X SE-buffer W. Storage: -20°C. Form: Liquid. Source: Micrococcus roseus X. Pack: 10 mM Tris-HCl (pH 7.5); 200 mM NaCl; 0,1 mM EDTA; 7 mM 2-mercaptoethanol; 200 μg/ml BSA; 50% glycerol. Cat No: ET-1138RE. | |
| MRS1220 | MRS1220. Group: Biochemicals. Alternative Names: N-[9-Chloro-2-(2-furanyl)[1,2,4]-triazolo[1,5-c]quinazolin-5-yl]benzene acetamide. Grades: Highly Purified. CAS No. 183721-15-5. Pack Sizes: 1mg, 2mg, 5mg, 10mg, 25mg. US Biological Life Sciences. | Worldwide |
| MRS 1220 | MRS 1220, a derivative of the triazoloquinazoline, is a potent and highly selective antagonist at the human A3 adenosine receptor (Ki= 0.65, 305, and 52 nM at hA3, rA1 and rA2A respectively.) It exhibits an IC50 value > 1 μM for inhibition of binding to rat A3 receptors. Synonyms: N-[9-Chloro-2-(2-furanyl)[1,2,4]-triazolo[1,5-c]quinazolin-5-yl]benzene acetamide; MRS1220; MRS-1220; MRS 1220. Grades: ≥98% by HPLC. CAS No. 183721-15-5. Molecular formula: C21H14ClN5O2. Mole weight: 403.83. | |
| MRS 1334 | MRS 1334 is a potent and highly specific antagonist for the human adenosine A3 receptor (Ki= are 2.69 nM at hA3). Synonyms: MRS 1334; MRS1334; MRS-1334; 1,4-Dihydro-2-methyl-6-phenyl-4-(phenylethynyl)-3,5-pyridinedicarboxylic acid 3-ethyl-5-[(3-nitrophenyl)methyl] ester. Grades: ≥98% by HPLC. CAS No. 192053-05-7. Molecular formula: C31H26N2O6. Mole weight: 522.56. | |
| MRS 1477 | MRS 1477, a dihydropyridine derivative, is a TRPV1 positive allosteric modulator, and potentiates vanilloid and proton activation of TRPV1 channels. Synonyms: MRS-1477; MRS 1477; MRS1477; 4-Ethyl-1,4-dihydro-5-[[(2-methoxyethyl)thio]carbonyl]-6-methyl-2-phenyl-3-pyridinecarboxylic acid ethyl ester. Grades: ≥98% by HPLC. CAS No. 212200-21-0. Molecular formula: C21H27NO4S. Mole weight: 389.51. | |
| MRS 1523 | MRS 1523 is a potent and selective adenosine A3 receptor antagonist (Ki= 18.9 nM for human A3R). Uses: Purinergic p1 receptor antagonists. Synonyms: MRS1523; MRS 1523; MRS-1523. Propyl 6-ethyl-5-ethylsulfanylcarbonyl-2-phenyl-4-propylpyridine-3-carboxylate. Grades: 98%. CAS No. 212329-37-8. Molecular formula: C23H29NO3S. Mole weight: 399.55. | |
| MRS 1706 | MRS 1706 is a potent and selective A2B inverse agonist. Uses: Adenosine a2 receptor antagonists. Synonyms: MRS1706; MRS 1706; MRS-1706. N-(4-Acetylphenyl)-2-[4-(2,3,6,7-tetrahydro-2,6-dioxo-1,3-dipropyl-1H-purin-8-yl)phenoxy]acetamide. CAS No. 264622-53-9. Molecular formula: C27H29N5O5. Mole weight: 503.56. | |
| MRS 1754 | MRS 1754 is a selective A2B antagonist. Synonyms: MRS1754; MRS-1754; MRS 1754; N-(4-Cyanophenyl)-2-[4-(2,3,6,7-tetrahydro-2,6-dioxo-1,3-dipropyl-1H-purin-8-yl)phenoxy]-acetamide. CAS No. 264622-58-4. Molecular formula: C26H26N6O4. Mole weight: 486.52. | |
Our database is helping our users find suppliers everyday.
