A directory of where to buy chemicals in the USA, including: distributors, industrial manufacturers, bulk supplies and wholesalers of raw ingredients & finished goods.
Search for products or services, then visit the suppliers website for prices or more information.
| Product | Description | |
|---|---|---|
| MPS-Gαi3 | It is a cell penetrating peptide. Synonyms: H-Ala-Ala-Val-Ala-Leu-Leu-Pro-Ala-Val-Leu-Leu-Ala-Leu-Leu-Ala-Lys-Asn-Asn-Leu-Lys-Glu-Cys-Gly-Leu-Tyr-OH. Grades: >95%. Molecular formula: C120H205N29O31S. Mole weight: 2582.19. |  |
| MPT0B098 | MPT0B098 is a potent microtubule inhibitor through binding to the colchicine-binding site of tubulin. MPT0B098 is active against the growth of various human cancer cells, including chemoresistant cells with IC50 values ranging from 70 to 150 nmol/L. MPT0B098 arrests cells in the G2-M phase and subsequently induces cell apoptosis. In addition, MPT0B098 effectively suppresses VEGF-induced cell migration and capillary-like tube formation of HUVECs. Distinguished from other microtubule inhibitors, MPT0B098 not only inhibited the expression levels of HIF-1α protein but also destabilized HIF-1α mRNA. The mechanism of causing unstable of HIF-1α mRNA by MPT0B098 is through decreasing RNA-binding protein, HuR, translocation from the nucleus to the cytoplasm. Notably, MPT0B098 effectively suppresses tumor growth and microvessel density of tumor specimens in vivo. Taken together, our results provide a novel mechanism of inhibiting HIF-1α of a microtubule inhibitor MPT0B098. MPT0B098 is a promising anticancer drug candidate with potential for the treatment of human malignancies. Synonyms: MPT 0B098; MPT-0B098; 1-(4-methoxyphenylsulfonyl)-7-(pyridin-4-yl)indoline. CAS No. 1254363-89-7. Molecular formula: C20H18N2O3S. Mole weight: 366.43. | |
| MPT0B214 | MPT0B214 is a novel and potent microtubule inhibitor with potential anticancer activity. MPT0B214 inhibited tubulin polymerization through strongly binding to the tubulin's colchicine-binding site and had cytotoxic activity in a variety of human tumor cell lines. After treatment with MPT0B214, KB cells were arrested in the G2-M phase before cell death occurred, which were associated with upregulation of cyclin B1, dephosphorylation of Cdc2, phosphorylation of Cdc25C and elevated expression of the mitotic marker MPM-2. Furthermore, the compound induced apoptotic cell death through mitochondria/caspase 9-dependent pathway. Notably, several KB-derived multidrug-resistant cancer cell lines were also sensitive to MPT0B214 treatment. Synonyms: MPT0B214; MPT 0B214; MPT-0B214. Grades: 98%. CAS No. 1215208-65-3. Molecular formula: C20H20N2O5. Mole weight: 368.38. | |
| MPT0E028 | MPT0E028 is a novel N-hydroxyacrylamide-derived HDAC inhibitor, inhibited human colorectal cancer HCT116 cell growth in vitro and in vivo. The results of NCI-60 screening showed that MPT0E028 inhibited proliferation in both solid and hematological tumor cell lines at micromolar concentrations, and was especially potent in HCT116 cells. MPT0E028 had a stronger apoptotic activity and inhibited HDACs activity more potently than SAHA, the first therapeutic HDAC inhibitor proved by FDA. In vivo murine model, the growth of HCT116 tumor xenograft was delayed and inhibited after treatment with MPT0E028 in a dose-dependent manner. Based on in vivo study, MPT0E028 showed stronger anti-cancer efficacy than SAHA. No significant body weight difference or other adverse effects were observed in both MPT0E028-and SAHA-treated groups. Taken together, our results demonstrate that MPT0E028 has several properties and is potential as a promising anti-cancer therapeutic drug. Synonyms: 3-(1-(Benzenesulfonyl)-2,3-dihydro-1H-indol-5-yl)-N-hydroxyacrylamide; MPT-0E028; MPT 0E028. Grades: 98%. CAS No. 1338320-94-7. Molecular formula: C17H16N2O4S. Mole weight: 344.38. | |
| MPT0G211 | MPT0G211 is a potent, orally active and selective HDAC6 inhibitor ( IC 50=0.291 nM). MPT0G211 displays >1000-fold selective for HDAC6 over other HDAC isoforms. MPT0G211 can penetrate the blood-brain barrier. MPT0G211 ameliorates tau phosphorylation and cognitive deficits in an Alzheimers disease model. MPT0G211 has anti-metastatic and neuroprotective effects. Anticancer activities [1] [2] [3]. Uses: Scientific research. Group: Signaling pathways. CAS No. 2151853-97-1. Pack Sizes: 10 mM * 1 mL; 5 mg; 10 mg. Product ID: HY-123976. |  |
| MPTP hydrochloride | MPTP hydrochloride Inhibitor. Uses: Scientific use. Product Category: T4081. CAS No. 23007-85-4. |  |
| MPTP hydrochloride | MPTP hydrochloride is a brain penetrant dopamine neurotoxin. MPTP hydrochloride can be used to induces Parkinsons Disease model. MPTP hydrochloride, a precusor of MPP + , induces apoptosis [1] [2] [3]. MPTP hydrochloride has been verified by MCE with professional biological experiments. Uses: Scientific research. Group: Signaling pathways. CAS No. 23007-85-4. Pack Sizes: 10 mM * 1 mL; 5 mg; 10 mg; 25 mg; 50 mg; 100 mg; 200 mg; 500 mg. Product ID: HY-15608. | |
| MPTP hydrochloride | A dopaminergic neurotoxin that causes permanent symptoms of Parkinson's disease by killing certain neurons in the substantia nigra of the brain. Useful tool compound for Parkinson's disease related studies. Synonyms: MPTP. Grades: >98%. CAS No. 23007-85-4. Molecular formula: C12H16ClN. Mole weight: 209.72. | |
| MPTP Hydrochloride (Dopaminergic Neurotoxin, MPTP) | A neurotoxin that is a precusor of MPP+ which is toxic to dopaminergic neurons and causes Parkinsonism. Widely used in research to induce Parkinson's disease models in primates. Group: Biochemicals. Grades: Highly Purified. CAS No. 23007-85-4. Pack Sizes: 10mg. Molecular Formula: C??H??N·HCl. US Biological Life Sciences. |  Worldwide |
| MP-VB1 | MP-VB1 showed strong antimicrobial activities against bacteria and fungi and induced mast cell degranulation, but displayed almost no hemolytic activity towards human blood red cells. | |
| MQAE | MQAE is a chloride ion (Cl - ) fluorescent probe that can be used to measure chloride concentrations. The fluorescence intensity of MQAE decreases proportionally as Cl - ions increase. MQAE has high cell permeability and is suitable for fluorescence detection such as confocal microscopy and flow cytometry (Ex/Em=350/460 nm) [1] [2]. Uses: Scientific research. Group: Fluorescent dye. CAS No. 162558-52-3. Pack Sizes: 50 mg; 100 mg; 200 mg; 500 mg. Product ID: HY-D0090. | |
| MQRGNFRNQRKIVKCFNCGKEGHTARNCRAPRKKGC WKCGKEGHQMKDCTERQAN | It is an HIV retrovirus NC peptide with superior cell membrane penetration activity. Synonyms: HIV-NC peptide SEQ ID NO: 12. | |
| m-Quaterphenyl | White powder. Synonyms: 3,3'-Diphenylbiphenyl. CAS No. 1166-18-3. Pack Sizes: 0.1g, 1g. Product ID: FR-2035. M.P. 82.5-84. Mole weight: 306.41. |  Frinton Laboratories |
| MR10 | | |
| MR 16728 hydrochloride | MR 16728 hydrochloride. Group: Biochemicals. Grades: Purified. CAS No. 207403-36-9. Pack Sizes: 10mg, 50mg. US Biological Life Sciences. | Worldwide |
| MR 16728 hydrochloride | MR 16728 hydrochloride, an analog of cetiedil, enhanced acetylcholine (ACh) release (up to 145% of control) from Torpedo synaptosomes when the release was triggered by a Ca2+ ionophore, A23187 or ionomycin, in the presence of 4 mM Ca2+ in the release medium, but inhibited ACh release induced by KCl depolarization of the presynaptic membrane. Synonyms: Benzeneacetamide, α-cyclohexyl-N-[3-(hexahydro-1H-azepin-1-yl)propyl]-, hydrochloride (1:1); Benzeneacetamide, α-cyclohexyl-N-[3-(hexahydro-1H-azepin-1-yl)propyl]-, monohydrochloride; NSC 662128; α-Cyclohexyl-N-[3-(hexahydro-1H-azepin-1-yl)propyl]benzeneacetamide monohydrochloride; MR-16728 hydrochloride; MR16728 hydrochloride; N-(3-(Azepan-1-yl)propyl)-2-cyclohexyl-2-phenylacetamide monohydrochloride. Grades: ≥95%. CAS No. 207403-36-9. Molecular formula: C23H36N2O.HCl. Mole weight: 393.01. | |
| MR304A | MR304A is extracted from Trichoderma harzianum. It can inhibit the formation of melanin by Mushroom tyrosinase, Streptomyces bikiniensis and B16 melanoma cells, with IC50 (μg/L) of 7.5, 2.5 and 1.0, respectively. Synonyms: MR-304A; MR 304A. Molecular formula: C8H11NO4. Mole weight: 185.18. | |
| MR-387-A | MR-387-A is an AP-N inhibitor produced by the strain of Streptomyces neyagawaensis SL-387. It is used to inhibit AP-N activity in cells derived from porcine kidney microsomes, human fibrosarcoma HT-1080 and human myeloid leukemia K562. Molecular formula: C25H36N4O7. Mole weight: 504.57. | |
| MR-387-B | MR-387-B is an AP-N inhibitor produced by the strain of Streptomyces neyagawaensis SL-387. It is used to inhibit AP-N activity in cells derived from porcine kidney microsomes, human fibrosarcoma HT-1080 and human myeloid leukemia K562. Molecular formula: C25H36N4O6. Mole weight: 488.58. | |
| MR-566A | It is produced by the strain of Trichoderma harzianus KCTC 0114BP. MR-566A inhibited mushroom enzyminase and melanin biosynthesis in B16 melanoma cells with IC50 (μmol/L) of 1.72 and 0.1, respectively. Synonyms: SCHEMBL20203773. Molecular formula: C8H10ClNO3. Mole weight: 203.62. | |
| MR-566B | It is produced by the strain of Trichoderma harzianus KCTC 0114BP. MR-566B inhibited mushroom enzyminase and melanin biosynthesis in B16 melanoma cells with IC50 (μmol/L) of 47 and 2.2, respectively. Synonyms: SCHEMBL20203767. Molecular formula: C8H11NO4. Mole weight: 185.18. | |
| Mram 8 | Mram 8 is isolated from Viola philippica which is a plant from the Violaceae family. | |
| m-Ranolazine | m-Ranolazine is one of Ranolazine impurities. Ranolazine is an anti-ischemic agent which modulates myocardial metabolism. Synonyms: N-(2,6-Dimethylphenyl)-4-[2-hydroxy-3-(3-methoxyphenoxy)propyl]-1-piperazineacetamide; Ranolazine Impurity 11. CAS No. 1393717-46-8. Molecular formula: C24H33N3O4. Mole weight: 427.54. | |
| MRE-269 | MRE-269 is an orally available and long-acting prostacyclin receptor agonist prodrug used for the treatment of pulmonary arterial hypertension. Uses: Prostacyclin receptor agonist. Synonyms: MRE-269; MRE269; MRE 269; ACT-333679; ACT 333679; ACT333679. [4-[(5,6-diphenylpyrazinyl)(1-methylethyl)amino]butoxy]-acetic acid; 2-[4-[(5,6-Diphenyl-2-pyrazinyl)(1-methylethyl)amino]butoxy]-acetic Acid. Grades: ≥98%. CAS No. 475085-57-5. Molecular formula: C25H29N3O3. Mole weight: 419.5. | |
| MRE 3008F20 | MRE 3008F20. Group: Biochemicals. Grades: Purified. CAS No. 252979-43-4. Pack Sizes: 10mg. US Biological Life Sciences. | Worldwide |
| MRE 3008F20 | MRE 3008F20 is a potent adenosine A3 receptor competitive antagonist, which is selective for human A3 receptors over human A1 and A2A receptors (Ki= 0.29, 141 and 1197 nM respectively). MRE 3008F20 has also been studied extensively in recent advances in adenosine receptor ligand in pulmonary diseases. Synonyms: N-[2-(2-Furanyl)-8-propyl-8H-pyrazolo[4,3-e][1,2,4]triazolo[1,5-c]pyrimidin-5-yl]-N'-(4-methoxyphenyl)urea; MRE 3008-F20; MRE 3008F20; MRE 3008 F20; MRE-3008-F20; MRE3008F20; MRE3008F20; MCP-NECA; MCP NECA; MCPNECA. Grades: ≥98% by HPLC. CAS No. 252979-43-4. Molecular formula: C21H20N8O3. Mole weight: 432.44. | |
| MreB Perturbing Compound A22 | MreB perturbing compound A22 is a benzylisothiourea compound that rapidly and reversibly perturbs MreB. It converts normal bacterial rod-shape cells to coccoid cells. It interferes with chromosome segregation in C. crescentus by blocking the binding of MreB to chromosomes. Synonyms: 2-(3,4-Dichloro-benzyl)-isothiourea hydrochloride; S-(3,4-Dichlorobenzyl)isothiourea HCl; 3,4-dichlorobenzyl carbamimidothioate hydrochloride. Grades: ≥95%. CAS No. 22816-60-0. Molecular formula: C8H8Cl2N2S·HCl. Mole weight: 271.6. | |
| MRK003 | MRK003 is a γ-secretase inhibitor exhibits promising in vitro pre-clinical activity in multiple myeloma and non-Hodgkin's lymphoma. MRK003 treatment induced caspase-dependent apoptosis and inhibited proliferation of MM and NHL cell lines and patient cells. Examination of signaling events after treatment showed time-dependent decrease in levels of the notch intracellular domain, Hes1 and c-Myc. MRK003 downregulated cyclin D1, Bcl-Xl and Xiap levels in NHL cells and p21, Bcl-2 and Bcl-Xl in MM cells. In addition, MRK003 caused an upregulation of pAkt, indicating crosstalk with the PI3K/Akt pathway. Uses: Gamma secretase inhibitors and modulators. Synonyms: MRK-003; MRK 003. CAS No. 623165-93-5. Molecular formula: C25H31F6N3O2S. Mole weight: 551.59. | |
| MRK 016 | MRK-016 is a selective α5 subunit-containing GABAA negative allosteric modulator with EC50 value of 3 nM. It has nootropic properties. MRK-016 can produce rapid, ketamine-like antidepressant effects in animal models of depression. Uses: Antidepressant effect. Synonyms: MRK-016; MRK016; 3-(1,1-Dimethylethyl)-7-(5-methyl-3-isoxazolyl)-2-[(1-methyl-1H-1,2,4-triazol-5-yl)methoxy]-pyrazolo[1,5-d][1,2,4]triazine; 3-(9-(tert-Butyl)-8-((1-methyl-1H-1,2,4-triazol-5-yl)methoxy)pyrazolo[1,5-d][1,2,4]triazin-2-yl)-5-methylisoxazole; 3-t-butyl-7-(5-methylisoxazol-3-yl)-2-(1-methyl-1h-1,2,4-triazol-5-ylmethoxy)-pyrazolo[1,5-d]-[1,2,4]triazine; 7-(5-Methyl-1,2-oxazol-3-yl)-3-(2-methyl-2-propanyl)-2-[(1-methyl-1H-1,2,4-triazol-5-yl)methoxy]pyrazolo[1,5-d][1,2,4]triazine. Grades: >98%. CAS No. 783331-24-8. Molecular formula: C17H20N8O2. Mole weight: 368.40. | |
| MRK 560 | MRK 560, under the IUPAC name N-((1r,4r)-4-((4-chlorophenyl)sulfonyl)-4-(2,5-difluorophenyl)cyclohexyl)-1,1,1-trifluoromethanesulfonamide, is a novel orally bioavailable γ-secretase inhibitor and inhibites the production of Aβ40 and Aβ42 (in vitro: IC50 = 0.65 nM). in vivo: Reduces Aβ in the brain (ED50 = 6 mg/kg) and cerebrospinal fluid (CSF) (ED50 = 10 mg/kg) in the rat markedly. Synonyms: N-((1r,4r)-4-((4-chlorophenyl)sulfonyl)-4-(2,5-difluorophenyl)cyclohexyl)-1,1,1-trifluoromethanesulfonamide; MRK560; MRK 560; MRK-560; 677772-84-8. CAS No. 677772-84-8. Molecular formula: C19H17ClF5NO4S2. Mole weight: 517.92. | |
| MRK-560 | MRK-560 is an orally bioavailable gamma-secretase inhibitor with the ability to markedly reduce Abeta peptide in the brain and CSF of the rat and confirm the utility of the rat for assessing the effects of gamma-secretase inhibitors on central nervous system. Group: Fluorinated apis. Alternative Names: N-[4-(4-chlorophenyl)sulfonyl-4-(2,5-difluorophenyl)cyclohexyl]-1,1,1-trifluoromethanesulfonamide. CAS No. 677772-84-8. Molecular formula: C19H17ClF5NO4S2. Mole weight: 517.92. Appearance: White to off-white solid powder. Purity: >98%. IUPACName: N-[4-(4-chlorophenyl)sulfonyl-4-(2,5-difluorophenyl)cyclohexyl]-1,1,1-trifluoromethanesulfonamide. Catalog: OFC677772848. |  |
| MRL-494 hydrochloride | MRL-494 hydrochloride, an antibacterial agent, is a inhibitor of β-barrel assembly machine A (BamA) impervious to efflux and the outer membrane permeability barrier. MRL-494 hydrochloride can inhibits Gram-positive (MIC of 12.5 μM for Staphylococcus aureus COL) and Gram-negative (MIC of 25 μM for E. coli JCM158) bacterias [1]. Uses: Scientific research. Group: Signaling pathways. CAS No. 2699937-04-5. Pack Sizes: 10 mM * 1 mL; 5 mg; 10 mg; 25 mg; 50 mg; 100 mg. Product ID: HY-128773A. | |
| mRNA (2'-O-methyladenosine-N6-)-methyltransferase | This enzyme belongs to the family of transferases, specifically those transferring one-carbon group methyltransferases. Group: Enzymes. Synonyms: messenger ribonucleate 2'-O-methyladenosine NG-methyltransferase; S-adenosyl-L-methionine:mRNA (2'-O-methyladenosine-6-N-)-methyltransferase. Enzyme Commission Number: EC 2.1.1.62. CAS No. 68009-87-0. Storage: Store it at +4 ?C for short term. For long term storage, store it at -20 ?C?-80 ?C. Form: Liquid or lyophilized powder. EXWM-1964; mRNA (2'-O-methyladenosine-N6-)-methyltransferase; EC 2.1.1.62; 68009-87-0; messenger ribonucleate 2'-O-methyladenosine NG-methyltransferase; S-adenosyl-L-methionine:mRNA (2'-O-methyladenosine-6-N-)-methyltransferase. Cat No: EXWM-1964. |  |
| mRNA(cytosine6666) deaminase | The apolipoprotein B mRNA editing enzyme complex catalyses the editing of apolipoprotein B mRNA at cytidine6666 to uridine, thereby transforming the codon for glutamine-2153 to a termination codon. Editing results in translation of a truncated apolipoprotein B isoform (apoB-48) with distinct functions in lipid transport. The catalytic component (APOBEC-1) contains zinc at the active site. Group: Enzymes. Synonyms: APOBEC-1 (catalytic component of an RNA-editing complex); APOBEC1 (catalytic subunit); apolipoprotein B mRNA-editing enzyme 1 (catalytic component of an RNA-editing complex); apoB mRNA-editing enzyme catalytic polypeptide 1 (catalytic component of an RNA-editing complex); apoB mRNA editing complex; apolipoprotein B mRNA editing enzyme; REPR. Enzyme Commission Number: EC 3.5.4.36. Storage: Store it at +4 ?C for short term. For long term storage, store it at -20 ?C?-80 ?C. Form: Liquid or lyophilized powder. EXWM-4564; mRNA(cytosine6666) deaminase; EC 3.5.4.36; APOBEC-1 (catalytic component of an RNA-editing complex); APOBEC1 (catalytic subunit); apolipoprotein B mRNA-editing enzyme 1 (catalytic component of an RNA-editing complex); apoB mRNA-editing enzyme catalytic polypeptide 1 (catalytic component of an RNA-editing complex); apoB mRNA editing complex; apolipoprotein B mRNA editing enzyme; REPR. Cat No: EXWM-4564. | |
| mRNA (guanine-N7)-methyltransferase | The nucleoside next to the terminal guanosine may be either guanosine or adenosine. Group: Enzymes. Synonyms: messenger ribonucleate guanine 7-methyltransferase; guanine-7-methyltransferase; messenger RNA guanine 7-methyltransferase; S-adenosyl-L-methionine:mRNA (guanine-7-N)-methyltransferase. Enzyme Commission Number: EC 2.1.1.56. CAS No. 56941-25-4. Storage: Store it at +4 ?C for short term. For long term storage, store it at -20 ?C?-80 ?C. Form: Liquid or lyophilized powder. EXWM-1958; mRNA (guanine-N7)-methyltransferase; EC 2.1.1.56; 56941-25-4; messenger ribonucleate guanine 7-methyltransferase; guanine-7-methyltransferase; messenger RNA guanine 7-methyltransferase; S-adenosyl-L-methionine:mRNA (guanine-7-N)-methyltransferase. Cat No: EXWM-1958. | |
| mRNA guanylyltransferase | The enzyme can also modify synthetic poly(A) and poly(G) to form the structures m7G(5')pppAn and m7G(5')pppGn. Group: Enzymes. Synonyms: mRNA capping enzyme; messenger RNA guanylyltransferase; Protein λ2. Enzyme Commission Number: EC 2.7.7.50. CAS No. 56941-23-2. Storage: Store it at +4 ?C for short term. For long term storage, store it at -20 ?C?-80 ?C. Form: Liquid or lyophilized powder. EXWM-3263; mRNA guanylyltransferase; EC 2.7.7.50; 56941-23-2; mRNA capping enzyme; messenger RNA guanylyltransferase; Protein λ2. Cat No: EXWM-3263. | |
| mRNA N1-methyladenine demethylase | Contains iron(II). Catalyses oxidative demethylation of mRNA N1-methyladenine. The enzyme is also involved in alkylation repair in DNA. Group: Enzymes. Synonyms: ALKBH3. Enzyme Commission Number: EC 1.14.11.54. Storage: Store it at +4 ?C for short term. For long term storage, store it at -20 ?C?-80 ?C. Form: Liquid or lyophilized powder. EXWM-0673; mRNA N1-methyladenine demethylase; EC 1.14.11.54; ALKBH3. Cat No: EXWM-0673. | |
| mRNA N6-methyladenine demethylase | Contains iron(II). Catalyses oxidative demethylation of mRNA N6-methyladenine. The FTO enzyme from human can also demethylate N3-methylthymine from single stranded DNA and N3-methyluridine from single stranded RNA with low activity. Group: Enzymes. Synonyms: ALKBH5; FTO. Enzyme Commission Number: EC 1.14.11.53. Storage: Store it at +4 ?C for short term. For long term storage, store it at -20 ?C?-80 ?C. Form: Liquid or lyophilized powder. EXWM-0672; mRNA N6-methyladenine demethylase; EC 1.14.11.53; ALKBH5; FTO. Cat No: EXWM-0672. | |
| MroN I | One unit of the enzyme is the amount required to hydrolyze 1 μg of Adenovirus-2 DNA in 1 hour at 37°C in a total reaction volume of 50 μl. Applications: After 5-fold overdigestion with enzyme more than 90% of the ad-2 dna fragments can be ligated and recut. Group: Restriction Enzymes. Purity: 500 U; 2500U. G↑CCGGC CGGCC↓G. Activity: 5000u.a./ml. Appearance: 10 X SE-buffer B. Storage: -20°C. Form: Liquid. Source: Micrococcus roseus N0. Pack: 10 mM Tris-HCl (pH 7.5); 250 mM NaCl; 0.1 mM EDTA; 7 mM 2-mercaptoethanol; 200 μg/ml BSA; 50% glycerol. Cat No: ET-1137RE. | |
| MroX I | One unit of the enzyme is the amount required to hydrolyze 1 μg of Lambda DNA in 1 hour at 37°C in a total reaction volume of 50 μl. Applications: After 5-fold overdigestion with enzyme more than 50% of the dna fragments can be ligated and recut. Group: Restriction Enzymes. Purity: 200U; 1000U. GAANN↑NNTTC CTTNN↓NNAAG. Activity: 5000u.a./ml. Appearance: 10 X SE-buffer W. Storage: -20°C. Form: Liquid. Source: Micrococcus roseus X. Pack: 10 mM Tris-HCl (pH 7.5); 200 mM NaCl; 0,1 mM EDTA; 7 mM 2-mercaptoethanol; 200 μg/ml BSA; 50% glycerol. Cat No: ET-1138RE. | |
| MRS1220 | MRS1220. Group: Biochemicals. Alternative Names: N-[9-Chloro-2-(2-furanyl)[1,2,4]-triazolo[1,5-c]quinazolin-5-yl]benzene acetamide. Grades: Highly Purified. CAS No. 183721-15-5. Pack Sizes: 1mg, 2mg, 5mg, 10mg, 25mg. US Biological Life Sciences. | Worldwide |
| MRS 1220 | MRS 1220, a derivative of the triazoloquinazoline, is a potent and highly selective antagonist at the human A3 adenosine receptor (Ki= 0.65, 305, and 52 nM at hA3, rA1 and rA2A respectively.) It exhibits an IC50 value > 1 μM for inhibition of binding to rat A3 receptors. Synonyms: N-[9-Chloro-2-(2-furanyl)[1,2,4]-triazolo[1,5-c]quinazolin-5-yl]benzene acetamide; MRS1220; MRS-1220; MRS 1220. Grades: ≥98% by HPLC. CAS No. 183721-15-5. Molecular formula: C21H14ClN5O2. Mole weight: 403.83. | |
| MRS 1334 | MRS 1334 is a potent and highly specific antagonist for the human adenosine A3 receptor (Ki= are 2.69 nM at hA3). Synonyms: MRS 1334; MRS1334; MRS-1334; 1,4-Dihydro-2-methyl-6-phenyl-4-(phenylethynyl)-3,5-pyridinedicarboxylic acid 3-ethyl-5-[(3-nitrophenyl)methyl] ester. Grades: ≥98% by HPLC. CAS No. 192053-05-7. Molecular formula: C31H26N2O6. Mole weight: 522.56. | |
| MRS 1477 | MRS 1477, a dihydropyridine derivative, is a TRPV1 positive allosteric modulator, and potentiates vanilloid and proton activation of TRPV1 channels. Synonyms: MRS-1477; MRS 1477; MRS1477; 4-Ethyl-1,4-dihydro-5-[[(2-methoxyethyl)thio]carbonyl]-6-methyl-2-phenyl-3-pyridinecarboxylic acid ethyl ester. Grades: ≥98% by HPLC. CAS No. 212200-21-0. Molecular formula: C21H27NO4S. Mole weight: 389.51. | |
| MRS 1523 | MRS 1523 is a potent and selective adenosine A3 receptor antagonist (Ki= 18.9 nM for human A3R). Uses: Purinergic p1 receptor antagonists. Synonyms: MRS1523; MRS 1523; MRS-1523. Propyl 6-ethyl-5-ethylsulfanylcarbonyl-2-phenyl-4-propylpyridine-3-carboxylate. Grades: 98%. CAS No. 212329-37-8. Molecular formula: C23H29NO3S. Mole weight: 399.55. | |
| MRS 1706 | MRS 1706 is a potent and selective A2B inverse agonist. Uses: Adenosine a2 receptor antagonists. Synonyms: MRS1706; MRS 1706; MRS-1706. N-(4-Acetylphenyl)-2-[4-(2,3,6,7-tetrahydro-2,6-dioxo-1,3-dipropyl-1H-purin-8-yl)phenoxy]acetamide. CAS No. 264622-53-9. Molecular formula: C27H29N5O5. Mole weight: 503.56. | |
| MRS 1754 | MRS 1754 is a selective A2B antagonist. Synonyms: MRS1754; MRS-1754; MRS 1754; N-(4-Cyanophenyl)-2-[4-(2,3,6,7-tetrahydro-2,6-dioxo-1,3-dipropyl-1H-purin-8-yl)phenoxy]-acetamide. CAS No. 264622-58-4. Molecular formula: C26H26N6O4. Mole weight: 486.52. | |
| MRS 1845 | MRS 1845 is a potent SOCE inhibitor that can block Ca2+ capacitative entry resulting in an antiinflammatory effect. MRS 1845 inhibits capacitative Ca2+ influx in HL-60 cells (IC50 = 1.7 mM). Synonyms: MRS 1845; MRS1845; MRS-1845; N-PROPARGYLNITRENDIPENE; MRS 1845; 1,4-DIHYDRO-2,6-DIMETHYL-4-(3-NITROPHENYL)-1-(2-PROPYNYL)-3,5-PYRIDINEDICARBOXYLIC ACID ETHYL, METHYL ESTER; 1, 4-Dihydro-2, 6-di methyl -4- (3-nitrophenyl) -1- (2-propynyl) -3, 5-pyridinedicarboxylicacidethyl methyl ester. Grades: ≥98% by HPLC. CAS No. 544478-19-5. Molecular formula: C21H22N2O6. Mole weight: 398.41. | |
| MRS 1845 | MRS 1845. Group: Biochemicals. Grades: Purified. CAS No. 544478-19-5. Pack Sizes: 10mg, 50mg. US Biological Life Sciences. | Worldwide |
| MRS 2159 | DBO-83 is an agonist of nicotinic acetylcholine receptors (nAChRs), which has anti-injury and anti-forgetting effects. DBO-83 dose-dependently increased the incubation period of paw licking in hot plate mice and decreased the number of abdominal coarctation in acetic acid mice, which was reduced by the nAChR antagonist mecamylamine. Grades: ≥98%. CAS No. 195211-53-1. Molecular formula: C15H11N3O8PNa3. Mole weight: 461.21. | |
| MRS2179 ammonium salt | MRS2179 is a competitive P2Y1 receptor antagonist that inhibits platelet aggregation. Grades: ≥98%. CAS No. 228264-19-5. Molecular formula: C11H17N5O9P2·xNH3. Mole weight: 425.23. | |
| MRS 2179 tetrasodium salt | MRS 2179 tetrasodium salt is a competitive antagonist at P2Y1 receptors (KB = 100 nM), which is selective over P2X1 (IC50 = 1.15 μM), P2X3 (IC50 = 12.9 μM), P2X2, P2X4, P2Y2, P2Y4 and P2Y6 receptors. It inhibits ADP-induced platelet shape change and aggregation (pA2 = 6.55) in vitro and prolongs bleeding time in rats and mice compared to controls. Synonyms: MRS 2179 tetrasodium salt; MRS2179 tetrasodium salt; MRS-2179 tetrasodium salt; 2'-Deoxy-N6-methyladenosine 3',5'-bisphosphate tetrasodium salt. Grades: ≥98% by HPLC. CAS No. 1454889-37-2. Molecular formula: C11H13N5O9P2Na4. Mole weight: 513.16. | |
| MRS 2211 | MRS 2211. Group: Biochemicals. Grades: Purified. Pack Sizes: 10mg, 50mg. US Biological Life Sciences. | Worldwide |
| MRS 2211 | MRS 2211 is a competitive P2Y13 receptor antagonist (pIC50 = 5.97), with > 20-fold selectivity over P2Y1 and P2Y12 receptors. It is known that MRS 2211 inhibits ADP-induced inositol trisphosphate (IP3) formation. Research suggests that MRS 2211 inhibits phospholipase C (PLC) response to 2-methylthio-ADP in 1321N1 astrocytoma cells. Synonyms: 2-[(2-Chloro-5-nitrophenyl)azo]-5-hydroxy-6-methyl-3-[(phosphonooxy)methyl]-4-pyridinecarboxaldehyde disodium salt; MRS2211; MRS-2211. Grades: ≥96% by HPLC. Molecular formula: C14H10N4O8Na2PCl. Mole weight: 474.66. | |
| MRS 2211 (2-[(2-Chloro-5-nitrophenyl)azo]-5-hydroxy-6-methyl-3-[(phosphonooxy)methyl]-4-pyridinecarboxaldehyde Sodium Salt, P2Y13 Purinergic Receptor Antagonist, MRS2211, MRS 2211, MRS-2211) | A highly selective and competitive antagonist of P2Y13 purinergic receptor (pIC50 = 5.97). Exhibits about 20-fold greater selectivity over P2Y1 and P2Y12 receptors. Group: Biochemicals. Grades: Highly Purified. Pack Sizes: 10mg. US Biological Life Sciences. | Worldwide |
| MRS 2219 | MRS 2219. Group: Biochemicals. Grades: Purified. CAS No. 14141-47-0. Pack Sizes: 10mg, 50mg. US Biological Life Sciences. | Worldwide |
| MRS 2219 | MRS 2219, a cyclic pyridoxine-alpha4, 5-monophosphate compound, is a selective potentiator of ATP-evoked responses at rat P2X1 receptors (EC50 = 5.9 μM). Synonyms: 1,5-Dihydro-3-hydroxy-8-methyl[1,3,2]dioxaphosphepino[5,6-c]pyridin-9-ol-3-oxide; MRS 2219; MRS-2219; MRS2219. Grades: ≥99% by HPLC. CAS No. 14141-47-0. Molecular formula: C8H10NO5P. Mole weight: 231.14. | |
| MRS 2279 | MRS 2279 is the first broadly applicable, selective and high affinity competitive antagonist radioligand for a P2Y receptor (Ki = 2.5 nM; IC50 = 51.6 nM). Synonyms: MRS2279; MRS-2279; MRS 2279. (1R*,2S*)-4-[2-Chloro-6-(methylamino)-9H-purin-9-yl]-2-(phosphonooxy)bicyclo[3.1.0]hexane-1-methanol dihydrogen phosphate ester diammonium salt. Grades: ≥98% by HPLC. CAS No. 367909-40-8. Molecular formula: C13H18ClN5O8P2.2NH3. Mole weight: 503.78. | |
| MRS 2365 | MRS 2365 is a highly potent, selective P2Y1 receptor agonist (EC50 = 0.4 nM), with no activity at P2Y12 receptors and only very low agonist activity at P2Y13 receptors (at concentrations up to 1 μM). Synonyms: [[(1R,2R,3S,4R,5S)-4-[6-Amino-2-(methylthio)-9H-purin-9-yl]-2,3-dihydroxybicyclo[3.1.0]hex-1-yl]methyl] diphosphoric acid mono ester trisodium salt; MRS2365; MRS 2365; MRS-2365. Grades: ≥98% by HPLC. CAS No. 436847-09-5. Molecular formula: C13H16N5O9P2SNa3. Mole weight: 549.28. | |
| MRS 2500 tetraammonium salt | MRS 2500 tetraammonium salt is a highly potent and selective antagonist of the platelet P2Y1 receptor (Ki = 0.78 nM). It inhibits ADP-induced aggregation of human platelets. Synonyms: (1R*,2S*)-4-[2-Iodo-6-(methylamino)-9H-purin-9-yl]-2-(phosphonooxy)bicyclo[3.1.0]hexane-1-methanol dihydrogen phosphate ester tetraammonium salt; Bicyclo[3.1.0]hexane-1-methanol, 4-[2-iodo-6-(methylamino)-9H-purin-9-yl]-2-(phosphonooxy)-, dihydrogen phosphate (ester), tetraammonium salt, (1R,2S,4S,5S)-; MRS-2500 tetraammonium; (1R, 2S, 4S, 5S)-4-(2-iodo-6-(methylamino)-9H-purin-9-yl)-1-((phosphonooxy)methyl)bicyclo[3. 1. 0]hexan-2-yl dihydrogen phosphate, tetraammonia salt. Grades: ≥96% by HPLC. CAS No. 630103-23-0. Molecular formula: C13H18N5O8P2I.4NH3. Mole weight: 629.29. | |
| MRS 2500 tetraammonium salt | MRS 2500 tetraammonium salt. Group: Biochemicals. Alternative Names: (1R, 2S) -4-[2-[2-Iodo-6- (methylamino) -9H-purin-9-yl]-2- (phosphonooxy) bicyclo[3. 1. 0]hexane-1-methanol dihydrogen phosphate ester tetraammonium salt. Grades: Highly Purified. CAS No. 779323-43-2,630103-23-0. Pack Sizes: 1mg, 2mg, 5mg. Molecular Formula: C13H18N5O8P2I·4NH3. US Biological Life Sciences. | Worldwide |
| MRS 2578 | MRS 2578. Group: Biochemicals. Grades: Purified. CAS No. 711019-86-2. Pack Sizes: 10mg, 50mg. US Biological Life Sciences. | Worldwide |
| MRS 2578 | MRS2578 is a potent P2Y6 receptor antagonist with IC50 of 37 nM, exhibits insignificant activity at P2Y1, P2Y2, P2Y4,and P2Y11 receptors. Synonyms: MRS-2578; MRS2578; MRS 2578. Grades: >98%. CAS No. 711019-86-2. Molecular formula: C20H20N6S4. Mole weight: 472.67. | |
| MRS 2690 | MRS 2690 is a potent P2Y14 receptor agonist (EC50 = 49 nM), with 7-fold higher potency than UDP-glucose. Synonyms: Diphosphoric acid 1-α-D-glucopyranosyl ester 2-[(4'-methylthio)uridin-5''-yl] ester disodium salt; MRS2690; MRS-2690; MRS 2690. Grades: ≥98% by HPLC. CAS No. 15039-58-4. Molecular formula: C15H22N2Na2O16P2S. Mole weight: 626.33. | |
| MRS 2690 | MRS 2690. Group: Biochemicals. Grades: Purified. CAS No. 15039-58-4. Pack Sizes: 1mg. US Biological Life Sciences. | Worldwide |
| MRS 2693 trisodium salt | MRS 2693 trisodium salt. Group: Biochemicals. Grades: Purified. CAS No. 1448858-83-0. Pack Sizes: 1mg. US Biological Life Sciences. | Worldwide |
| MRS 2693 trisodium salt | MRS 2693 trisodium salt is a selective P2Y6 agonist (EC50 = 0.015 μM at the hP2Y6 receptor), with no activity at other P2Y subtypes. Synonyms: Uridine 5'-(trihydrogen diphosphate), 5-iodo-, sodium salt (1:3); MRS 2693; 5-Iodo-UDP Trisodium Salt; 5-Iodouridine 5'-(trihydrogen diphosphate) sodium salt; 5-Iodouridine-5'-O-diphosphate trisodium salt; MRS2693; MRS-2693. Grades: ≥95% by HPLC. CAS No. 1448858-83-0. Molecular formula: C9H10IN2Na3O12P2. Mole weight: 596.00. | |
| Mrs 2768 tetrasodium salt | Heterocyclic Organic Compound. CAS No. 1047980-83-5. Molecular formula: C15H16N2O18P4Na4. Mole weight: C15H16N2O18P4Na4. Purity: >98 %. Catalog: ACM1047980835. | |
| MRS 2768 tetrasodium salt | MRS 2768 tetrasodium salt. Group: Biochemicals. Grades: Purified. CAS No. 1047980-83-5. Pack Sizes: 1mg. US Biological Life Sciences. | Worldwide |
| MRS 2768 tetrasodium salt | MRS 2768 tetrasodium salt is a selective P2Y2 agonist (EC50 = 1.89 μM), with no affinity for human P2Y4 or P2Y6 receptors. Synonyms: Uridine-5'-tetraphosphate δ-phenyl ester tetrasodium salt; MRS 2768 tetrasodium salt; MRS2768 tetrasodium salt; MRS-2768 tetrasodium salt. Grades: ≥98% by HPLC. CAS No. 1047980-83-5. Molecular formula: C15H16N2O18P4Na4. Mole weight: 728.14. | |
Our database is helping our users find suppliers everyday.
