A directory of where to buy chemicals in the USA, including: distributors, industrial manufacturers, bulk supplies and wholesalers of raw ingredients & finished goods.
Search for products or services, then visit the suppliers website for prices or more information.
| Product | Description | |
|---|---|---|
| Tylvalosin tartrate | Tylvalosin (Acetylisovaleryltylosin) tartrate is an orally active, broad-spectrum macrolide antibiotic with antimicrobial activity. Tylvalosin tartrate is an antiviral agent useful in studying PRRSV infection. Tylvalosin tartrate induces apoptosis. Tylvalosin tartrate also has anti-inflammatory activity, relieves oxidative stress, and alleviates acute lung injury by inhibiting NF-κB activation [1] [2] [3] [4]. Uses: Scientific research. Group: Signaling pathways. Alternative Names: Acetylisovaleryltylo?sin tartrate. CAS No. 63428-13-7. Pack Sizes: 10 mM * 1 mL; 50 mg; 100 mg; 500 mg. Product ID: HY-128423. |  |
| Tymazoline Hydrochloride | Tymazoline Hydrochloride. Group: Biochemicals. Alternative Names: 4, 5-Dihydro-2-[[5-methyl-2- (1-methylethyl) phenoxy]methyl]-H-imidazole, , Hydrochloride; 4, 5-Dihydro-2-[[5-methyl-2- (1-methylethyl) phenoxy]methyl]-1H-imidazole Monohydrochloride; 2-[(Thymyloxy)methyl]-2-imidazoline, Monohydrochloride; 2- (Thymyloxymethyl) glyoxalidine Hydrochloride; Thymazen. Grades: Highly Purified. CAS No. 28120-03-8. Pack Sizes: 2.5g. Molecular Formula: C14H21N2ClO, Molecular Weight: 268.779999999999. US Biological Life Sciences. |  Worldwide |
| Type 1 Moulded Injection Vials | Type 1 Moulded Injection Vials. Product ID: PM-033. Product Keywords: Packaging Materials; Glass Packaging; PM-033; Type 1 Moulded Injection Vials. |  |
| Type A Allatostatin III | Type A Allatostatin III is a type A allatostatin. Synonyms: H-Gly-Gly-Ser-Leu-Tyr-Ser-Phe-Gly-Leu-NH2; Glycylglycyl-L-seryl-L-leucyl-L-tyrosyl-L-seryl-L-phenylalanylglycyl-L-leucinamide; Allatostatin 8 (Diploptera punctata); Allatostatin A 3 (Diploptera punctata); Allatostatin A 3; Allatostatin III (Diploptera punctata); AST 3; AST 8; Dippu-AST 8. Grades: 95%. CAS No. 123209-96-1. Molecular formula: C42H62N10O12. Mole weight: 899.01. |  |
| type III protein arginine methyltransferase | Type III protein arginine methyltransferases catalyse the single methylation of one of the terminal nitrogen atoms of the guanidino group in an L-arginine residue within a protein. Unlike type I and type II protein arginine methyltransferases, which also catalyse this reaction, type III enzymes do not methylate the substrate any further. cf. EC 2.1.1.319, type I protein arginine methyltransferase, EC 2.1.1.320, type II protein arginine methyltransferase, and EC 2.1.1.322, type IV protein arginine methyltransferase. Group: Enzymes. Synonyms: PRMT7 (gene name). Enzyme Commission Number: EC 2.1.1.321. Storage: Store it at +4 ?C for short term. For long term storage, store it at -20 ?C?-80 ?C. Form: Liquid or lyophilized powder. EXWM-1929; type III protein arginine methyltransferase; EC 2.1.1.321; PRMT7 (gene name). Cat No: EXWM-1929. |  |
| type III site-specific deoxyribonuclease | This is a large group of enzymes which, together with those now listed as EC 3.1.21.3 (type 1 site-specific deoxyribonuclease) and EC 3.1.21.4 (type II site-specific deoxyribonuclease), were previously listed separately in sub-subclasses EC 3.1.23 and EC 3.1.24. They have an absolute requirement for ATP but do not hydrolyse it; S-adenosy-L-methionine stimulates the reaction, but is not absolutely required. They recognize specific, short DNA sequences and cleave a short distance away from the recognition sequence. These enzymes exist as complexes with enzymes of similar specificity listed under EC 2.1.1.72 [site-specific DNA-methyltransferase (adenine-specific)] or EC 2.1.1.73. Group: Enzymes. Synonyms: type III restriction enzyme; restriction-modification system. Enzyme Commission Number: EC 3.1.21.5. CAS No. 9075-8-5. Storage: Store it at +4 ?C for short term. For long term storage, store it at -20 ?C?-80 ?C. Form: Liquid or lyophilized powder. EXWM-3575; type III site-specific deoxyribonuclease; EC 3.1.21.5; 9075-08-5; type III restriction enzyme; restriction-modification system. Cat No: EXWM-3575. | |
| type II protein arginine methyltransferase | The enzyme catalyses the methylation of one of the terminal guanidino nitrogen atoms in arginine residues within proteins, forming monomethylarginine, followed by the methylation of the second terminal nitrogen atom to form a symmetrical dimethylarginine. The mammalian enzyme is active in both the nucleus and the cytoplasm, and plays a role in the assembly of snRNP core particles by methylating certain small nuclear ribonucleoproteins. cf. EC 2.1.1.319, type I protein arginine methyltransferase, EC 2.1.1.321, type III protein arginine methyltransferase, and EC 2.1.1.322, type IV protein arginine methyltransferase. Group: Enzymes. Synonyms: PRMT5 (gene name); PRMT9 (gene name). Enzyme Commission Number: EC 2.1.1.320. Storage: Store it at +4 ?C for short term. For long term storage, store it at -20 ?C?-80 ?C. Form: Liquid or lyophilized powder. EXWM-1928; type II protein arginine methyltransferase; EC 2.1.1.320; PRMT5 (gene name); PRMT9 (gene name). Cat No: EXWM-1928. | |
| type II site-specific deoxyribonuclease | This is a large group of enzymes which, together with those now listed as EC 3.1.21.3 (type 1 site-specific deoxyribonuclease) and EC 3.1.21.5. Group: Enzymes. Synonyms: type II restriction enzyme. Enzyme Commission Number: EC 3.1.21.4. CAS No. 9075-8-5. Storage: Store it at +4 ?C for short term. For long term storage, store it at -20 ?C?-80 ?C. Form: Liquid or lyophilized powder. EXWM-3574; type II site-specific deoxyribonuclease; EC 3.1.21.4; 9075-08-5; type II restriction enzyme. Cat No: EXWM-3574. | |
| type I protein arginine methyltransferase | This eukaryotic enzyme catalyses the sequential dimethylation of one of the terminal guanidino nitrogen atoms in arginine residues, resulting in formation of asymmetric dimethylarginine residues. Some forms (e.g. PRMT1) have a very wide substrate specificity, while others (e.g. PRMT4 and PRMT6) are rather specific. The enzyme has a preference for methylating arginine residues that are flanked by one or more glycine residues. PRMT1 is responsible for the bulk (about 85%) of total protein arginine methylation activity in mammalian cells. cf. EC 2.1.1.320, type II protein arginine methyltransferase, EC 2.1.1.321, type III protein arginine methyltransferase, and EC 2.1.1.322, type IV protein arginine methyltransferase. Group: Enzymes. Synonyms: PRMT1 (gene name); PRMT2 (gene name); PRMT3 (gene name); PRMT4 (gene name); PRMT6 (gene name); PRMT8 (gene name); RMT1 (gene name); CARM1 (gene name). Enzyme Commission Number: EC 2.1.1.319. Storage: Store it at +4 ?C for short term. For long term storage, store it at -20 ?C?-80 ?C. Form: Liquid or lyophilized powder. EXWM-1927; type I protein arginine methyltransferase; EC 2.1.1.319; PRMT1 (gene name); PRMT2 (gene name); PRMT3 (gene name); PRMT4 (gene name); PRMT6 (gene name); PRMT8 (gene name); RMT1 (gene name); CARM1 (gene name). Cat No: EXWM-1927. | |
| type I site-specific deoxyribonuclease | This is a large group of enzymes which, together with those now listed as EC 3.1.21.4 (type II site-specific deoxyribonuclease) and EC 3.1.21.5 (type III site-specific deoxyribonuclease), were previously listed separately in sub-subclasses EC 3.1.23 and EC 3.1.24. They have an absolute requirement for ATP (or dATP) and S-adenosyl-L-methionine. They recognize specific short DNA sequences and cleave at sites remote from the recognition sequence. They are multifunctional proteins that also catalyse the reactions of EC 2.1.1.72 [site-specific DNA-methyltransferase (adenine-specific)] and EC 2.1.1.37. Group: Enzymes. Synonyms: type I restriction enzyme; deoxyribonuclease (ATP- and S-adenosyl-L-methionine-dependent); restriction-modification system; deoxyribonuclease (adenosine tr. Enzyme Commission Number: EC 3.1.21.3. CAS No. 37263-09-5. Storage: Store it at +4 ?C for short term. For long term storage, store it at -20 ?C?-80 ?C. Form: Liquid or lyophilized powder. EXWM-3573; type I site-specific deoxyribonuclease; EC 3.1.21.3; 37263-09-5; type I restriction enzyme; deoxyribonuclease (ATP- and S-adenosyl-L-methionine-dependent); restriction-modification system; deoxyribonuclease (adenosine triphosphate-hydrolyzing); adenosine triphosphate-dependent deoxyribonuclease; ATP-dependent DNase; type 1 site-specific deoxyribonuclease. Cat No: EXWM-3573. | |
| Type IV collagen alpha 4 chain (170-177) | Type IV collagen alpha 4 chain (170-177) is a 8-aa peptide. Type IV collagen is the major structural component of glomerular basement membranes (GBM), forming a 'chicken-wire' meshwork together with laminins, proteoglycans and entactin/nidogen. | |
| type IV protein arginine methyltransferase | This enzyme, characterized from the yeast Saccharomyces cerevisiae, methylates the the Δ-nitrogen atom of arginine residues within proteins. Among its substrates are Arg67 of the ribosomal protein L12. cf. EC 2.1.1.319, type I protein arginine methyltransferase, EC 2.1.1.320, type II protein arginine methyltransferase, and EC 2.1.1.321, type III protein arginine methyltransferase. Group: Enzymes. Synonyms: RMT2 (gene name). Enzyme Commission Number: EC 2.1.1.322. Storage: Store it at +4 ?C for short term. For long term storage, store it at -20 ?C?-80 ?C. Form: Liquid or lyophilized powder. EXWM-1930; type IV protein arginine methyltransferase; EC 2.1.1.322; RMT2 (gene name). Cat No: EXWM-1930. | |
| Type Y molecular sieve, ammonium ion, powder | DryPowder; DryPowder, PelletsLargeCrystals; OtherSolid. Group: Molecular sieve. CAS No. 1318-02-1. Product ID: dioxosilane; oxo(oxoalumanyloxy)alumane. Molecular formula: 162.05g/mol. Mole weight: Al2O5Si. O=[Al]O[Al]=O.O=[Si]=O. InChI=1S/2Al.O2Si.3O/c;;1-3-2;; : HNPSIPDUKPIQMN-UHFFFAOYSA-N. |  |
| Type Y molecular sieve, sodium ion, powder | DryPowder; DryPowder, PelletsLargeCrystals; OtherSolid. Group: Molecular sieve. CAS No. 1318-02-1. Product ID: dioxosilane; oxo(oxoalumanyloxy)alumane. Molecular formula: 162.05g/mol. Mole weight: Al2O5Si. O=[Al]O[Al]=O.O=[Si]=O. InChI=1S/2Al.O2Si.3O/c;;1-3-2;; : HNPSIPDUKPIQMN-UHFFFAOYSA-N. | |
| Typhaneoside | Typhaneoside, extracted from Typha angustifolia L., Typhaneoside can inhibit the excessive autophagy of hypoxia/reoxygenation cells and increase the phosphorylation of Akt and mTOR. Typhaneoside has certain effects on the cardiovascular system, including lowering blood lipid levels, promoting antiatherosclerosis activities, as well as improving immune and coagulation function. Group: Inhibitors. CAS No. 104472-68-6. Molecular formula: C34H42O20. Mole weight: 770.69. Appearance: Solid. Purity: 0.9974. Canonical SMILES: O=C1C (O[C@H] (O[C@H] (CO[C@H] (O[C@@H] (C)[C@H] (O)[C@H]2O)[C@@H]2O)[C@@H] (O)[C@@H]3O)[C@@H]3O[C@@] (O[C@@H] (C)[C@H] (O)[C@H]4O) ([H])[C@@H]4O)=C (C5=CC (OC)=C (O)C=C5)OC6=CC (O)=CC (O)=C16. Catalog: ACM104472686. |  |
| Typhaneoside | Typhaneoside. Group: Biochemicals. Alternative Names: Aervitrin. Grades: Plant Grade. CAS No. 104472-68-6. Pack Sizes: 20mg. Molecular Formula: C34H42O20, Molecular Weight: 770.684999999999. US Biological Life Sciences. | Worldwide |
| Tyr0-C-Type Natriuretic Peptide (32-53) | Tyr0-C-Type Natriuretic Peptide (32-53), a peptide hormone, is a crucial regulator of the body's fluid and electrolyte balance. Studies have demonstrated its therapeutic potential in cardiovascular and renal diseases. It exerts its effects via the Natriuretic Peptide Receptor C, thus signifying it as a potential drug target for future development though much remains unknown about the precise mechanisms of its action. Synonyms: H-Tyr-Gly-Leu-Ser-Lys-Gly-Cys(1)-Phe-Gly-Leu-Lys-Leu-Asp-Arg-Ile-Gly-Ser-Met-Ser-Gly-Leu-Gly-Cys(1)-OH. Grades: 95%. CAS No. 142878-79-3. Molecular formula: C102H166N28O30S3. Mole weight: 2360.77. | |
| TYRA-300 | TYRA-300 is an orally active, selective inhibitor for FGFR3 with an IC 50 of 11 nM in Ba/F3. TYRA-300 exhibits antitumor efficacy against urothelial cancers and solid tumors [1]. Uses: Scientific research. Group: Signaling pathways. CAS No. 2800223-30-5. Pack Sizes: 10 mM * 1 mL; 1 mg; 5 mg; 10 mg; 25 mg; 50 mg. Product ID: HY-159642. | |
| Tyr-α-cgrp(human) | Heterocyclic Organic Compound. CAS No. 124756-98-5. Molecular formula: C172H276N52O51S2;Sequence:H-Tyr-Ala-Cys-Asp-Thr-Al. Purity: 0.96. Catalog: ACM124756985. | |
| Tyramine | 25g Pack Size. Group: Analytical Reagents, Building Blocks, Organics, Stains & Indicators. Formula: C8 H11 N O. CAS No. 51-67-2. Prepack ID 90026279-25g. Molecular Weight 137.18. See USA prepack pricing. |  |
| Tyramine | Tyramine is an amino acid that helps regulate blood pressure. Tyramine occurs naturally in the body, and it's found in certain foods [1]. Uses: Scientific research. Group: Natural products. CAS No. 51-67-2. Pack Sizes: 10 mM * 1 mL; 500 mg; 1 g. Product ID: HY-W007606. | |
| Tyramine | Tyramine. CAS No: 51-67-2 |  Sarchem Laboratories New Jersey NJ |
| Tyramine-d4 Hydrochloride (4-(2-Aminoethyl-d4)phenol Hydrochloride, 2-(4-Hydroxyphenyl)ethyl-1,1,2,2-d4-amine Hydrochloride, Tyrosamine-d4 Hydrochloride, Mydrial-d4) | Adrenergic. Group: Biochemicals. Alternative Names: 4-(2-Aminoethyl-d4)phenol Hydrochloride; 2-(4-Hydroxyphenyl)ethyl-1,1,2,2-d4-amine Hydrochloride; Tyrosamine-d4 Hydrochloride; Mydrial-d4. Grades: Highly Purified. Pack Sizes: 1mg. US Biological Life Sciences. | Worldwide |
| Tyramine Free Base | Adrenergic. Group: Biochemicals. Alternative Names: 4-(2-Aminoethyl)phenol; 2- (4-Hydroxyphenyl) ethylamine; 2- (4-Hydroxyphenyl) ethylamine; 2- (p-Hydroxyphenyl) ethylamine; 4-(2-Aminoethyl)phenol; 4-Hydroxy- β-phenylethylamine; 4-Hydroxyphenethylamine; 4- hydroxyphenyl ethyl amine; 4-Hydroxy Benzene ethanamine; NSC 249188; Systogene; Tocosine; Tyramin; Tyramine; Tyrosamine; Uteramine; p-(2-Aminoethyl)phenol; p-Hydroxy- β-phenylethylamine; p- hydroxyphenyl ethyl amine; p-Tyramine; p- β -Aminoethylphenol. alpha. -(4-Hydroxyphenyl)- β-aminoethane; β - (4-Hydroxyphenyl) ethylamine. Grades: Highly Purified. CAS No. 51-67-2. Pack Sizes: 25g, 100g, 250g, 1Kg. Molecular Formula: C?H??NO, Molecular Weight: 137.18. US Biological Life Sciences. | Worldwide |
| Tyramine HCL | Tyramine HCL. CAS No: 60-19-5 | Sarchem Laboratories New Jersey NJ |
| Tyramine hydrochloride | A naturally occurring derivative of tyrosine. A catecholamine releasing agent that promotes blood pressure elevation. Uses: Tyramine hydrochloride has been:coinfused with adenosine in control subjects and patients in order to reduce leg blood flow by 50% without affecting arterial blood pressurelabelled with fluorescence dyes (atto 488 and atto 655) to serve as a substrate for peroxidase in immunofluorescence analysisused in dimethylformamide, labelled with 5-(and-6)carboxyfluorescein, succinimidyl ester/biotin to serve as a substrate for peroxidase in tyramide signal amplification. Synonyms: 4-(2-Aminoethyl)phenol hydrochloride; 4-Hydroxyphenethylamine hydrochloride. Grades: 98.0%. CAS No. 60-19-5. Molecular formula: C8H11NO·HCl. Mole weight: 173.64. | |
| Tyramine hydrochloride | Tyramine hydrochloride is an amino acid that helps regulate blood pressure. Tyramine hydrochloride occurs naturally in the body, and it's found in certain foods [1]. Uses: Scientific research. Group: Natural products. CAS No. 60-19-5. Pack Sizes: 10 mM * 1 mL; 250 mg; 500 mg. Product ID: HY-W016823. | |
| Tyramine Hydrochloride 99.5+% | Tyramine Hydrochloride is a naturally occurring monoamine derived from tyrosine. Neurotransmitter. Group: Biochemicals. Alternative Names: 4-(2-Aminoethyl)-phenol Hydrochloride; p-(2-Aminoethyl)-phenol Hydrochloride; 2- (4-Hydroxyphenyl) ethylamine Hydrochloride; 4-Hydroxy- β-phenethylamine Hydrochloride; 4-Hydroxyphenethylamine Hydrochloride; 4- hydroxyphenyl ethyl amine Hydrochloride; Mydrial; Tyrosam; Uteramin; p-Tyramine Hydrochloride. Grades: Reagent Grade. CAS No. 60-19-5. Pack Sizes: 5g, 25g, 100g, 250g, 1Kg. Molecular Formula: C?H??NO HCl, Molecular Weight: 173.65. US Biological Life Sciences. | Worldwide |
| tyramine-L-glutamate ligase | The enzyme, which has been characterized from the archaea Methanocaldococcus fervens, participates in the biosynthesis of the cofactor methanofuran. Requires a divalent cation for activity, with Mn2+ giving the highest activity, followed by Mg2+, Co2+, Zn2+, and Fe2+. Group: Enzymes. Synonyms: mfnD (gene name). Enzyme Commission Number: EC 6.3.4.24. Storage: Store it at +4 ?C for short term. For long term storage, store it at -20 ?C?-80 ?C. Form: Liquid or lyophilized powder. EXWM-5794; tyramine-L-glutamate ligase; EC 6.3.4.24; mfnD (gene name). Cat No: EXWM-5794. | |
| tyramine N-feruloyltransferase | Cinnamoyl-CoA, 4-coumaroyl-CoA and sinapoyl-CoA can also act as donors, and some aromatic amines can act as acceptors. Group: Enzymes. Synonyms: tyramine N-feruloyl-CoA transferase; feruloyltyramine synthase; feruloyl-CoA tyramine N-feruloyl-CoA transferase; tyramine feruloyltransferase. Enzyme Commission Number: EC 2.3.1.110. CAS No. 128909-19-3. Storage: Store it at +4 ?C for short term. For long term storage, store it at -20 ?C?-80 ?C. Form: Liquid or lyophilized powder. EXWM-2049; tyramine N-feruloyltransferase; EC 2.3.1.110; 128909-19-3; tyramine N-feruloyl-CoA transferase; feruloyltyramine synthase; feruloyl-CoA tyramine N-feruloyl-CoA transferase; tyramine feruloyltransferase. Cat No: EXWM-2049. | |
| tyramine N-methyltransferase | Has some activity on phenylethylamine analogues. Group: Enzymes. Synonyms: DIB O-methyltransferase (3,5-diiodo-4-hydroxy-benzoic acid); S-adenosyl-methionine:tyramine N-methyltransferase; tyramine methylpherase. Enzyme Commission Number: EC 2.1.1.27. CAS No. 37256-96-5. Storage: Store it at +4 ?C for short term. For long term storage, store it at -20 ?C?-80 ?C. Form: Liquid or lyophilized powder. EXWM-1875; tyramine N-methyltransferase; EC 2.1.1.27; 37256-96-5; DIB O-methyltransferase (3,5-diiodo-4-hydroxy-benzoic acid); S-adenosyl-methionine:tyramine N-methyltransferase; tyramine methylpherase. Cat No: EXWM-1875. | |
| TYR-CORTICOTROPIN RELEASING FACTOR HUMAN, RAT | Heterocyclic Organic Compound. Alternative Names: YSEEPPISLDLTFHLLREVLEEMARAEQLAQQAHSN RKLMEII-NH2; TYROSyl -CORTICOTROPIN RELEASING FACTOR (HUMAN, RAT);TYROSYL-CRF (HUMAN, RAT);TYR-SER-GLU-GLU-PRO-PRO-ILE-SER-LEU-ASP-LEU-THR-PHE-HIS-LEU-LEU-ARG-GLU-VAL-LEU-GLU-MET-ALA-ARG-ALA-GLU-GLN-LEU-ALA-GLN-GLN-ALA-H. CAS No. 100915-92-2. Catalog: ACM100915922. | |
| Tyr-CRF (human, rat) | Synonyms: CRF; H-TYR-SER-GLU-GLU-PRO-PRO-ILE-SER-LEU-ASP-LEU-THR-PHE-HIS-LEU-LEU-ARG-GLU-VAL-LEU-GLU-GLU-MET-ALA-ARG-ALA-GLU-GLN-LEU-ALA-GLN-GLN-ALA-HIS-SER-ASN-ARG-LYS-LEU-MET-GLU-ILE-ILE-NH2; H-TYR-SER-GLU-GLU-PRO-PRO-ILE-SER-LEU-ASP-LEU-THR-PHE-HIS-LEU-LEU-ARG-GL. Grades: 95%. CAS No. 100513-58-4. Molecular formula: C217H353N61O65S2. Mole weight: 4920.62. | |
| Tyr-D-ala-p-chloro-phe-pro-nh2 | Heterocyclic Organic Compound. Alternative Names: [D-ALA2, P-CHLORO-PHE3]-BETA-CASOMORPHIN (1-4) AMIDE (BOVINE);[DALA2, (PCL)PHE3] BETA-CASOMORPHIN, AMIDE, BOVINE;TYR-D-ALA-P-CHLORO-PHE-PRO-NH2;TYR-DALA-(PCL)PHE-PRO-NH2;B-CASOMORPHIN (D-ALA2,PCL-PHE3)-FRAGMENT 1-4 AMIDE;[D-Ala2, p-Cl-Phe3]-β-Casomorph. CAS No. 102029-97-0. Molecular formula: C26H32ClN5O5. Mole weight: 530.02. Catalog: ACM102029970. | |
| Tyr-(D-Dab4,Arg5,D-Trp8)-cyclo-Somatostatin-14 (4-11) | Tyr-(D-Dab4,Arg5,D-Trp8)-cyclo-Somatostatin-14 (4-11), a high affinity ligand of five somatostatin receptors (SST1-SST5), has higher binding affinity than omatostatin-14 and octreotide in AtT-20 mouse anterior pituitary tumor cells expressing SST2 and SST5 receptors. Synonyms: KE 108; H-Tyr-cyclo(-D-Dab-Arg-Phe-Phe-D-Trp-Lys-Thr-Phe); L-Tyrosyl-(2R)-2,4-diaminobutanoyl-L-arginyl-L-phenylalanyl-L-phenylalanyl-D-tryptophyl-L-lysyl-L-threonyl-L-phenylalanine (9?2)-lactam; Benzenepropanamide, α-amino-N-[(3S,6S,9S,12R,15S,18S,21S,24R)-9-(4-aminobutyl)-21-[3-[(aminoiminomethyl)amino]propyl]-6-[(1R)-1-hydroxyethyl]-12-(1H-indol-3-ylmethyl)-2,5,8,11,14,17,20,23-octaoxo-3,15,18-tris(phenylmethyl)-1,4,7,10,13,16,19,22-octaazacyclohexacos-24-yl]-4-hydroxy-, (αS)-. Grades: 95%. CAS No. 496849-46-8. Molecular formula: C67H85N15O11. Mole weight: 1276.49. | |
| TYR-GLY-ALA-VAL-VAL-ASN-ASP-LEU | Heterocyclic Organic Compound. CAS No. 103424-74-4. Catalog: ACM103424744. | |
| Tyr-Gly-Gly-OH | Tripeptide released from enkephalins by the enzyme enkephalinase. Synonyms: L-Tyrosylglycylglycine; (S) -2- (2- (2-Amino-3- (4-hydroxyphenyl) propanamido) acetamido) acetic acid; Tyr Gly Gly OH. Grades: ≥ 97% (Assay). CAS No. 21778-69-8. Molecular formula: C13H17N3O5. Mole weight: 295.30. | |
| Tyr-Gly-Gly-OH | Tyr-Gly-Gly-OH. Group: Biochemicals. Alternative Names: L-Tyrosylglycylglycine. Grades: Highly Purified. CAS No. 21778-69-8. Pack Sizes: 100mg, 250mg. US Biological Life Sciences. | Worldwide |
| Tyr-Gly-Gly-OH 99+% (TLC) | Tyr-Gly-Gly-OH 99+% (TLC). Group: Biochemicals. Grades: Reagent Grade. Pack Sizes: 100mg, 250mg. US Biological Life Sciences. | Worldwide |
| Tyr-Gly-OH | Tyr-Gly-OH. Group: Biochemicals. Grades: Reagent Grade. Pack Sizes: 250mg, 1g, 2.5g. US Biological Life Sciences. | Worldwide |
| Tyr-Gly-OH | Synonyms: L-Tyrosylglycine; (S)-2-(2-Amino-3-(4-hydroxyphenyl)propanamido)acetic acid; Tyr Gly OH. Grades: ≥ 99% (TLC). CAS No. 673-08-5. Molecular formula: C11H14N2O4. Mole weight: 238.24. | |
| Tyr-LL-37 | Tyr-LL-37 is an analog of LL-37 for radioiodination. Synonyms: [Tyr133]-Cationic Antimicrobial Protein 18 (134-170) (human); H-Tyr-Leu-Leu-Gly-Asp-Phe-Phe-Arg-Lys-Ser-Lys-Glu-Lys-Ile-Gly-Lys-Glu-Phe-Lys-Arg-Ile-Val-Gln-Arg-Ile-Lys-Asp-Phe-Leu-Arg-Asn-Leu-Val-Pro-Arg-Thr-Glu-Ser-OH; Tyr-hCAP-18 (134-170). Grades: ≥95%. CAS No. 2022972-74-1. Molecular formula: C214H349N61O55. Mole weight: 4656.42. | |
| Tyr-met-glu-his-phe-arg-trp | Heterocyclic Organic Compound. Alternative Names: ADRENOCORTICOTROPIC HORMONE HUMAN TYR-FRAGMENT 4-9;H-TYR-MET-GLU-HIS-PHE-ARG-TRP-OH;TYR-ACTH (4-9);TYR-ADRENOCORTICOTROPIC HORMONE (4-9);TYR-MET-GLU-HIS-PHE-ARG-TRP;tyr-adrenocorticotropic hormone*fragment 4-9;adrenocorticotropic hormone tyr-fragment 4-9. CAS No. 129813-57-6. Molecular formula: C51H65N13O11S. Mole weight: 1068.21. Catalog: ACM129813576. | |
| Tyrocidine A | Tyrocidine A is a peptide antibiotic originally isolated from Bac. brevis. It is resistant to gram-positive bacteria and protozoa as well as to a lesser degree to gram-negative bacteria, and it is also resistant to yeast. Synonyms: TrcA; cyclo-(D-PheProPhe-D-PheAsnGlnTyrValOrnLeu); cyclo(L-asparaginyl-L-glutaminyl-L-tyrosyl-L-valyl-L-ornithyl-L-leucyl-D-phenylalanyl-L-prolyl-L-phenylalanyl-D-phenylalanyl). CAS No. 1481-70-5. Molecular formula: C66H87N13O13. Mole weight: 1270.47. | |
| Tyrocidine B hydrochloride | Tyrocidine B is a peptide antibiotic originally isolated from Bac. brevis. It is resistant to gram-positive bacteria and protozoa as well as to a lesser degree to gram-negative bacteria. Synonyms: Tyrocidine B, monohydrochloride; Cyclo(L-asparaginyl-L-glutaminyl-L-tyrosyl-L-valyl-L-ornithyl-L-leucyl-D-phenylalanyl-L-prolyl-L-tryptophyl-D-phenylalanyl), monohydrochloride. CAS No. 27805-48-7. Molecular formula: C68H89ClN14O13. Mole weight: 1345.97. | |
| Tyrocidine C | Tyrocidine C is a homodetic cyclic decapeptide, macrocyclic peptide, and antimicrobial peptide. It acts as an antimicrobial agent, metabolite, and bacterial metabolite. Synonyms: Cyclic tyrocidine C; Cyclo(L-asparaginyl-L-glutaminyl-L-tyrosyl-L-valyl-L-ornithyl-L-leucyl-D-phenylalanyl-L-prolyl-L-tryptophyl-D-tryptophyl); Pyrrolo[1, 2-a][1, 4, 7, 10, 13, 16, 19, 22, 25, 28]decaazacyclotriacontine, cyclic peptide deriv.; Tyrocidine A, 9-L-tryptophan-10-D-tryptophan-; Cyclo(L-tryptophyl-D-tryptophyl-L-asparaginyl-L-glutaminyl-L-tyrosyl-L-valyl-L-ornithyl-L-leucyl-D-phenylalanyl-L-prolyl); cyclo-(D-Phe-Pro-Trp-D-Trp-Asn-Gln-Tyr-Val-Orn-Leu). CAS No. 3252-29-7. Molecular formula: C70H89N15O13. Mole weight: 1348.55. | |
| Tyrocidine C hydrochloride | Tyrocidine C is a peptide antibiotic originally isolated from Bac. brevis. It is resistant to gram-positive bacteria and protozoa as well as to a lesser degree to gram-negative bacteria. Synonyms: Tyrocidine C, monohydrochloride; Cyclo(L-asparaginyl-L-glutaminyl-L-tyrosyl-L-valyl-L-ornithyl-L-leucyl-D-phenylalanyl-L-prolyl-L-tryptophyl-D-tryptophyl), monohydrochloride. CAS No. 28343-15-9. Molecular formula: C70H90ClN15O13. Mole weight: 1385.01. | |
| Tyrocidine complex | It is a mixture of eight cationic cyclic decapeptides antibiotic produced by bacillus brevis. It has a broad spectrum of antimicrobial activity against gram-positive and Gram-negative bacteria. Tyrocidine A is the major component of the tyrothricin complex which is used for treatment of topical infection. It acts by disturbing lipid bilayers of the bacterial cell membrane. Grades: >95% by HPLC. CAS No. 8011-61-8. Molecular formula: C66H87N13O13 (for Tyrocidine A). Mole weight: 1270.48 (for Tyrocidine A). | |
| Tyropanoate Sodium | Tyropanoate Sodium. Group: Biochemicals. Alternative Names: α-Ethyl-2,4,6-triiodo-3-[(1-oxobutyl)amino]-benzenepropanoic Acid Sodium Salt; α-Ethyl-2,4,6-triiodo-3-[(1-oxobutyl)amino]-benzenepropanoic Acid Monosodium Salt; 3-Butyramido-α-ethyl-2,4,6-triiodo-hydrocinnamic Acid Monosodium Salt; 3-Butyramido-α-ethyl-2,4,6-triiodo-Hydrocinnamic Acid Sodium Salt; Bilopac; Bilopaque; Lumopaque; NSC 107434; Sodium 3-Butyramido-α-ethyl-2,4,6-triiodohydrocinnamate; Sodium Tyropanoate; Tyropanoate; Win 8851-2; α-Ethyl- β - (2, 4, 6-triiodo-3-butyramidophenyl) propionic Acid Sodium Salt. Grades: Highly Purified. CAS No. 7246-21-1. Pack Sizes: 100g. Molecular Formula: C15H17I3NNaO3, Molecular Weight: 663. US Biological Life Sciences. | Worldwide |
| Tyropanoate Sodium-d5 | Tyropanoate Sodium-d5. Group: Biochemicals. Alternative Names: α-Ethyl-2,4,6-triiodo-3-[(1-oxobutyl)amino]-benzenepropanoic Acid Sodium Salt-d5; α-Ethyl-2,4,6-triiodo-3-[(1-oxobutyl)amino]-benzenepropanoic Acid Monosodium Salt-d5; 3-Butyramido-α-ethyl-2,4,6-triiodo-hydrocinnamic Acid Monosodium Salt-d5; 3-Butyramido-α-ethyl-2,4,6-triiodo-Hydrocinnamic Acid Sodium Salt-d5; Bilopac-d5; Bilopaque-d5; Lumopaque-d5; NSC 107434-d5; Sodium 3-Butyramido-α-ethyl-2,4,6-triiodohydrocinnamate-d5; Sodium Tyropanoate-d5; Tyropanoate-d5; Win 8851-2; α-Ethyl- β - (2, 4, 6-triiodo-3-butyramidophenyl) propionic Acid Sodium Salt-d5. Grades: Highly Purified. Pack Sizes: 1mg. Molecular Formula: C15H12D5I3NNaO3, Molecular Weight: 668.03. US Biological Life Sciences. | Worldwide |
| Tyropanoic Acid | Tyropanoic Acid. Group: Biochemicals. Alternative Names: 3-Butyramido-α-ethyl-2,4,6-triiodohydrocinnamic Acid, ; 3-(3-Butyrylamino-2,4,6-triiodophenyl)-2-ethylpropionic Acid; 3-Butyramido-α-ethyl-2,4,6-triiodohydrocinnamic Acid. Grades: Highly Purified. CAS No. 27293-82-9. Pack Sizes: 100mg. Molecular Formula: C16H20I3NO3, Molecular Weight: 655.049999999999. US Biological Life Sciences. | Worldwide |
| Tyropanoic Acid-d5 | Tyropanoic Acid-d5. Group: Biochemicals. Alternative Names: 3-Butyramido-α-ethyl-2,4,6-triiodohydrocinnamic Acid-d5; 3-(3-Butyrylamino-2,4,6-triiodophenyl)-2-ethylpropionic Acid-d5; 3-Butyramido-α-ethyl-2,4,6-triiodohydrocinnamic Acid-d5. Grades: Highly Purified. Pack Sizes: 1mg. Molecular Formula: C15H13D5I3NO3, Molecular Weight: 646.049999999999. US Biological Life Sciences. | Worldwide |
| Tyropeptin A | It is produced by the strain of Kitasatospora sp. MK993-dF2. Tyropeptin A inhibited CHT-L and T-L activity of 20S proteasome with IC50 of 0.10 and 1.5 μg/mL, respectively. Synonyms: Isovaleryl-L-tyrosyl-L-valyl-DL-tyrosinal. Molecular formula: C28H37N3O6. Mole weight: 511.61. | |
| Tyropeptin B | It is produced by the strain of Kitasatospora sp. MK993-dF2. The inhibitory activity of B against CHT-L and T-L of 20S proteasome was half that of A. Synonyms: n-butyryl-L-tyrosyl-L-leucyl-DL-tyrosynal. Molecular formula: C28H37N3O6. Mole weight: 511.61. | |
| Tyroserleutide | Tyroserleutide is a tripeptide consisting of tyrosine, serine, and leucine with potential antineoplastic activity. Although the mechanism of its antitumor activity has yet to be fully elucidated, tyroserleutide appears to inhibit the expression of ICAM-1 (CD54), a cell adhesion factor of the immunoglobulin (Ig) superfamily that plays an important role in the invasion, adhesion, and metastasis of tumor cells. In addition, this agent may influence the Ca2+/calmodulin pathway, inhibiting phosphatidylinositol 3 kinase (PI3K); PI3K is upregulated in tumor cells and is involved in cellular proliferation. Synonyms: Tyroserleutide; YSL; CMS 024. H-Tyr-Ser-Leu-OH; CMS024; CMS-024. CAS No. 138168-48-6. Molecular formula: C18H27N3O6. Mole weight: 381.43. | |
| tyrosinase | A type III copper protein found in a broad variety of bacteria, fungi, plants, insects, crustaceans, and mammals, which is involved in the synthesis of betalains and melanin. The enzyme, which is activated upon binding molecular oxygen, can catalyse both a monophenolase reaction cycle (reaction 1) or a diphenolase reaction cycle (reaction 2). During the monophenolase cycle, one of the bound oxygen atoms is transferred to a monophenol (such as L-tyrosine), generating an o-diphenol intermediate, which is subsequently oxidized to an o-quinone and released, along with a water molecule. The enzyme remains in an inactive deoxy state, and is restored to the active oxy state by the binding of a...oxidase; cresolase; monophenolase; tyrosine-dopa oxidase; monophenol monooxidase; monophenol dihydroxyphenylalanine:oxygen oxidoreductase; N-acetyl-6-hydroxytryptophan oxidase; monophenol, dihydroxy-L-phenylalanine oxygen oxidoreductase; o-diphenol:O2 oxidoreductase; phenol oxidase. Enzyme Commission Number: EC 1.14.18.1. CAS No. 9002-10-2. Tyrosinase. Storage: Store it at +4 ?C for short term. For long term storage, store it at -20 ?C?-80 ?C. Form: Liquid or lyophilized powder. EXWM-0963; tyrosinase; EC 1.14.18.1; 9002-10-2; monophenol monooxygenase; phenolase; monophenol oxidase; cresolase; monophenolase; tyrosine-dopa oxidase; monophenol monooxidase; monophenol dihydroxyphenylalanine | |
| Tyrosinase (146-156) | A peptide fragment of Tyrosinase. Tyrosinase is a rate-limiting enzyme for controlling the production of melanin. It is found inside melanosomes which are synthesized in the skin melanocytes. In humans, the tyrosinase enzyme is encoded by the TYR gene. | |
| Tyrosinase (206-214) (human) | Tyrosinase (206-214) (human), a tyrosinase epitope recognized by HLA-A24-restricted tumor-infiltrating lymphocytes (TIL), represents a reagent that can be used to generate melanoma-specific T cells for adoptive immunotherapy, as well as a peptide vaccine for patients with HLA-A24+ melanoma. Synonyms: H-Ala-Phe-Leu-Pro-Trp-His-Arg-Leu-Phe-OH; L-alanyl-L-phenylalanyl-L-leucyl-L-prolyl-L-tryptophyl-L-histidyl-L-arginyl-L-leucyl-L-phenylalanine; L-Alanyl-L-phenylalanyl-L-leucyl-L-prolyl-L-tryptophyl-L-histidyl-N5-(diaminomethylene)-L-ornithyl-L-leucyl-L-phenylalanine. Grades: ≥90%. CAS No. 166188-11-0. Molecular formula: C61H83N15O10. Mole weight: 1186.41. | |
| Tyrosinase (208-216) | A peptide fragment of Tyrosinase. Tyrosinase is a rate-limiting enzyme for controlling the production of melanin. It is found inside melanosomes which are synthesized in the skin melanocytes. In humans, the tyrosinase enzyme is encoded by the TYR gene. | |
| Tyrosinase (240-251) | Tyrosinase is a multi-copper enzyme which is widely distributed in different organisms and plays an important role in the melanogenesis and enzymatic browning. Grades: >95%. | |
| Tyrosinase-IN-12 | Non-competitive tyrosinase inhibitor (Tyrosinase-IN-12) is a potent, non-competitive tyrosinase inhibitor with an IC 50 value of 49.33 ± 2.64 μM and K i value of 31.25 ± 0.25 μM. Non-competitive tyrosinase inhibitor (Tyrosinase-IN-12) have the highest radical scavenging activity to reduce the production of reactive oxygen species ( ROS ) with an IC 50 value of 25.39 ± 0.77 μM. Non-competitive tyrosinase inhibitor (Tyrosinase-IN-12) can be used for anti-browning substances in the food and agricultural sectors [1]. Uses: Scientific research. Group: Signaling pathways. CAS No. 1860779-42-5. Pack Sizes: 5 mg; 10 mg. Product ID: HY-149404. | |
| Tyrosinase, Mushroom | Tyrosinase (EC 1.14.18.1) (Polyphenol oxidase) is a rate-limiting enzyme that controls the production of melanin and is encoded by TYR gene. Tyrosinase is mainly found in melanosomes synthesized by skin melanocytes [1]. Uses: Scientific research. Group: Signaling pathways. Alternative Names: Polyphenol oxidase. CAS No. 9002-10-2. Pack Sizes: 1 KU; 5 KU. Product ID: HY-125860. | |
| Tyrosinase precursor (1-9) | Tyrosinase precursor (1-9) is a 9-aa peptide. Tyrosinase is a multi-copper enzyme which is widely distributed in different organisms and plays an important role in the melanogenesis and enzymatic browning. | |
| Tyrosinase-related protein-2 (180-188) | Tyrosinase-related protein-2 (180-188) is amino acids 180 to 188 fragment of Tyrosinase-related protein-2. TRP2 peptide, also named L-dopachrome tautomerase, H-2KB or DCT, is an immunopotientor for Melanoma, Neoplasms and Glioma. | |
| tyrosine 2,3-aminomutase | Requires ATP. Group: Enzymes. Synonyms: tyrosine α,β-mutase. Enzyme Commission Number: EC 5.4.3.6. CAS No. 9073-38-5. Storage: Store it at +4 ?C for short term. For long term storage, store it at -20 ?C?-80 ?C. Form: Liquid or lyophilized powder. EXWM-5538; tyrosine 2,3-aminomutase; EC 5.4.3.6; 9073-38-5; tyrosine α,β-mutase. Cat No: EXWM-5538. | |
| tyrosine 3-monooxygenase | The active centre contains mononuclear iron(II). The enzyme is activated by phosphorylation, catalysed by EC 2.7.11.27, [acetyl-CoA carboxylase] kinase. The 4a-hydroxytetrahydrobiopterin formed can dehydrate to 6,7-dihydrobiopterin, both spontaneously and by the action of EC 4.2.1.96, 4a-hydroxytetrahydrobiopterin dehydratase. The 6,7-dihydrobiopterin can be enzymically reduced back to tetrahydrobiopterin, by EC 1.5.1.34 (6,7-dihydropteridine reductase), or slowly rearranges into the more stable compound 7,8-dihydrobiopterin. Group: Enzymes. Synonyms: L-tyrosine hydroxylase; tyrosine 3-hydroxylase; tyrosine hydroxylase. Enzyme Commission Number: EC 1.14.16.2. CAS No. 9036-22-0. Storage: Store it at +4 ?C for short term. For long term storage, store it at -20 ?C?-80 ?C. Form: Liquid or lyophilized powder. EXWM-0954; tyrosine 3-monooxygenase; EC 1.14.16.2; 9036-22-0; L-tyrosine hydroxylase; tyrosine 3-hydroxylase; tyrosine hydroxylase. Cat No: EXWM-0954. | |
| tyrosine ammonia-lyase | This enzyme is a member of the aromatic amino acid lyase family, other members of which are EC 4.3.1.3 (histidine ammonia-lyase), EC 4.3.1.24 (phenylalanine ammonia-lyase) and EC 4.3.1.25 (phenylalanine/tyrosine ammonia-lyase). The enzyme contains the cofactor 3,5-dihydro-5-methylidene-4H-imidazol-4-one (MIO), which is common to this family. This unique cofactor is formed autocatalytically by cyclization and dehydration of the three amino-acid residues alanine, serine and glycine. The enzyme is far more active with tyrosine than with phenylalanine as substrate, but the substrate specificity can be switched by mutation of a single amino acid (H89F) in the enzyme from the bacterium Rhodobacter sphaeroides. Group: Enzymes. Synonyms: TAL; tyrase; L-tyrosine ammonia-lyase. Enzyme Commission Number: EC 4.3.1.23. CAS No. 1030840-68-6. Storage: Store it at +4 ?C for short term. For long term storage, store it at -20 ?C?-80 ?C. Form: Liquid or lyophilized powder. EXWM-5283; tyrosine ammonia-lyase; EC 4.3.1.23; 1030840-68-6; TAL; tyrase; L-tyrosine ammonia-lyase. Cat No: EXWM-5283. | |
| tyrosine-arginine ligase | This enzyme belongs to the family of ligases, specifically those forming carbon-nitrogen bonds as acid-D-amino-acid ligases (peptide synthases). Group: Enzymes. Synonyms: tyrosyl-arginine synthase; kyotorphin synthase; kyotorphin-synthesizing enzyme; kyotorphin synthetase. Enzyme Commission Number: EC 6.3.2.24. CAS No. 116036-78-3. Storage: Store it at +4 ?C for short term. For long term storage, store it at -20 ?C?-80 ?C. Form: Liquid or lyophilized powder. EXWM-5742; tyrosine-arginine ligase; EC 6.3.2.24; 116036-78-3; tyrosyl-arginine synthase; kyotorphin synthase; kyotorphin-synthesizing enzyme; kyotorphin synthetase. Cat No: EXWM-5742. | |
| tyrosine decarboxylase | A pyridoxal-phosphate protein. The bacterial enzyme also acts on 3-hydroxytyrosine and, more slowly, on 3-hydroxyphenylalanine. Group: Enzymes. Synonyms: L-tyrosine decarboxylase; L-(-)-tyrosine apodecarboxylase; L-tyrosine carboxy-lyase. Enzyme Commission Number: EC 4.1.1.25. CAS No. 9002-9-9. L-Tyrosine Decarboxylase. Storage: Store it at +4 ?C for short term. For long term storage, store it at -20 ?C?-80 ?C. Form: Liquid or lyophilized powder. EXWM-4770; tyrosine decarboxylase; EC 4.1.1.25; 9002-09-9; L-tyrosine decarboxylase; L-(-)-tyrosine apodecarboxylase; L-tyrosine carboxy-lyase. Cat No: EXWM-4770. | |
| Tyrosine decarboxylase, Microorganism | Tyrosine decarboxylase, Microorganism (TDC) widely exists in plants, insects and different microorganisms, and is often used in biochemical research. Tyrosine decarboxylase is a pyridoxal 5'-phosphate (PLP)-dependent decarboxylase that catalyzes the removal of carboxyl groups from tyrosine to produce tyramine and carbon dioxide [1]. Uses: Scientific research. Group: Signaling pathways. Alternative Names: TDC; TyrDC. CAS No. 9002-9-9. Pack Sizes: 25 U. Product ID: HY-P2825. | |
Our database is helping our users find suppliers everyday.
