A directory of where to buy chemicals in the USA, including: distributors, industrial manufacturers, bulk supplies and wholesalers of raw ingredients & finished goods.
100g Pack Size. Group: Building Blocks, Inorganic Chemicals. Formula: PBr3. CAS No. 7789-60-8. Prepack ID 84048251-100g. Molecular Weight 270.69. See USA prepack pricing.
Phosphorus tribromide
25g Pack Size. Group: Building Blocks, Inorganic Chemicals. Formula: PBr3. CAS No. 7789-60-8. Prepack ID 84048251-25g. Molecular Weight 270.69. See USA prepack pricing.
Phosphorus Tribromide
Used in tests for skin corrosivity. Group: Biochemicals. Alternative Names: Phosphorus Bromide; Phosphorous Bromide; Tribromophosphine. Grades: Highly Purified. CAS No. 7789-60-8. Pack Sizes: 5g, 10g, 25g, 50g. Molecular Formula: Br3P, Molecular Formula: Br3P. US Biological Life Sciences.
Worldwide
Phosphorus trichloride
Phosphorus trichloride. CAS No: 7719-12-2.
Sarchem Laboratories New Jersey NJ
Phosphorus (V) Chloride
Phosphorus (V) Chloride. Grades: 99.999% Extremely High (>=99%). CAS No. 10026-13-8. Pack Sizes: Gram Quantities: 25 gm , 100 gm. Order Number: 2851.
www.prochemonline.com
Phosphorus (V) Oxide
Phosphorus (V) Oxide. Grades: 99.998% Extremely High (>=99%). CAS No. 1314-56-3. Pack Sizes: Gram Quantities: 100 gm, 500 gm. Order Number: 2857.
www.prochemonline.com
Phosphorus(V) Oxychloride
High purity Phosphorus(V) Oxychloride is used as an n-type dopant in the semiconductor industry for applications such as solar cell fabrication. Group: Biochemicals. Grades: Highly Purified. CAS No. 10025-87-3. Pack Sizes: 5g, 25g. Molecular Formula: Cl3OP, Molecular Weight: 153.33. US Biological Life Sciences.
Phosphorylase b from rabbit muscle. Uses: Designed for use in research and industrial production. Additional or Alternative Names: α-Glucan Phosphorylase. Appearance: Powder. CAS No. 9012-69-5. Product ID: ACM9012695-1. Alfa Chemistry ISO 9001:2015 Certified.
phosphorylase kinase
Requires Ca2+ and calmodulin for activity. The enzyme phosphorylates a specific serine residue in each of the subunits of the dimeric phosphorylase b. For muscle phosphorylase but not liver phosphorylase, this is accompaniedby a further dimerization to form a tetrameric phosphorylase. The enzyme couples muscle contraction with energy production via glycogenolysis-glycolysis by catalysing the Ca2+-dependent phosphorylation and activation of glycogen phosphorylase b. The γ subunit of the tetramericenzyme is the catalytic subunit. Group: Enzymes. Synonyms: dephosphophosphorylase kinase; glycogen phosphorylase kinase; PHK; phosphorylase b kinase; phosphorylase B kinase; phosphorylase kinase (phosphorylating); STK17. Enzyme Commission Number: EC 2.7.11.19. CAS No. 9001-88-1. Storage: Store it at +4 ?C for short term. For long term storage, store it at -20 ?C?-80 ?C. Form: Liquid or lyophilized powder. EXWM-3138; phosphorylase kinase; EC 2.7.11.19; 9001-88-1; dephosphophosphorylase kinase; glycogen phosphorylase kinase; PHK; phosphorylase b kinase; phosphorylase B kinase; phosphorylase kinase (phosphorylating); STK17. Cat No: EXWM-3138.
Phosphorylase kinase
Phosphorylase kinase (PhK) is a biochemical reagent that can be used as a biological material or organic compound for life science related research. Uses: Scientific research. Group: Signaling pathways. Alternative Names: PhK. CAS No. 9001-88-1. Pack Sizes: 500 U; 1000 U. Product ID: HY-P2757.
Phosphorylase Kinase β-Subunit Fragment 420-436
It is the β-subunit fragment (peptide 430-436) of phosphorylase kinase. Phosphokinase is a serine/threonine specific protein kinase that activates glycogen phosphorylase to release glucose-1-phosphate from glycogen. Synonyms: Lys-Arg-Asn-Pro-Gly-Ser-Gln-Lys-Arg-Phe-Pro-Ser-Asn-Cys-Gly-Arg-Asp; L-lysyl-L-arginyl-L-asparagyl-L-prolyl-glycyl-L-seryl-L-glutaminyl-L-lysyl-L-arginyl-L-phenylalanyl-L-prolyl-L-seryl-L-asparagyl-L-cysteinyl-glycyl-L-arginyl-L-aspartic acid; Phosphorylase Kinase b-Subunit Fragment (420-436). Grades: ≥95%. CAS No. 150829-21-3. Molecular formula: C79H131N31O25S. Mole weight: 1947.14.
Phosphorylcholine
Phosphatidylcholine is the main phospholipid component in eukaryotic biofilms. Phosphatidylcholine exists in commensal or pathogenic bacteria associated with eukaryotes in prokaryotes. Phosphorylcholine exhibits a surprising range of immunomodulatory properties [1]. Uses: Scientific research. Group: Natural products. Alternative Names: Phosphocholine. CAS No. 3616-4-4. Pack Sizes: 10 mM * 1 mL; 100 mg; 500 mg. Product ID: HY-B2233B.
Phosphorylcholine
Phosphorylcholine. Uses: Designed for use in research and industrial production. Additional or Alternative Names: Choline phosphate; N-Trimethyl-2-aminoethylphosphonate; o-Phosphocholine; phosphorylcholine; O-Phosphonocholine; O-phosphoryl choline. Appearance: White powder or crystalline powder. CAS No. 107-73-3. Molecular formula: C5H15ClNO4P. Mole weight: 219.6. Purity: 97%+. IUPACName: phosphocholine. Product ID: ACM107733. Alfa Chemistry ISO 9001:2015 Certified.
Phosphorylcholine chloride
Phosphorylcholine chloride (Phosphocholine chloride) is an antigenic cell-surface component found on many commensal and pathogenic bacteria that reside in the upper airway. Uses: Scientific research. Group: Natural products. Alternative Names: Phosphocholine chloride. CAS No. 107-73-3. Pack Sizes: 10 mM * 1 mL; 500 mg. Product ID: HY-B2233.
Phosphorylethanolamine is used in the synthesis of Sphingomyelin, a type of sphingolipid found in animal cell membrane. Phosphorylethanolamine participates in phospholipid metabolism. Its release can be stimulated occasionally by depolarizing stimuli. Reduction of phosphorylethanolamine levels has been observed in Alzheimer?s and Huntington?s disease. Group: Biochemicals. Alternative Names: 2-Aminoethanol 1-(Dihydrogen Phosphate); 2-Aminoethanol Dihydrogen Phosphate Ester; 2-Aminoethanol Phosphate; Phosphoric Acid 2-Aminoethyl Ester; 2-Aminoethanol O-Phosphate; 2-Aminoethyl Dihydrogen Phosphate; Colamine phosphate; Ethanolamine O-Phosphate; Mono(2-aminoethyl) phosphate; Monoaminoethyl Phosphate; NSC 254167; O-Phosphoethanolamine; O-Phosphoryl ethanolamine; Phosphoethanolamine; Phosphonoethanolamine. Grades: Highly Purified. CAS No. 1071-23-4. Pack Sizes: 10g, 25g. Molecular Formula: C2H8NO4P, Molecular Weight: 141.06. US Biological Life Sciences.
Worldwide
Phosphorylethanolamine
Phosphorylethanolamine (Monoaminoethyl phosphate) is a membrane phospholipid and an important precursor of Phosphatidylcholine (HY-B2233B). It is found in most animal tissues and various human extracranial tumors, playing a critical role in membrane integrity, cell division, mitochondrial respiratory function, and more. Studies have shown that changes in the abundance of Phosphorylethanolamine are associated with Alzheimer's disease and Parkinson's disease. Lowering the ratio of Phosphorylethanolamine to Phosphatidylcholine in the liver can improve insulin signaling. Phosphorylethanolamine holds promise for research in the fields of cancer, neurodegenerative disorders, and metabolic diseases [1] [2] [3] [4] [5]. Uses: Scientific research. Group: Natural products. Alternative Names: Monoaminoethyl phosphate; NSC 254167; O-Phosphoethanolamine. CAS No. 1071-23-4. Pack Sizes: 10 mM * 1 mL; 5 g. Product ID: HY-N5034.
Phosphorylethanolamine-d4
Labeled analogue of Phosphoryl ethanolamine. Phosphorylethanolamine is used in the synthesis of Sphingomyelin, a type of sphingolipid found in animal cell membrane. Group: Biochemicals. Alternative Names: 2-Aminoethanol-d4 1-(Dihydrogen Phosphate); 2-Aminoethanol-d4 Dihydrogen Phosphate Ester; 2-Aminoethanol-d4 Phosphate; Phosphoric Acid 2-Aminoethy-d4 Ester; 2-Aminoethanol-d4 O-Phosphate2-Aminoethyl-d4 Dihydrogen Phosphate; Colamine phosphate; Ethanolamine-d4 O-Phosphate; Mono(2-aminoethyl-d4) phosphate; Monoaminoethyl-d4 Phosphate; NSC 254167-d4; O-Phosphoethanolamine-d4; O-Phosphorylethanolamine-d4; Phosphoethanolamine-d4; Phosphonoethanolamine-d4. Grades: Highly Purified. CAS No. 1169692-38-9. Pack Sizes: 1mg. US Biological Life Sciences.
This enzyme belongs to the family of hydrolases, specifically those acting on phosphoric monoester bonds. The systematic name of this enzyme class is O-phosphoserine phosphohydrolase. This enzyme participates in glycine, serine and threonine metabolism. Group: Enzymes. Enzyme Commission Number: EC 3.1.3.3. CAS No. 9025-73-4. PSP. Storage: Store it at +4 ?C for short term. For long term storage, store it at -20 ?C?-80 ?C. Form: Liquid or lyophilized powder. EXWM-3633; phosphoserine phosphatase; EC 3.1.3.3; 9025-73-4. Cat No: EXWM-3633.
Phosphoserine Phosphatase from Human, Recombinant
Human Phosphoserine phosphatase (hPSP) is an important enzyme in the phosphorylated pathway of serine biosynthesis, which contributes a major portion of the endogenous L-serine. Similar to known L-3-phosphoserine phosphatases, it catalyzed the Mg2+-dependent hydrolysis of L-phosphoserine and an exchange reaction between L-serine and L-phosphoserine. Recently, its complex structures reveal that the open-closed environmental change of the active site, generated-helical bundle domain, is important to substrate by local rearrangement of the recognition and hydrolysis. Phosphoserine phosphatase human recombinant produced in e. coli is a single, non-glycosylated polypeptid...3-phosphoserine phosphatase; PSPH. Enzyme Commission Number: EC 3.1.3.3. CAS No. 9025-73-4. Purity: Greater than 95.0% as determined by (a) Analysis by RP-HPLC. (b) Analysis by SDS-PAGE. PSP. Mole weight: 25 kDa. Stability: Store at 4°C if entire vial will be used within 2-4 weeks. Store, frozen at -20°C for longer periods of time. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA). Avoid multiple freeze-thaw cycles. Appearance: Sterile filtered colorless solution. Source: E. coli. Species: Human. Phosphoserine phosphatase; EC 3.1.3.3; PSP; O-phosphoserine phosphohydrolase; PSPase; L-3-phosphoserine phosphatase; PSPH. Cat No: NATE-0911.
Phosphoserine / Phosphothreonine, Positive Control
Positive control for P4076-17, P4077-15 or P4076-22. Group: Molecular Biology. Pack Sizes: 150ul. US Biological Life Sciences.
Worldwide
phosphoserine transaminase
A pyridoxal-phosphate protein. This enzyme catalyses the second step in the phosphorylated pathway of serine biosynthesis in Escherichia coli. It also catalyses the third step in the biosynthesis of the coenzyme pyridoxal 5'-phosphate in Escherichia coli (using Reaction 2 above). In Escherichia coli, pyridoxal 5'-phosphate is synthesized de novo by a pathway that involves EC 1.2.1.72 (erythrose-4-phosphate dehydrogenase), EC 1.1.1.290 (4-phosphoerythronate dehydrogenase), EC 2.6.1.52 (phosphoserine transaminase), EC 1.1.1.262 (4-hydroxythreonine-4-phosphate dehydrogenase), EC 2.6.99.2 (pyridoxine 5'-phosphate synthase) and EC 1.4.3.5 (with pyridoxine 5'-phosphate as substrate). ...ransaminase; 3-O-phospho-L-serine:2-oxoglutarate aminotransferase; SerC; PdxC; 3PHP transaminase. Enzyme Commission Number: EC 2.6.1.52. CAS No. 9030-90-4. Storage: Store it at +4 ?C for short term. For long term storage, store it at -20 ?C?-80 ?C. Form: Liquid or lyophilized powder. EXWM-2894; phosphoserine transaminase; EC 2.6.1.52; 9030-90-4; PSAT; phosphoserine aminotransferase; 3-phosphoserine aminotransferase; hydroxypyruvic phosphate-glutamic transaminase; L-phosphoserine aminotransferase; phosphohydroxypyruvate transaminase; phosphohydroxypyruvic-glutamic transaminase; 3-O-phospho-L-serine:2-oxoglutarate aminotransferase; SerC; PdxC; 3PHP transaminase. Cat No: EXWM-2894.
phosphosulfolactate synthase
Requires Mg2+. The enzyme from the archaeon Methanococcus jannaschii catalyses the Michael addition of sulfite to phosphoenolpyruvate. It specifically requires phosphoenolpyruvate and its broad alkaline pH optimum suggests that it uses sulfite rather than hydrogensulfite. Group: Enzymes. Synonyms: (2R)-phospho-3-sulfolactate synthase; (2R)-O-phospho-3-sulfolactate sulfo-lyase. Enzyme Commission Number: EC 4.4.1.19. CAS No. 473575-53-0. Storage: Store it at +4 ?C for short term. For long term storage, store it at -20 ?C?-80 ?C. Form: Liquid or lyophilized powder. EXWM-5320; phosphosulfolactate synthase; EC 4.4.1.19; 473575-53-0; (2R)-phospho-3-sulfolactate synthase; (2R)-O-phospho-3-sulfolactate sulfo-lyase. Cat No: EXWM-5320.
Phosphotrienin (Fostriecin, Antibiotic CI 920, Antibiotic CL 1565A, Antibiotic PD 110161, NSC 339638), Sodium Salt
Fostriecin is the most fully characterized member of a family of phosphate esters of a triene antibiotic. The antitumor potential of fostriecin has attracted considerable interest, focused on its mode of action as a topoisomerase II inhibitor. Subsequent research has focused on this metabolite's selective inhibition of protein phosphatase PP2A. Group: Biochemicals. Alternative Names: Fostriecin, Phosphotrienin, Antibiotic CI 920, Antibiotic CL 1565A,Antibiotic PD 110161, NSC 339638. Grades: Highly Purified. CAS No. 87810-56-8. Pack Sizes: 100ug. US Biological Life Sciences.
Worldwide
Phosphotungstic acid
Phosphotungstic acid. Group: Biochemicals. Alternative Names: Tungstophosphoric acid. Grades: Highly Purified. CAS No. 1343-93-7. Pack Sizes: 25g, 50g, 100g, 250g, 500g. Molecular Formula: H3O40PW12·xH2O. US Biological Life Sciences.
Worldwide
Phosphotungstic Acid
Phosphotungstic Acid. Group: other nano materials. CAS No. 12501-23-4. Molecular formula: 2880.05 g/mol. Mole weight: H3[P(W3O10)4] xH2O. 99%.
Phosphotungstic Acid
Phosphotungstic Acid. CAS No. 12501-23-4. Molecular Formula H3PO4 * 12WO3 * x H2O. Chemical Reagents
100g Pack Size. Group: Building Blocks, Inorganic Chemicals. Formula: H3O40PW12 · xH2O. CAS No. 12501-23-4. Prepack ID 46336733-100g. Molecular Weight 2880.05. See USA prepack pricing.
Phosphotungstic acid hydrate
Phosphotungstic acid hydrate. Group: Biochemicals. Grades: Reagent Grade. CAS No. 12501-23-4. Pack Sizes: 100g, 250g, 25g, 1Kg, 5Kg. US Biological Life Sciences.
Photinus (firefly) is a bioluminescent insect. The first step in the reaction is the formation of an acid anhydride between the carboxylic group and AMP, with the release of diphosphate. The enzyme may be assayed by measurement of light emission. Group: Enzymes. Synonyms: firefly luciferase; luciferase (firefly luciferin); Photinus luciferin 4-monooxygenase (adenosine triphosphate-hydrolyzing); firefly luciferin luciferase; Photinus pyralis luciferase. Enzyme Commission Number: EC 1.13.12.7. CAS No. 61970-00-1. Luciferase. Storage: Store it at +4 ?C for short term. For long term storage, store it at -20 ?C?-80 ?C. Form: Liquid or lyophilized powder. EXWM-0620; Photinus-luciferin 4-monooxygenase (ATP-hydrolysing); EC 1.13.12.7; 61970-00-1; firefly luciferase; luciferase (firefly luciferin); Photinus luciferin 4-monooxygenase (adenosine triphosphate-hydrolyzing); firefly luciferin luciferase; Photinus pyralis luciferase. Cat No: EXWM-0620.
Photobiotin acetate
Photobiotin acetate. Uses: Designed for use in research and industrial production. Additional or Alternative Names: Photobiotin acetate salt, Biotin {3-[3-(4-azido-2-nitroanilino)-N-methylpropylamino]propylamide} acetate salt, 96087-38-6, A1935_SIGMA, CTK8G2402, BIP0695, AG-H-94850, N-(4-Azido-2-nitrophenyl)-N inverted exclamation marka-(3-biotinylaminopropyl)-N inverted exclamation marka-methyl-1,3-propanediamine acetate salt, N-(4-Azido-2-nitrophenyl)-N-(3-biotinylaminopropyl)-N-methyl-1,3-propanediamine acetate salt. Product Category: Heterocyclic Organic Compound. CAS No. 96087-38-6. Molecular formula: C25H39N9O6S. Mole weight: 593.7. Purity: 0.96. IUPACName: 5-[(3aS,4S,6aR)-2-oxo-1,3,3a,4,6,6a-hexahydrothieno[3,4-d]imidazol-4-yl]-N-[3-[3-(4-azido-2-nitroanilino)propyl-methylamino]propyl]pentanamide;acetic acid. Product ID: ACM96087386. Alfa Chemistry ISO 9001:2015 Certified.
Photobiotin acetate salt
For labeling DNA probes for hybridizations. Group: Fluorescence/luminescence spectroscopy.
Photochlor
Photochlor, also known as HTTP, is a lipophilic, second-generation, chlorin-based photosensitizer. Upon intravenous administration, HPPH selectively accumulates in the cytoplasm of cancer or pre-cancerous cells. When laser light is applied, a photodynamic reaction between HPPH and oxygen occurs, resulting in the production of cytotoxic free radicals and singlet oxygen and free radical-mediated cell death. Compared to the first-generation photosensitizer porfimer sodium, HPPH shows improved pharmacokinetic properties and causes only mild skin photosensitivity which declines rapidly within a few days after administration. Synonyms: HPPH; 2-(1-Hexyloxyethyl)-2-devinyl pyropheophorbide-a; 14-Ethyl-9-(1-(hexyloxy)ethyl)-4,8,13,18-tetramethyl-20-oxo-3-phorbinepropanoic acid. Grades: >98%. CAS No. 149402-51-7. Molecular formula: C39H48N4O4. Mole weight: 636.83.
Photochromic Ion Channel Blocker, QAQ (2, 2- ( (diazene-1, 2-diylbis (4, 1-phenylene))bis (azanediyl))bis (N, N, N-triethyl-2-oxoethanaminium) formate, Quaternary Ammonium-Azobenzene-Quaternary Ammonium)
A membrane-impermeant Na+, K+, and Ca2+ channel blocker that is structurally composed of two azo-linked QX-314 type quaternary amines. Both QX-314 and QAQ are shown to selectively target excitability of nociceptor neurons via TRPV1-dependent cellular uptake. Unlike QX-314, the channel blocking activity of QAQ can be quickly switched on and off via optical cis-to-trans (500nM) and trans-to-cis (320nM) isomerization. Its efficacy as a pain-selective, photochromic anesthetic has been demonstrated in rats in vivo. QAQ cellular uptake can also be achieved by ATP-activated P2X7 receptor. Group: Biochemicals. Grades: Highly Purified. Pack Sizes: 10mg. US Biological Life Sciences.
Photoinitiator - Surface Coatings. SUPPLIERS TO BUSINESS CUSTOMERS ONLY.
North America & APAC
Photomirex
A toxic metabolite of Mirex. A photodegradaton product of the insecticide Mirex, is an environmental contaminant that has been identified in Great Lakes fish, soil, and human adipose tissue. Group: Biochemicals. Alternative Names: 1, 1a, 2, 2, 3, 3a, 4, 5, 5, 5a, 5b-Undecachlorooctahydro-. Grades: Highly Purified. CAS No. 39801-14-4. Pack Sizes: 5mg. US Biological Life Sciences.
Photoswitchable PAD inhibitor is a photoactivated inhibitor of protein arginine deiminase (PAD), which plays a role in the pathogenesis of various diseases, including rheumatoid arthritis, multiple sclerosis, lupus, ulcerative colitis, and breast cancer. Synonyms: Photoswitchable PAD inhibitor; 2226393-62-8; N-[(1S)-4-[(1-amino-2-chloroethylidene)amino]-1-(1H-benzimidazol-2-yl)butyl]-4-phenyldiazenylbenzamide; N-[(1S)-1-(1H-benzimidazol-2-yl)-4-[(2-chloro-1-iminoethyl)amino]butyl]-4-(2-phenyldiazenyl)-benzamide; AKOS040754853; PD121672; Photoswitchable PAD Inhibitor (technical grade). CAS No. 2226393-62-8. Molecular formula: C26H26ClN7O. Mole weight: 487.98.
photosystem I
Contains chlorophyll, phylloquinones, carotenoids and [4Fe-4S] clusters.Cytochrome c6 can act as an alternative electron donor, and flavodoxin as an alternative acceptor in some species. Group: Enzymes. Enzyme Commission Number: EC 1.97.1.12. Storage: Store it at +4 ?C for short term. For long term storage, store it at -20 ?C?-80 ?C. Form: Liquid or lyophilized powder. EXWM-1691; photosystem I; EC 1.97.1.12. Cat No: EXWM-1691.
photosystem II
Contains chlorophyll a, β-carotene, pheophytin, plastoquinone, a Mn4Ca cluster, heme and non-heme iron. Four successive photoreactions, resulting in a storage of four positive charges, are required to oxidize two water molecules to one oxygen molecule. Group: Enzymes. Enzyme Commission Number: EC 1.10.3.9. Storage: Store it at +4 ?C for short term. For long term storage, store it at -20 ?C?-80 ?C. Form: Liquid or lyophilized powder. EXWM-0487; photosystem II; EC 1.10.3.9. Cat No: EXWM-0487.
Phoxim
Phoxim is an organic phosphorus pesticide and widely applies worldwide for agricultural purposes [1] [2]. Uses: Scientific research. Group: Signaling pathways. CAS No. 14816-18-3. Pack Sizes: 120 μg (335.23 μM * 1.2 mL in Methanol). Product ID: HY-B0819.
PHP 501 trifluoroacetate is potent GABAA antagonist (Ki = 0.0028 μM at rat GABAA receptors; IC50 = 0.024 μM at human α1β2γ2 GABAA-expressing tsA201 cells), without disrupting hGAT-1, hGAT-2, hGAT-3 or hBGT-1 GABA transporters. Synonyms: PHP 501 trifluoroacetate; PHP501 trifluoroacetate; PHP-501 trifluoroacetate; 4-(5-[1,1'-Biphenyl]-3-yl-1-hydroxy-1H-pyrazol-4-yl)piperidine trifluoroacetate. Grades: ≥98% by HPLC. CAS No. 1236105-75-1. Molecular formula: C20H21N3O.CF3CO2H. Mole weight: 433.42.
PHP 501 trifluoroacetate
PHP 501 trifluoroacetate. Group: Biochemicals. Grades: Purified. CAS No. 1236105-75-1. Pack Sizes: 10mg, 50mg. US Biological Life Sciences.
Worldwide
PHPS1
PHPS1 is a cell-permeable inhibitor of the protein tyrosine phosphatase Shp2, a positive modulator of growth factor signaling. It is selective for Shp2 over ECPTP, PTP1B, Shp1, and mycobacterium MptpA. Synonyms: Phenylhydrazonopyrazolone sulfonate 1; Protein Tyrosine Phosphatase Inhibitor V; PTP Inhibitor V; [4-[[5-[4-(nitromethyl)phenyl]-3-oxo-2-phenyl-1H-pyrazol-4-yl]diazenyl]phenyl]methanesulfonic acid. Grades: ≥98%. CAS No. 314291-83-3. Molecular formula: C21H15N5O6S. Mole weight: 465.4.
PHPS1
PHPS1 is an inhibitor of the protein tyrosine phosphatase Shp2. PHPS1 also efficiently inhibits activation of Erk1/2 by the leukemia-associated Shp2 mutant, Shp2-E76K, and blocks the anchorage-independent growth of a variety of human tumor cell lines. Uses: Designed for use in research and industrial production. Additional or Alternative Names: PHPS1; PHPS 1; PHPS-1. Product Category: Inhibitors. Appearance: Solid powder. CAS No. 314291-83-3. Molecular formula: C21H15N5O6S. Mole weight: 465.44. Purity: >98%. IUPACName: 4-[2-[1,5-dihydro-3-(4-nitrophenyl)-5-oxo-1-phenyl-4H-pyrazol-4-ylidene]hydrazinyl]-benzenesulfonic Acid. Canonical SMILES: O=S(C1=CC=C(N/N=C2C(C3=CC=C([N+]([O-])=O)C=C3)=NN(C4=CC=CC=C4)C\2=O)C=C1)(O)=O. Product ID: ACM314291833-1. Alfa Chemistry ISO 9001:2015 Certified.
PHPS1
PHPS1 is a potent and selective Shp2 inhibitor with K i s of 0.73, 5.8, 10.7, 5.8, and 0.47 μM for Shp2, Shp2-R362K, Shp1, PTP1B, and PTP1B-Q, respectively [1]. Uses: Scientific research. Group: Signaling pathways. CAS No. 314291-83-3. Pack Sizes: 10 mM * 1 mL; 5 mg; 10 mg; 25 mg; 50 mg; 100 mg. Product ID: HY-112368.
PHPS1 sodium
PHPS1 sodium is a potent and selective Shp2 inhibitor with K i s of 0.73, 5.8, 10.7, 5.8, and 0.47 μM for Shp2, Shp2-R362K, Shp1, PTP1B, and PTP1B-Q, respectively [1]. Uses: Scientific research. Group: Signaling pathways. CAS No. 1177131-02-0. Pack Sizes: 5 mg; 10 mg; 25 mg; 50 mg; 100 mg. Product ID: HY-125108.
PHPS1 sodium salt
PHPS1 is a cell-permeable inhibitor of the protein tyrosine phosphatase Shp2, a positive modulator of growth factor signaling. It is selective for Shp2 over ECPTP, PTP1B, Shp1, and mycobacterium MptpA. Synonyms: 4-[2-[1,5-Dihydro-3-(4-nitrophenyl)-5-oxo-1-phenyl-4H-pyrazol-4-ylidene]hydrazinyl]benzenesulfonic acid sodium salt. Grades: ≥98% by HPLC. Molecular formula: C21H14N5O6SNa. Mole weight: 487.42.
Phps1 sodium salt hydrate
Phps1 sodium salt hydrate. Uses: Designed for use in research and industrial production. Additional or Alternative Names: PTP Inhibitor V, PHPS1, CTK8E6636, 314291-83-3. Product Category: Heterocyclic Organic Compound. CAS No. 314291-83-3. Molecular formula: C21H14N5O6SNa.xH2O. Mole weight: 487.42 (anhydrous basis). Purity: 0.96. IUPACName: [4-[2-[3-[4-(nitromethyl)phenyl]-5-oxo-1-phenylpyrazol-4-ylidene]hydrazinyl]phenyl]methanesulfonic acid. Canonical SMILES: C1=CC=C(C=C1)N2C(=O)C(=NNC3=CC=C(C=C3)CS(=O)(=O)O)C(=N2)C4=CC=C(C=C4)C[N+](=O)[O-]. Product ID: ACM314291833. Alfa Chemistry ISO 9001:2015 Certified.
Phpy2. Uses: Designed for use in research and industrial production. Additional or Alternative Names: PHPY2;2-[PHENYL(PYRIDIN-2-YL)PHOSPHINO]PYRIDINE. Product Category: Heterocyclic Organic Compound. CAS No. 68469-71-6. Molecular formula: C16H13N2P. Product ID: ACM68469716. Alfa Chemistry ISO 9001:2015 Certified.
Phrixotoxin 3, a peptide toxin produced by the Chilean copper tarantula (Paraphysa scrofa), is a potent blocker of voltage-gated sodium channels (IC50= 0.6, 42, and 72 nM for NaV1.2, NaV1.3 and NaV1.5 respectively). Synonyms: 6-(phenylsulfinyl)-tetrazolo[1,5-b]pyridazine; DCLGFLWKCNPSNDKCCRPNLVCSRKDKWCKYQI. Grades: >99%. CAS No. 880886-00-0. Molecular formula: C176H269N51O48S6. Mole weight: 4059.74.
Phrixotoxin 3
Phrixotoxin 3. Group: Biochemicals. Grades: Purified. CAS No. 880886-00-0. Pack Sizes: 100ug. US Biological Life Sciences.
Worldwide
PHT 427
PHT 427. Group: Biochemicals. Grades: Purified. CAS No. 1191951-57-1. Pack Sizes: 10mg, 50mg. US Biological Life Sciences.