American Chemical Suppliers

A directory of where to buy chemicals in the USA, including: distributors, industrial manufacturers, bulk supplies and wholesalers of raw ingredients & finished goods.

Search for products or services, then visit the suppliers website for prices or more information.

Product
Phosphoryl Colamine Ethanolamine Phosphate; 2-Aminoethanol Dihydrogen Phosphate; Phosphoethanolamine; O Phosphorylethanolamine. CAS No. 1071-23-4. Product ID: 8-01583. Molecular formula: C2H8NO4P . Mole weight: 141.06 . Categories: PhosphorylColamine. CarboMer Inc
Phosphorylethanolamine Phosphorylethanolamine (Monoaminoethyl phosphate) is a membrane phospholipid and an important precursor of Phosphatidylcholine (HY-B2233B). It is found in most animal tissues and various human extracranial tumors, playing a critical role in membrane integrity, cell division, mitochondrial respiratory function, and more. Studies have shown that changes in the abundance of Phosphorylethanolamine are associated with Alzheimer's disease and Parkinson's disease. Lowering the ratio of Phosphorylethanolamine to Phosphatidylcholine in the liver can improve insulin signaling. Phosphorylethanolamine holds promise for research in the fields of cancer, neurodegenerative disorders, and metabolic diseases [1] [2] [3] [4] [5]. Uses: Scientific research. Group: Natural products. Alternative Names: Monoaminoethyl phosphate; NSC 254167; O-Phosphoethanolamine. CAS No. 1071-23-4. Pack Sizes: 10 mM * 1 mL; 5 g. Product ID: HY-N5034. MedChemExpress MCE
Phosphorylethanolamine Phosphorylethanolamine is used in the synthesis of Sphingomyelin, a type of sphingolipid found in animal cell membrane. Phosphorylethanolamine participates in phospholipid metabolism. Its release can be stimulated occasionally by depolarizing stimuli. Reduction of phosphorylethanolamine levels has been observed in Alzheimer?s and Huntington?s disease. Group: Biochemicals. Alternative Names: 2-Aminoethanol 1-(Dihydrogen Phosphate); 2-Aminoethanol Dihydrogen Phosphate Ester; 2-Aminoethanol Phosphate; Phosphoric Acid 2-Aminoethyl Ester; 2-Aminoethanol O-Phosphate; 2-Aminoethyl Dihydrogen Phosphate; Colamine phosphate; Ethanolamine O-Phosphate; Mono(2-aminoethyl) phosphate; Monoaminoethyl Phosphate; NSC 254167; O-Phosphoethanolamine; O-Phosphoryl ethanolamine; Phosphoethanolamine; Phosphonoethanolamine. Grades: Highly Purified. CAS No. 1071-23-4. Pack Sizes: 10g, 25g. Molecular Formula: C2H8NO4P, Molecular Weight: 141.06. US Biological Life Sciences. USBiological 2
Worldwide
Phosphorylethanolamine-d4 Labeled analogue of Phosphoryl ethanolamine. Phosphorylethanolamine is used in the synthesis of Sphingomyelin, a type of sphingolipid found in animal cell membrane. Group: Biochemicals. Alternative Names: 2-Aminoethanol-d4 1-(Dihydrogen Phosphate); 2-Aminoethanol-d4 Dihydrogen Phosphate Ester; 2-Aminoethanol-d4 Phosphate; Phosphoric Acid 2-Aminoethy-d4 Ester; 2-Aminoethanol-d4 O-Phosphate2-Aminoethyl-d4 Dihydrogen Phosphate; Colamine phosphate; Ethanolamine-d4 O-Phosphate; Mono(2-aminoethyl-d4) phosphate; Monoaminoethyl-d4 Phosphate; NSC 254167-d4; O-Phosphoethanolamine-d4; O-Phosphorylethanolamine-d4; Phosphoethanolamine-d4; Phosphonoethanolamine-d4. Grades: Highly Purified. CAS No. 1169692-38-9. Pack Sizes: 1mg. US Biological Life Sciences. USBiological 2
Worldwide
Phosphoserine-BSA 2 mg/mL, buffered aqueous solution. Group: Fluorescence/luminescence spectroscopy. Alfa Chemistry Analytical Products 2
phosphoserine phosphatase This enzyme belongs to the family of hydrolases, specifically those acting on phosphoric monoester bonds. The systematic name of this enzyme class is O-phosphoserine phosphohydrolase. This enzyme participates in glycine, serine and threonine metabolism. Group: Enzymes. Enzyme Commission Number: EC 3.1.3.3. CAS No. 9025-73-4. PSP. Storage: Store it at +4 ?C for short term. For long term storage, store it at -20 ?C?-80 ?C. Form: Liquid or lyophilized powder. EXWM-3633; phosphoserine phosphatase; EC 3.1.3.3; 9025-73-4. Cat No: EXWM-3633. Creative Enzymes
Phosphoserine Phosphatase from Human, Recombinant Human Phosphoserine phosphatase (hPSP) is an important enzyme in the phosphorylated pathway of serine biosynthesis, which contributes a major portion of the endogenous L-serine. Similar to known L-3-phosphoserine phosphatases, it catalyzed the Mg2+-dependent hydrolysis of L-phosphoserine and an exchange reaction between L-serine and L-phosphoserine. Recently, its complex structures reveal that the open-closed environmental change of the active site, generated-helical bundle domain, is important to substrate by local rearrangement of the recognition and hydrolysis. Phosphoserine phosphatase human recombinant produced in e. coli is a single, non-glycosylated polypeptid...3-phosphoserine phosphatase; PSPH. Enzyme Commission Number: EC 3.1.3.3. CAS No. 9025-73-4. Purity: Greater than 95.0% as determined by (a) Analysis by RP-HPLC. (b) Analysis by SDS-PAGE. PSP. Mole weight: 25 kDa. Stability: Store at 4°C if entire vial will be used within 2-4 weeks. Store, frozen at -20°C for longer periods of time. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA). Avoid multiple freeze-thaw cycles. Appearance: Sterile filtered colorless solution. Source: E. coli. Species: Human. Phosphoserine phosphatase; EC 3.1.3.3; PSP; O-phosphoserine phosphohydrolase; PSPase; L-3-phosphoserine phosphatase; PSPH. Cat No: NATE-0911. Creative Enzymes
Phosphoserine / Phosphothreonine, Positive Control Positive control for P4076-17, P4077-15 or P4076-22. Group: Molecular Biology. Pack Sizes: 150ul. US Biological Life Sciences. USBiological 1
Worldwide
phosphoserine transaminase A pyridoxal-phosphate protein. This enzyme catalyses the second step in the phosphorylated pathway of serine biosynthesis in Escherichia coli. It also catalyses the third step in the biosynthesis of the coenzyme pyridoxal 5'-phosphate in Escherichia coli (using Reaction 2 above). In Escherichia coli, pyridoxal 5'-phosphate is synthesized de novo by a pathway that involves EC 1.2.1.72 (erythrose-4-phosphate dehydrogenase), EC 1.1.1.290 (4-phosphoerythronate dehydrogenase), EC 2.6.1.52 (phosphoserine transaminase), EC 1.1.1.262 (4-hydroxythreonine-4-phosphate dehydrogenase), EC 2.6.99.2 (pyridoxine 5'-phosphate synthase) and EC 1.4.3.5 (with pyridoxine 5'-phosphate as substrate). ...ransaminase; 3-O-phospho-L-serine:2-oxoglutarate aminotransferase; SerC; PdxC; 3PHP transaminase. Enzyme Commission Number: EC 2.6.1.52. CAS No. 9030-90-4. Storage: Store it at +4 ?C for short term. For long term storage, store it at -20 ?C?-80 ?C. Form: Liquid or lyophilized powder. EXWM-2894; phosphoserine transaminase; EC 2.6.1.52; 9030-90-4; PSAT; phosphoserine aminotransferase; 3-phosphoserine aminotransferase; hydroxypyruvic phosphate-glutamic transaminase; L-phosphoserine aminotransferase; phosphohydroxypyruvate transaminase; phosphohydroxypyruvic-glutamic transaminase; 3-O-phospho-L-serine:2-oxoglutarate aminotransferase; SerC; PdxC; 3PHP transaminase. Cat No: EXWM-2894. Creative Enzymes
phosphosulfolactate synthase Requires Mg2+. The enzyme from the archaeon Methanococcus jannaschii catalyses the Michael addition of sulfite to phosphoenolpyruvate. It specifically requires phosphoenolpyruvate and its broad alkaline pH optimum suggests that it uses sulfite rather than hydrogensulfite. Group: Enzymes. Synonyms: (2R)-phospho-3-sulfolactate synthase; (2R)-O-phospho-3-sulfolactate sulfo-lyase. Enzyme Commission Number: EC 4.4.1.19. CAS No. 473575-53-0. Storage: Store it at +4 ?C for short term. For long term storage, store it at -20 ?C?-80 ?C. Form: Liquid or lyophilized powder. EXWM-5320; phosphosulfolactate synthase; EC 4.4.1.19; 473575-53-0; (2R)-phospho-3-sulfolactate synthase; (2R)-O-phospho-3-sulfolactate sulfo-lyase. Cat No: EXWM-5320. Creative Enzymes
Phosphothreonine-BSA 2 mg/mL, buffered aqueous solution. Group: Fluorescence/luminescence spectroscopy. Alfa Chemistry Analytical Products 2
Phosphotrienin (Fostriecin, Antibiotic CI 920, Antibiotic CL 1565A, Antibiotic PD 110161, NSC 339638), Sodium Salt Fostriecin is the most fully characterized member of a family of phosphate esters of a triene antibiotic. The antitumor potential of fostriecin has attracted considerable interest, focused on its mode of action as a topoisomerase II inhibitor. Subsequent research has focused on this metabolite's selective inhibition of protein phosphatase PP2A. Group: Biochemicals. Alternative Names: Fostriecin, Phosphotrienin, Antibiotic CI 920, Antibiotic CL 1565A,Antibiotic PD 110161, NSC 339638. Grades: Highly Purified. CAS No. 87810-56-8. Pack Sizes: 100ug. US Biological Life Sciences. USBiological 1
Worldwide
Phosphotungstic acid Phosphotungstic acid. Group: Biochemicals. Alternative Names: Tungstophosphoric acid. Grades: Highly Purified. CAS No. 1343-93-7. Pack Sizes: 25g, 50g, 100g, 250g, 500g. Molecular Formula: H3O40PW12·xH2O. US Biological Life Sciences. USBiological 8
Worldwide
Phosphotungstic Acid Phosphotungstic Acid. Grade: Reagent. CAS: 12067-99-1. Packing: Plastic Drums. Allan Chemical Corporation
New Jersey NJ
Phosphotungstic Acid PHOSPHOTUNGSTIC ACID, SODIUM SALT, HYDRATE, Reagent, crystal, (Synonym: Tungstophosphoric Acid, Sodium Salt, Hydrate), Formula: Na3PO4.12WO3.xH2O. CAS No. 51312-42-6. Noah Chemicals San Antonio, Texas. ISO 9001:2015 Certified. Request a Quote Today! Noah Chemicals
Texas TX
Phosphotungstic Acid Phosphotungstic Acid. Group: other nano materials. CAS No. 12501-23-4. Molecular formula: 2880.05 g/mol. Mole weight: H3[P(W3O10)4] xH2O. 99%. Alfa Chemistry Materials 2
Phosphotungstic Acid Phosphotungstic Acid. CAS No. 12501-23-4. Molecular Formula H3PO4 * 12WO3 * x H2O. Chemical Reagents Cater Chemicals Corp.
Cater Chemicals Corp. Illinois IL
Phosphotungstic Acid PHOSPHOTUNGSTIC ACID, HYDRATE, Reagent, crystal, (Synonym: Tungstophosphoric Acid, Hydrate), Formula: H3PO4.12WO3.xH2O. CAS No. 12067-99-1. Noah Chemicals San Antonio, Texas. ISO 9001:2015 Certified. Request a Quote Today! Noah Chemicals
Texas TX
Phosphotungstic acid, AR Phosphotungstic acid, AR. Group: Electronic chemicals. CAS No. 12501-23-4. Product ID: phosphoric acid; trioxotungsten; hydrate. Molecular formula: 2898g/mol. Mole weight: H5O41PW12. O. OP(=O)(O)O. O=[W](=O)=O. O=[W](=O)=O. O=[W](=O)=O. O=[W](=O)=O. O=[W](=O)=O. O=[W](=O)=O. O=[W](=O)=O. O=[W](=O)=O. O=[W](=O)=O. O=[W](=O)=O. O=[W](=O)=O. O=[W](=O)=O. InChI=1S/H3O4P.H2O.36O.12W/c1-5(2, 3)4; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; /h(H3, 1, 2, 3, 4); 1H2; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ;. AVFBYUADVDVJQL-UHFFFAOYSA-N. Alfa Chemistry Materials 5
Phosphotungstic acid hydrate Phosphotungstic acid hydrate. Group: Biochemicals. Grades: Reagent Grade. CAS No. 12501-23-4. Pack Sizes: 100g, 250g, 25g, 1Kg, 5Kg. US Biological Life Sciences. USBiological 5
Worldwide
Phosphotungstic acid hydrate Phosphotungstic acid hydrate. Group: Electronic materials. Alternative Names: 12-Tungstophosphoric acid hydrate. CAS No. 12501-23-4. Product ID: Phosphoric acid; trioxotungsten; hydrate. Molecular formula: 2898.1. Mole weight: H5O41PW12. O. OP(=O)(O)O. O=[W](=O)=O. O=[W](=O)=O. O=[W](=O)=O. O=[W](=O)=O. O=[W](=O)=O. O=[W](=O)=O. O=[W](=O)=O. O=[W](=O)=O. O=[W](=O)=O. O=[W](=O)=O. O=[W](=O)=O. O=[W](=O)=O. InChI=1S/H3O4P.H2O.36O.12W/c1-5(2, 3)4;/h(H3, 1, 2, 3, 4);1H2. AVFBYUADVDVJQL-UHFFFAOYSA-N. 99%+. Alfa Chemistry Materials 5
Phosphotungstic acid hydrate 100g Pack Size. Group: Building Blocks, Inorganic Chemicals. Formula: H3O40PW12 · xH2O. CAS No. 12501-23-4. Prepack ID 46336733-100g. Molecular Weight 2880.05. See USA prepack pricing. Molekula Americas
Phosphotungstic acid hydrate Phosphotungstic acid hydrate. Group: Electronic materials. Alternative Names: 12 TUNGSTO(VI) PHOSPHORIC ACID N-HYDRATE; 12 TUNGSTO(+6)PHOSPHORIC ACID N-HYDRATE; 12-TUNGSTOPHOSPHATE; 12-TUNGSTOPHOSPHORIC ACID HYDRATE; DODECA-TUNGSTOPHOSPHORIC ACID HYDRATE; PHOSPHOTUNGSTIC ACID HYDRATE; PHOSPHOTUNGSTIC ACID N-HYDRATE; PHOSPHOTUNGSTIC ACID. CAS No. 12501-23-4/12067-99-1. Molecular formula: 348.86. Mole weight: H6O8PW. Alfa Chemistry Materials 6
Phosphotungstic acid hydrate 99.995% trace metals basis (Purity excludes up to 300 ppm Si). Group: Electronic chemicals. Alfa Chemistry Analytical Products
Phosphotyrosine-BSA 2 mg/mL, buffered aqueous solution. Group: Fluorescence/luminescence spectroscopy. Alfa Chemistry Analytical Products 2
Phosphotyrosine Control, EGF-Stimulated A431 Cell Phosphotyrosine Control, EGF-Stimulated A431 Cell. Group: Biologicals. Grades: Lysate. Pack Sizes: 1mg. US Biological Life Sciences. USBiological 1
Worldwide
PhosTAC7 PhosTAC7 is a heterobifunctional molecule named as a Phosphorylation Targeting Chimera (PhosTAC). PhosTAC7 can dephosphorylate the PDCD4 protein, FOXO3a protein, and Tau protein by recruiting serine/threonine protein phosphatase 2A (PP2A). PhosTAC7 offers the advantage of selectively modulating the phosphorylation state of individual target proteins, making it a promising tool for research in cancer and tau protein-related neurodegenerative diseases[1][2]. Uses: Scientific research. Group: Signaling pathways. CAS No. 3016307-75-5. Pack Sizes: 10 mM * 1 mL; 1 mg; 5 mg; 10 mg; 25 mg; 50 mg. Product ID: HY-145232. MedChemExpress MCE
Photinus-luciferin 4-monooxygenase (ATP-hydrolysing) Photinus (firefly) is a bioluminescent insect. The first step in the reaction is the formation of an acid anhydride between the carboxylic group and AMP, with the release of diphosphate. The enzyme may be assayed by measurement of light emission. Group: Enzymes. Synonyms: firefly luciferase; luciferase (firefly luciferin); Photinus luciferin 4-monooxygenase (adenosine triphosphate-hydrolyzing); firefly luciferin luciferase; Photinus pyralis luciferase. Enzyme Commission Number: EC 1.13.12.7. CAS No. 61970-00-1. Luciferase. Storage: Store it at +4 ?C for short term. For long term storage, store it at -20 ?C?-80 ?C. Form: Liquid or lyophilized powder. EXWM-0620; Photinus-luciferin 4-monooxygenase (ATP-hydrolysing); EC 1.13.12.7; 61970-00-1; firefly luciferase; luciferase (firefly luciferin); Photinus luciferin 4-monooxygenase (adenosine triphosphate-hydrolyzing); firefly luciferin luciferase; Photinus pyralis luciferase. Cat No: EXWM-0620. Creative Enzymes
Photobiotin acetate Photobiotin acetate. Uses: Designed for use in research and industrial production. Additional or Alternative Names: Photobiotin acetate salt, Biotin {3-[3-(4-azido-2-nitroanilino)-N-methylpropylamino]propylamide} acetate salt, 96087-38-6, A1935_SIGMA, CTK8G2402, BIP0695, AG-H-94850, N-(4-Azido-2-nitrophenyl)-N inverted exclamation marka-(3-biotinylaminopropyl)-N inverted exclamation marka-methyl-1,3-propanediamine acetate salt, N-(4-Azido-2-nitrophenyl)-N-(3-biotinylaminopropyl)-N-methyl-1,3-propanediamine acetate salt. Product Category: Heterocyclic Organic Compound. CAS No. 96087-38-6. Molecular formula: C25H39N9O6S. Mole weight: 593.7. Purity: 0.96. IUPACName: 5-[(3aS,4S,6aR)-2-oxo-1,3,3a,4,6,6a-hexahydrothieno[3,4-d]imidazol-4-yl]-N-[3-[3-(4-azido-2-nitroanilino)propyl-methylamino]propyl]pentanamide;acetic acid. Product ID: ACM96087386. Alfa Chemistry — ISO 9001:2015 Certified. Alfa Chemistry. 5
Photobiotin acetate salt For labeling DNA probes for hybridizations. Group: Fluorescence/luminescence spectroscopy. Alfa Chemistry Analytical Products 3
Photochlor Photochlor, also known as HTTP, is a lipophilic, second-generation, chlorin-based photosensitizer. Upon intravenous administration, HPPH selectively accumulates in the cytoplasm of cancer or pre-cancerous cells. When laser light is applied, a photodynamic reaction between HPPH and oxygen occurs, resulting in the production of cytotoxic free radicals and singlet oxygen and free radical-mediated cell death. Compared to the first-generation photosensitizer porfimer sodium, HPPH shows improved pharmacokinetic properties and causes only mild skin photosensitivity which declines rapidly within a few days after administration. Synonyms: HPPH; 2-(1-Hexyloxyethyl)-2-devinyl pyropheophorbide-a; 14-Ethyl-9-(1-(hexyloxy)ethyl)-4,8,13,18-tetramethyl-20-oxo-3-phorbinepropanoic acid. Grades: >98%. CAS No. 149402-51-7. Molecular formula: C39H48N4O4. Mole weight: 636.83. BOC Sciences 11
Photochromic Ion Channel Blocker, QAQ (2, 2’- ( (diazene-1, 2-diylbis (4, 1-phenylene))bis (azanediyl))bis (N, N, N-triethyl-2-oxoethanaminium) formate, Quaternary Ammonium-Azobenzene-Quaternary Ammonium) A membrane-impermeant Na+, K+, and Ca2+ channel blocker that is structurally composed of two azo-linked QX-314 type quaternary amines. Both QX-314 and QAQ are shown to selectively target excitability of nociceptor neurons via TRPV1-dependent cellular uptake. Unlike QX-314, the channel blocking activity of QAQ can be quickly switched on and off via optical cis-to-trans (500nM) and trans-to-cis (320nM) isomerization. Its efficacy as a pain-selective, photochromic anesthetic has been demonstrated in rats in vivo. QAQ cellular uptake can also be achieved by ATP-activated P2X7 receptor. Group: Biochemicals. Grades: Highly Purified. Pack Sizes: 10mg. US Biological Life Sciences. USBiological 4
Worldwide
Photoinduced CuInS2(CIS)/ZnS Quantum Dots Photoinduced CuInS2(CIS)/ZnS Quantum Dots. Group: Photoinduced cuins2(cis)/zns quantum dots. Water. Alfa Chemistry Materials 7
Photoinitiator 947-19-3 Photoinitiator - Surface Coatings. SUPPLIERS TO BUSINESS CUSTOMERS ONLY. Redox
North America & APAC
Photomirex A toxic metabolite of Mirex. A photodegradaton product of the insecticide Mirex, is an environmental contaminant that has been identified in Great Lakes fish, soil, and human adipose tissue. Group: Biochemicals. Alternative Names: 1, 1a, 2, 2, 3, 3a, 4, 5, 5, 5a, 5b-Undecachlorooctahydro-. Grades: Highly Purified. CAS No. 39801-14-4. Pack Sizes: 5mg. US Biological Life Sciences. USBiological 2
Worldwide
Photoregulin3 ?98% (HPLC). Group: Fluorescence/luminescence spectroscopy. Alfa Chemistry Analytical Products 3
Photoswitchable PAD Inhibitor Photoswitchable PAD inhibitor is a photoactivated inhibitor of protein arginine deiminase (PAD), which plays a role in the pathogenesis of various diseases, including rheumatoid arthritis, multiple sclerosis, lupus, ulcerative colitis, and breast cancer. Synonyms: Photoswitchable PAD inhibitor; 2226393-62-8; N-[(1S)-4-[(1-amino-2-chloroethylidene)amino]-1-(1H-benzimidazol-2-yl)butyl]-4-phenyldiazenylbenzamide; N-[(1S)-1-(1H-benzimidazol-2-yl)-4-[(2-chloro-1-iminoethyl)amino]butyl]-4-(2-phenyldiazenyl)-benzamide; AKOS040754853; PD121672; Photoswitchable PAD Inhibitor (technical grade). CAS No. 2226393-62-8. Molecular formula: C26H26ClN7O. Mole weight: 487.98. BOC Sciences 9
photosystem I Contains chlorophyll, phylloquinones, carotenoids and [4Fe-4S] clusters.Cytochrome c6 can act as an alternative electron donor, and flavodoxin as an alternative acceptor in some species. Group: Enzymes. Enzyme Commission Number: EC 1.97.1.12. Storage: Store it at +4 ?C for short term. For long term storage, store it at -20 ?C?-80 ?C. Form: Liquid or lyophilized powder. EXWM-1691; photosystem I; EC 1.97.1.12. Cat No: EXWM-1691. Creative Enzymes
photosystem II Contains chlorophyll a, β-carotene, pheophytin, plastoquinone, a Mn4Ca cluster, heme and non-heme iron. Four successive photoreactions, resulting in a storage of four positive charges, are required to oxidize two water molecules to one oxygen molecule. Group: Enzymes. Enzyme Commission Number: EC 1.10.3.9. Storage: Store it at +4 ?C for short term. For long term storage, store it at -20 ?C?-80 ?C. Form: Liquid or lyophilized powder. EXWM-0487; photosystem II; EC 1.10.3.9. Cat No: EXWM-0487. Creative Enzymes
Phoxim O,O-diethyl α-cyanobenzylideneamino-oxyphosphonothioate. CAS No. 14816-18-3. Product ID: 8-01387. Molecular formula: C12H15N2O3PS. Mole weight: 298.3. CarboMer Inc
Phoxim Phoxim is an organic phosphorus pesticide and widely applies worldwide for agricultural purposes [1] [2]. Uses: Scientific research. Group: Signaling pathways. CAS No. 14816-18-3. Pack Sizes: 120 μg (335.23 μM * 1.2 mL in Methanol). Product ID: HY-B0819. MedChemExpress MCE
PHP 501 trifluoroacetate PHP 501 trifluoroacetate is potent GABAA antagonist (Ki = 0.0028 μM at rat GABAA receptors; IC50 = 0.024 μM at human α1β2γ2 GABAA-expressing tsA201 cells), without disrupting hGAT-1, hGAT-2, hGAT-3 or hBGT-1 GABA transporters. Synonyms: PHP 501 trifluoroacetate; PHP501 trifluoroacetate; PHP-501 trifluoroacetate; 4-(5-[1,1'-Biphenyl]-3-yl-1-hydroxy-1H-pyrazol-4-yl)piperidine trifluoroacetate. Grades: ≥98% by HPLC. CAS No. 1236105-75-1. Molecular formula: C20H21N3O.CF3CO2H. Mole weight: 433.42. BOC Sciences 10
PHP 501 trifluoroacetate PHP 501 trifluoroacetate. Group: Biochemicals. Grades: Purified. CAS No. 1236105-75-1. Pack Sizes: 10mg, 50mg. US Biological Life Sciences. USBiological 5
Worldwide
PhpC PhpC is a G-clamp analogue. PhpC shows antiproliferative activity against MCF7 cells, with an IC50 of 387.9 ?M. PhpC modulates G-quadruplex-RNA landscapes in human cells[1]. Uses: Scientific research. Group: Signaling pathways. Pack Sizes: 5 mg; 10 mg; 25 mg. Product ID: HY-164421. MedChemExpress MCE
PHPS1 PHPS1 is a potent and selective Shp2 inhibitor with K i s of 0.73, 5.8, 10.7, 5.8, and 0.47 μM for Shp2, Shp2-R362K, Shp1, PTP1B, and PTP1B-Q, respectively [1]. Uses: Scientific research. Group: Signaling pathways. CAS No. 314291-83-3. Pack Sizes: 10 mM * 1 mL; 5 mg; 10 mg; 25 mg; 50 mg; 100 mg. Product ID: HY-112368. MedChemExpress MCE
PHPS1 PHPS1 is a cell-permeable inhibitor of the protein tyrosine phosphatase Shp2, a positive modulator of growth factor signaling. It is selective for Shp2 over ECPTP, PTP1B, Shp1, and mycobacterium MptpA. Synonyms: Phenylhydrazonopyrazolone sulfonate 1; Protein Tyrosine Phosphatase Inhibitor V; PTP Inhibitor V; [4-[[5-[4-(nitromethyl)phenyl]-3-oxo-2-phenyl-1H-pyrazol-4-yl]diazenyl]phenyl]methanesulfonic acid. Grades: ≥98%. CAS No. 314291-83-3. Molecular formula: C21H15N5O6S. Mole weight: 465.4. BOC Sciences 9
PHPS1 PHPS1 is an inhibitor of the protein tyrosine phosphatase Shp2. PHPS1 also efficiently inhibits activation of Erk1/2 by the leukemia-associated Shp2 mutant, Shp2-E76K, and blocks the anchorage-independent growth of a variety of human tumor cell lines. Uses: Designed for use in research and industrial production. Additional or Alternative Names: PHPS1; PHPS 1; PHPS-1. Product Category: Inhibitors. Appearance: Solid powder. CAS No. 314291-83-3. Molecular formula: C21H15N5O6S. Mole weight: 465.44. Purity: >98%. IUPACName: 4-[2-[1,5-dihydro-3-(4-nitrophenyl)-5-oxo-1-phenyl-4H-pyrazol-4-ylidene]hydrazinyl]-benzenesulfonic Acid. Canonical SMILES: O=S(C1=CC=C(N/N=C2C(C3=CC=C([N+]([O-])=O)C=C3)=NN(C4=CC=CC=C4)C\2=O)C=C1)(O)=O. Product ID: ACM314291833-1. Alfa Chemistry — ISO 9001:2015 Certified. Alfa Chemistry.
PHPS1 sodium PHPS1 sodium is a potent and selective Shp2 inhibitor with K i s of 0.73, 5.8, 10.7, 5.8, and 0.47 μM for Shp2, Shp2-R362K, Shp1, PTP1B, and PTP1B-Q, respectively [1]. Uses: Scientific research. Group: Signaling pathways. CAS No. 1177131-02-0. Pack Sizes: 5 mg; 10 mg; 25 mg; 50 mg; 100 mg. Product ID: HY-125108. MedChemExpress MCE
PHPS1 sodium salt PHPS1 is a cell-permeable inhibitor of the protein tyrosine phosphatase Shp2, a positive modulator of growth factor signaling. It is selective for Shp2 over ECPTP, PTP1B, Shp1, and mycobacterium MptpA. Synonyms: 4-[2-[1,5-Dihydro-3-(4-nitrophenyl)-5-oxo-1-phenyl-4H-pyrazol-4-ylidene]hydrazinyl]benzenesulfonic acid sodium salt. Grades: ≥98% by HPLC. Molecular formula: C21H14N5O6SNa. Mole weight: 487.42. BOC Sciences 9
Phps1 sodium salt hydrate Phps1 sodium salt hydrate. Uses: Designed for use in research and industrial production. Additional or Alternative Names: PTP Inhibitor V, PHPS1, CTK8E6636, 314291-83-3. Product Category: Heterocyclic Organic Compound. CAS No. 314291-83-3. Molecular formula: C21H14N5O6SNa.xH2O. Mole weight: 487.42 (anhydrous basis). Purity: 0.96. IUPACName: [4-[2-[3-[4-(nitromethyl)phenyl]-5-oxo-1-phenylpyrazol-4-ylidene]hydrazinyl]phenyl]methanesulfonic acid. Canonical SMILES: C1=CC=C(C=C1)N2C(=O)C(=NNC3=CC=C(C=C3)CS(=O)(=O)O)C(=N2)C4=CC=C(C=C4)C[N+](=O)[O-]. Product ID: ACM314291833. Alfa Chemistry — ISO 9001:2015 Certified. Alfa Chemistry. 5
PHPS1 sodium salt hydrate ?98% (HPLC). Group: Fluorescence/luminescence spectroscopy. Alfa Chemistry Analytical Products
Phpy2 Phpy2. Uses: Designed for use in research and industrial production. Additional or Alternative Names: PHPY2;2-[PHENYL(PYRIDIN-2-YL)PHOSPHINO]PYRIDINE. Product Category: Heterocyclic Organic Compound. CAS No. 68469-71-6. Molecular formula: C16H13N2P. Product ID: ACM68469716. Alfa Chemistry — ISO 9001:2015 Certified. Alfa Chemistry. 5
Phrixotoxin-2 >98% (HPLC), lyophilized powder. Group: Fluorescence/luminescence spectroscopy. Alfa Chemistry Analytical Products 3
Phrixotoxin 3 Phrixotoxin 3. Group: Biochemicals. Grades: Purified. CAS No. 880886-00-0. Pack Sizes: 100ug. US Biological Life Sciences. USBiological 5
Worldwide
Phrixotoxin 3 Phrixotoxin 3, a peptide toxin produced by the Chilean copper tarantula (Paraphysa scrofa), is a potent blocker of voltage-gated sodium channels (IC50= 0.6, 42, and 72 nM for NaV1.2, NaV1.3 and NaV1.5 respectively). Synonyms: 6-(phenylsulfinyl)-tetrazolo[1,5-b]pyridazine; DCLGFLWKCNPSNDKCCRPNLVCSRKDKWCKYQI. Grades: >99%. CAS No. 880886-00-0. Molecular formula: C176H269N51O48S6. Mole weight: 4059.74. BOC Sciences 3
PHT 427 PHT 427. Group: Biochemicals. Grades: Purified. CAS No. 1191951-57-1. Pack Sizes: 10mg, 50mg. US Biological Life Sciences. USBiological 5
Worldwide
PHT-427 PHT-427 is an AKT inhibitor that inhibits AKT and PDPK1 at low micromolar concentrations in numerous cancer cell lines and exhibits good oral anti-tumor activity in mouse xenograft models. PHT-427 reduces the phosphorylation of AKT and PDPK1. Following the administration of a single oral dose of PHT-427 to mice bearing BxPC-3 human pancreatic tumor xenografts, PHT-427 inhibited the phosphorylation of both Akt and PDPK1 as well as downstream targets maximally at 8-12 h after administration corresponding to its peak plasma concentration, with PDPK1 inhibition extending to 24 hr. Anti-tumor activity was observed in a number of human tumor xenografts with in some cases complete cessation of tumor growth during administration of the compound and some tumor regressions observed. Mutational profiles indicate that EGFR and PIK3CA activiating mutations provide greatest sensitivity to PHT-427. Pre-clinical development of PHT-427 continues. Synonyms: PHT-427; PHT427; PHT 427. CAS No. 1191951-57-1. Molecular formula: C20H31N3O2S2. Mole weight: 409.60904. BOC Sciences 10
PHT-427 PHT-247 is an inhibitor of the pleckstrin homology (PH) domain of Akt , and it is also an inhibitor of PDPK1 with K i s of 2.7 μM and 5.2 μM and for Akt and PDPK1, respectively. Uses: Scientific research. Group: Signaling pathways. CAS No. 1191951-57-1. Pack Sizes: 10 mM * 1 mL; 5 mg; 10 mg; 50 mg; 100 mg; 200 mg. Product ID: HY-12063. MedChemExpress MCE
PhTD1 PhTD1 is an antimicrobial peptide found in Papio hamadryas (Hamadryas baboon), and has antibacterial and antifungal activity. Synonyms: PhTD-1; BTD 1; Baboon theta defensin 1; Cyclo(L-arginyl-L-cysteinyl-L-valyl-L-cysteinyl-arginyl-L-arginylglycyl-L-valyl-L-cysteinyl-L-arginyl-L-cysteinyl-L-valyl-L-cysteinyl-L-threonyl-rginylglycyl-L-phenylalanyl-cysteinyl), cyclic(2?11),(4?9),(13?18)-tris(disulfide); θ-Defensin 1 (Papio anubis); θ-Defensin 1 (Papio hamadryas); θ-Defensin 1 (baboon). Grades: >98%. CAS No. 1085365-19-0. Molecular formula: C80H133N33O19S6. Mole weight: 2053.51. BOC Sciences 4
PhTD3 PhTD3 is an antimicrobial peptide found in Papio hamadryas (Hamadryas baboon), and has antibacterial and antifungal activity. Synonyms: PhTD-3; BTD 3; Baboon theta defensin 3; Cyclo(L-arginyl-L-cysteinyl-L-valyl-L-cysteinyl-threonyl-L-arginylglycyl-L-phenylalanyl-L-cysteinyl-L-arginyl-L-cysteinyl-L-valyl-L-cysteinyl-L-threonyl-rginylglycyl-L-phenylalanyl-cysteinyl), cyclic(2?11),(4?9),(13?18)-tris(disulfide); θ-Defensin 3 (Papio anubis); θ-Defensin 3 (Papio hamadryas); θ-Defensin 3 (baboon). Grades: >98%. CAS No. 1085365-23-6. Molecular formula: C82H128N30O20S6. Mole weight: 2046.47. BOC Sciences 4
Pht-Gly-b-Ala-OH 99+% Pht-Gly-b-Ala-OH 99+%. Group: Biochemicals. Grades: Reagent Grade. Pack Sizes: 1g, 2.5g. US Biological Life Sciences. USBiological 5
Worldwide
Pht-Gly-β-Ala-OH Synonyms: Phthaloyl-glycyl-β-alanine; 3-(2-(1,3-Dioxoisoindolin-2-yl)acetamido)propanoic acid; Pht Gly β Ala OH. Grades: ≥ 99%. CAS No. 17896-84-3. Molecular formula: C13H12N2O5. Mole weight: 276.25. BOC Sciences 5
Pht-Gly-beta-Ala-OH Pht-Gly-beta-Ala-OH. Group: Biochemicals. Alternative Names: Phthaloyl-glycyl-b-alanine. Grades: Highly Purified. CAS No. 17896-84-3. Pack Sizes: 1g, 2g. US Biological Life Sciences. USBiological 8
Worldwide
Phthalaldehyde Phthalaldehyde. Group: Biochemicals. Grades: Highly Purified. CAS No. 643-79-8. Pack Sizes: 50g, 100g, 250g, 500g, 1kg. US Biological Life Sciences. USBiological 8
Worldwide
Phthalaldehyde Phthalaldehyde is a biochemical assay reagent, which modifies the amino acid and measure the derivative through HPLC. Phthalaldehyde forms a fluorescent compound with α-amino group [1] [2]. Uses: Scientific research. Group: Biochemical assay reagents. Alternative Names: Phthaldialdehyde. CAS No. 643-79-8. Pack Sizes: 25 g. Product ID: HY-W012669. MedChemExpress MCE
Phthalaldehydic Acid Phthalaldehydic Acid. Group: Biochemicals. Alternative Names: Benzaldehyde-2-carboxylic Acid; 2-Carboxybenzaldehyde; 2-Formylbenzoic Acid. Grades: Highly Purified. CAS No. 119-67-5. Pack Sizes: 100g, 250g, 500g, 1Kg. US Biological Life Sciences. USBiological 8
Worldwide
Phthalamide White powder, 97%. Synonyms: 1,2-Benzenedicarboxamide. CAS No. 88-96-0. Pack Sizes: 50g, 250g. Product ID: FR-0040. M.P. 223 dec. Mole weight: 164.16. Frinton Laboratories Inc
Frinton Laboratories
Phthalan Phthalan. Group: Biochemicals. Alternative Names: 1,3-Dihydroisobenzofuran; 2-Oxaindan; Dihydroisobenzofuran; Isocoumaran. Grades: Highly Purified. CAS No. 496-14-0. Pack Sizes: 10g. Molecular Formula: C8H8O, Molecular Weight: 120.15. US Biological Life Sciences. USBiological 3
Worldwide
phthalate 4,5-cis-dihydrodiol dehydrogenase Involved in the phthalate degradation pathway in bacteria. Group: Enzymes. Enzyme Commission Number: EC 1.3.1.64. Storage: Store it at +4 ?C for short term. For long term storage, store it at -20 ?C?-80 ?C. Form: Liquid or lyophilized powder. EXWM-1332; phthalate 4,5-cis-dihydrodiol dehydrogenase; EC 1.3.1.64. Cat No: EXWM-1332. Creative Enzymes
phthalate 4,5-dioxygenase A system, containing a reductase which is an iron-sulfur flavoprotein (FMN), an iron-sulfur oxygenase, and no independent ferredoxin. Requires Fe2+. Group: Enzymes. Synonyms: PDO phthalate dioxygenase. Enzyme Commission Number: EC 1.14.12.7. CAS No. 63626-44-8. Storage: Store it at +4 ?C for short term. For long term storage, store it at -20 ?C?-80 ?C. Form: Liquid or lyophilized powder. EXWM-0695; phthalate 4,5-dioxygenase; EC 1.14.12.7; 63626-44-8; PDO phthalate dioxygenase. Cat No: EXWM-0695. Creative Enzymes

Would you like to list your products on USA Chemical Suppliers?

Our database is helping our users find suppliers everyday.

Add Your Products