American Chemical Suppliers
A directory of where to buy chemicals in the USA, including: distributors, industrial manufacturers, bulk supplies and wholesalers of raw ingredients & finished goods.
Search for products or services, then visit the suppliers website for prices or more information.
Product | Description | |
---|---|---|
Phosphorylation Site-Detector FKBP65 Quick inquiry Where to buy Suppliers range | Phosphorylation Site-Detector FKBP65. Uses: Enzyme Substrate Arrays. Product ID: PMA-H165. | |
Phosphorylation Site-Detector GAB1 Quick inquiry Where to buy Suppliers range | Phosphorylation Site-Detector GAB1. Uses: Enzyme Substrate Arrays. Product ID: PMA-H166. | |
Phosphorylation Site-Detector LKB1 Quick inquiry Where to buy Suppliers range | Phosphorylation Site-Detector LKB1. Uses: Enzyme Substrate Arrays. Product ID: PMA-H167. | |
Phosphorylation Site-Detector MDM2 Quick inquiry Where to buy Suppliers range | Phosphorylation Site-Detector MDM2. Uses: Enzyme Substrate Arrays. Product ID: PMA-H168. | |
Phosphorylation Site-Detector MeCP2 Quick inquiry Where to buy Suppliers range | Phosphorylation Site-Detector MeCP2. Uses: Enzyme Substrate Arrays. Product ID: PMA-H169. | |
Phosphorylation Site-Detector NFATP Quick inquiry Where to buy Suppliers range | Phosphorylation Site-Detector NFATP. Uses: Enzyme Substrate Arrays. Product ID: PMA-H170. | |
Phosphorylation Site-Detector NKTK Quick inquiry Where to buy Suppliers range | Phosphorylation Site-Detector NKTK. Uses: Enzyme Substrate Arrays. Product ID: PMA-H171. | |
Phosphorylation Site-Detector Nucleophosmin1 Quick inquiry Where to buy Suppliers range | Phosphorylation Site-Detector Nucleophosmin1. Uses: Enzyme Substrate Arrays. Product ID: PMA-H172. | |
Phosphorylation Site-Detector p53 Quick inquiry Where to buy Suppliers range | Phosphorylation Site-Detector p53. Uses: Enzyme Substrate Arrays. Product ID: PMA-H173. | |
Phosphorylation Site-Detector PAK1 Quick inquiry Where to buy Suppliers range | Phosphorylation Site-Detector PAK1. Uses: Enzyme Substrate Arrays. Product ID: PMA-H174. | |
Phosphorylation Site-Detector Par17 Quick inquiry Where to buy Suppliers range | Phosphorylation Site-Detector Par17. Uses: Enzyme Substrate Arrays. Product ID: PMA-H175. | |
Phosphorylation Site-Detector Parvulin14 Quick inquiry Where to buy Suppliers range | Phosphorylation Site-Detector Parvulin14. Uses: Enzyme Substrate Arrays. Product ID: PMA-H176. | |
Phosphorylation Site-Detector PDK1 Quick inquiry Where to buy Suppliers range | Phosphorylation Site-Detector PDK1. Uses: Enzyme Substrate Arrays. Product ID: PMA-H177. | |
Phosphorylation Site-Detector Phas-I Quick inquiry Where to buy Suppliers range | Phosphorylation Site-Detector Phas-I. Uses: Enzyme Substrate Arrays. Product ID: PMA-H178. | |
Phosphorylation Site-Detector Pin 1 Quick inquiry Where to buy Suppliers range | Phosphorylation Site-Detector Pin 1. Uses: Enzyme Substrate Arrays. Product ID: PMA-H179. | |
Phosphorylation Site-Detector PTEN Quick inquiry Where to buy Suppliers range | Phosphorylation Site-Detector PTEN. Uses: Enzyme Substrate Arrays. Product ID: PMA-H180. | |
Phosphorylation Site-Detector PTMA Quick inquiry Where to buy Suppliers range | Phosphorylation Site-Detector PTMA. Uses: Enzyme Substrate Arrays. Product ID: PMA-H181. | |
Phosphorylation Site-Detector PTPA Quick inquiry Where to buy Suppliers range | Phosphorylation Site-Detector PTPA. Uses: Enzyme Substrate Arrays. Product ID: PMA-H182. | |
Phosphorylation Site-Detector PTPN1 Quick inquiry Where to buy Suppliers range | Phosphorylation Site-Detector PTPN1. Uses: Enzyme Substrate Arrays. Product ID: PMA-H183. | |
Phosphorylation Site-Detector RAD9 Quick inquiry Where to buy Suppliers range | Phosphorylation Site-Detector RAD9. Uses: Enzyme Substrate Arrays. Product ID: PMA-H184. | |
Phosphorylation Site-Detector RAF1 Quick inquiry Where to buy Suppliers range | Phosphorylation Site-Detector RAF1. Uses: Enzyme Substrate Arrays. Product ID: PMA-H185. | |
Phosphorylation Site-Detector RBL2 Quick inquiry Where to buy Suppliers range | Phosphorylation Site-Detector RBL2. Uses: Enzyme Substrate Arrays. Product ID: PMA-H186. | |
Phosphorylation Site-Detector S6 protein Quick inquiry Where to buy Suppliers range | Phosphorylation Site-Detector S6 protein. Uses: Enzyme Substrate Arrays. Product ID: PMA-H187. | |
Phosphorylation Site-Detector Tie 2 Quick inquiry Where to buy Suppliers range | Phosphorylation Site-Detector Tie 2. Uses: Enzyme Substrate Arrays. Product ID: PMA-H188. | |
Phosphorylcholine Quick inquiry Where to buy Suppliers range | White powder or crystalline powder. Alternative Names: Choline phosphate; N-Trimethyl-2-aminoethylphosphonate; o-Phosphocholine; phosphorylcholine; O-Phosphonocholine; O-phosphoryl choline. CAS No. 107-73-3. IUPAC Name: phosphocholine. Molecular Weight: 219.60. Molecular Formula: C5H15ClNO4P. | |
Phosphorylethanolamine Quick inquiry Where to buy Suppliers range | Building Blocks. Uses: For analytical and research use. Group: reagents. Alternative Names: Ethanol, 2-amino-, dihydrogen phosphate (ester) (8CI,9CI), Phosphoric acid, 2-aminoethyl ester (6CI), Phosphorylethanolamine, O-Phosphorylethanolamine, Phosphoethanolamine, Phosphonoethanolamine, Ethanolamine O-phosphate, O-Phosphoethanolamine, 2-Aminoethanol O-phosphate, Mono(2-aminoethyl) phosphate, Monoaminoethyl phosphate, Ethanol, 2-amino-, phosphate (6CI), 2-Aminoethyl dihydrogen phosphate, Colamine phosphate, NSC 254167,2-Aminoethanol 1-(dihydrogen phosphate). CAS No. 1071-23-4. Pack Sizes: 10MG. IUPAC Name: 2-aminoethyl dihydrogen phosphate. | |
Phosphorylethanolamine Quick inquiry Where to buy Suppliers range | Phosphorylethanolamine is used in the synthesis of Sphingomyelin, a type of sphingolipid found in animal cell membrane. Phosphorylethanolamine participates in phospholipid metabolism. Its release can be stimulated occasionally by depolarizing stimuli. Reduction of phosphorylethanolamine levels has been observed in Alzheimer?s and Huntington?s disease. Group: Biochemicals. Alternative Names: 2-Aminoethanol 1-(Dihydrogen Phosphate); 2-Aminoethanol Dihydrogen Phosphate Ester; 2-Aminoethanol Phosphate; Phosphoric Acid 2-Aminoethyl Ester; 2-Aminoethanol O-Phosphate; 2-Aminoethyl Dihydrogen Phosphate; Colamine phosphate; Ethanolamine O-Phosphate; Mono(2-aminoethyl) phosphate; Monoaminoethyl Phosphate; NSC 254167; O-Phosphoethanolamine; O-Phosphoryl ethanolamine; Phosphoethanolamine; Phosphonoethanolamine. Grades: Highly Purified. CAS No. 1071-23-4. Pack Sizes: 10g, 25g. Molecular Formula: C2H8NO4P, Molecular Weight: 141.06. US Biological Life Sciences. | Worldwide |
Phosphorylethanolamine-d4 Quick inquiry Where to buy Suppliers range | Labeled analogue of Phosphoryl ethanolamine. Phosphorylethanolamine is used in the synthesis of Sphingomyelin, a type of sphingolipid found in animal cell membrane. Group: Biochemicals. Alternative Names: 2-Aminoethanol-d4 1-(Dihydrogen Phosphate); 2-Aminoethanol-d4 Dihydrogen Phosphate Ester; 2-Aminoethanol-d4 Phosphate; Phosphoric Acid 2-Aminoethy-d4 Ester; 2-Aminoethanol-d4 O-Phosphate2-Aminoethyl-d4 Dihydrogen Phosphate; Colamine phosphate; Ethanolamine-d4 O-Phosphate; Mono(2-aminoethyl-d4) phosphate; Monoaminoethyl-d4 Phosphate; NSC 254167-d4; O-Phosphoethanolamine-d4; O-Phosphorylethanolamine-d4; Phosphoethanolamine-d4; Phosphonoethanolamine-d4. Grades: Highly Purified. CAS No. 1169692-38-9. Pack Sizes: 1mg. US Biological Life Sciences. | Worldwide |
Phosphoserine / Phosphothreonine, Positive Control Quick inquiry Where to buy Suppliers range | Positive control for P4076-17, P4077-15 or P4076-22. Group: Molecular Biology. Pack Sizes: 150ul. US Biological Life Sciences. | Worldwide |
Phosphotrienin (Fostriecin, Antibiotic CI 920, Antibiotic CL 1565A, Antibiotic PD 110161, NSC 339638), Sodium Salt Quick inquiry Where to buy Suppliers range | Fostriecin is the most fully characterized member of a family of phosphate esters of a triene antibiotic. The antitumor potential of fostriecin has attracted considerable interest, focused on its mode of action as a topoisomerase II inhibitor. Subsequent research has focused on this metabolite's selective inhibition of protein phosphatase PP2A. Group: Biochemicals. Alternative Names: Fostriecin, Phosphotrienin, Antibiotic CI 920, Antibiotic CL 1565A,Antibiotic PD 110161, NSC 339638. Grades: Highly Purified. CAS No. 87810-56-8. Pack Sizes: 100ug. US Biological Life Sciences. | Worldwide |
Phosphotungstic acid Quick inquiry Where to buy Suppliers range | Phosphotungstic acid. Group: Biochemicals. Alternative Names: Tungstophosphoric acid. Grades: Highly Purified. CAS No. 1343-93-7. Pack Sizes: 25g, 50g, 100g, 250g, 500g. Molecular Formula: H3O40PW12·xH2O. US Biological Life Sciences. | Worldwide |
Phosphotungstic Acid Quick inquiry Where to buy Suppliers range | PHOSPHOTUNGSTIC ACID, HYDRATE, Reagent, crystal, (Synonym: Tungstophosphoric Acid, Hydrate), Formula: H3PO4.12WO3.xH2O. CAS No. 12067-99-1. Noah Chemicals San Antonio, Texas. ISO 9001:2015 Certified. Request a Quote Today! | Texas TX |
Phosphotungstic Acid Quick inquiry Where to buy Suppliers range | PHOSPHOTUNGSTIC ACID, SODIUM SALT, HYDRATE, Reagent, crystal, (Synonym: Tungstophosphoric Acid, Sodium Salt, Hydrate), Formula: Na3PO4.12WO3.xH2O. CAS No. 51312-42-6. Noah Chemicals San Antonio, Texas. ISO 9001:2015 Certified. Request a Quote Today! | Texas TX |
Phosphotungstic Acid Quick inquiry Where to buy Suppliers range | Phosphotungstic Acid. Grade: Reagent. CAS: 12067-99-1. Packing: Plastic Drums | New Jersey NJ |
Phosphotungstic Acid Quick inquiry Where to buy Suppliers range | Phosphotungstic Acid. CAS No. 12501-23-4. Molecular Formula H3PO4 * 12WO3 * x H2O. Chemical Reagents | Cater Chemicals Corp. Illinois IL |
Phosphotungstic Acid Quick inquiry Where to buy Suppliers range | Phosphotungstic Acid. Group: Other Nanomaterials. CAS No. 12501-23-4. Molecular Weight: H3[P(W3O10)4]; xH2O. Molecular Formula: 2880.05 g/mol. Purity: 99%. Density: 960 kg/m³. | |
Phosphotungstic Acid Quick inquiry Where to buy Suppliers range | Phosphotungstic Acid. Grade: Reagent. CAS: 12067-99-1. Packing: Plastic Drums. | New Jersey NJ |
Phosphotungstic acid, AR Quick inquiry Where to buy Suppliers range | Phosphotungstic acid, AR. Group: Electronic Chemicals. CAS No. 12501-23-4. IUPAC Name: phosphoric acid;trioxotungsten;hydrate. Molecular Weight: 2898g/mol. Molecular Formula: H5O41PW12. SMILES: O. OP(=O)(O)O. O=[W](=O)=O. O=[W](=O)=O. O=[W](=O)=O. O=[W](=O)=O. O=[W](=O)=O. O=[W](=O)=O. O=[W](=O)=O. O=[W](=O)=O. O=[W](=O)=O. O=[W](=O)=O. O=[W](=O)=O. O=[W](=O)=O. InChI: InChI=1S/H3O4P.H2O.36O.12W/c1-5(2, 3)4; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; /h(H3, 1, 2, 3, 4); 1H2; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ;. InChIKey: AVFBYUADVDVJQL-UHFFFAOYSA-N. | |
Phosphotungstic acid hydrate Quick inquiry Where to buy Suppliers range | 100g Pack Size. Group: Building Blocks, Inorganic Chemicals. Formula: H3O40PW12 · xH2O. CAS No. 12501-23-4. Prepack ID 46336733-100g. Molecular Weight 2880.05. See USA prepack pricing. | |
Phosphotungstic acid hydrate Quick inquiry Where to buy Suppliers range | Phosphotungstic acid hydrate. CAS No. 12501-23-4. | |
Phosphotungstic acid hydrate Quick inquiry Where to buy Suppliers range | Phosphotungstic acid hydrate. Group: Biochemicals. Grades: Reagent Grade. CAS No. 12501-23-4. Pack Sizes: 100g, 250g, 25g, 1Kg, 5Kg. US Biological Life Sciences. | Worldwide |
Phosphotungstic acid hydrate Quick inquiry Where to buy Suppliers range | 99.995% trace metals basis (Purity excludes up to 300 ppm Si). Uses: For analytical and research use. Group: Electronic Chemicals. CAS No. 12501-23-4. Pack Sizes: 10G, 50G. Mole weight: 2880.05 (anhydrous basis). Catalog: AP12501234. Assay: 99.995% trace metals basis (Purity excludes up to 300 ppm Si). Linear Formula: H3[P(W3O10)4] · xH2O. | |
Phosphotyrosine Control, EGF-Stimulated A431 Cell Quick inquiry Where to buy Suppliers range | Phosphotyrosine Control, EGF-Stimulated A431 Cell. Group: Biologicals. Grades: Lysate. Pack Sizes: 1mg. US Biological Life Sciences. | Worldwide |
Photobiotin acetate Quick inquiry Where to buy Suppliers range | Photobiotin acetate, Photobiotin acetate salt, 96087-38-6, 5-[(3aS,4S,6aR)-2-oxo-1,3,3a,4,6,6a-hexahydrothieno[3,4-d]imidazol-4-yl]-N-[3-[3-(4-azido-2-nitroanilino)propyl-methylamino]propyl]pentanamide;acetic acid, DTXSID70585051, HY-W127719, Biotin {3-[3-(4-azido-2-nitroanilino)-N-methylpropylamino]propylamide} acetate salt, CS-0185915, Acetic acid--N-(3-{[3-(4-azido-2-nitroanilino)propyl](methyl)amino}propyl)-5-[(3aS,4S,6aR)-2-oxohexahydro-1H-thieno[3,4-d]imidazol-4-yl]pentanamide (1/1), N-(3-((3-((4-azido-2-nitrophenyl)amino)propyl)(methyl)amino)propyl)-5-((3aS,4S,6aR)-2-oxohexahydro-1H-thieno[3,4-d]imidazol-4-yl)pentanamide acetate. | |
Photocatalytic Ordered TiO2Tx Nanosheets/C Composites Quick inquiry Where to buy Suppliers range | Two-dimensional MXene was used as a precursor to construct an ordered nanosheet structure and at the same time modify a uniform carbon layer to prepare a TiO2 photocatalyst with high visible light activity. Under visible light conditions, the photocatalytic activity of TiO2 nanosheets/C composites is three times higher than that of TiO2. Uses: Energy storage, catalysis, analytical chemistry, mechanics, adsorption, biology, microelectronics, sensors, etc. Group: Ti3C2 MXene Powder. CAS No. 12363-89-2. Molecular Weight: 167.62 g/mol. Flash Point: 0.99. | |
Photochlor Quick inquiry Where to buy Suppliers range | Photochlor, also known as HTTP, is a lipophilic, second-generation, chlorin-based photosensitizer. Upon intravenous administration, HPPH selectively accumulates in the cytoplasm of cancer or pre-cancerous cells. When laser light is applied, a photodynamic reaction between HPPH and oxygen occurs, resulting in the production of cytotoxic free radicals and singlet oxygen and free radical-mediated cell death. Compared to the first-generation photosensitizer porfimer sodium, HPPH shows improved pharmacokinetic properties and causes only mild skin photosensitivity which declines rapidly within a few days after administration. Synonyms: HPPH; 2-(1-Hexyloxyethyl)-2-devinyl pyropheophorbide-a; 14-Ethyl-9-(1-(hexyloxy)ethyl)-4,8,13,18-tetramethyl-20-oxo-3-phorbinepropanoic acid. Grades: >98%. CAS No. 149402-51-7. Molecular formula: C39H48N4O4. Mole weight: 636.83. | |
Photochromic Ion Channel Blocker, QAQ (2, 2- ( (diazene-1, 2-diylbis (4, 1-phenylene))bis (azanediyl))bis (N, N, N-triethyl-2-oxoethanaminium) formate, Quaternary Ammonium-Azobenzene-Quaternary Ammonium) Quick inquiry Where to buy Suppliers range | A membrane-impermeant Na+, K+, and Ca2+ channel blocker that is structurally composed of two azo-linked QX-314 type quaternary amines. Both QX-314 and QAQ are shown to selectively target excitability of nociceptor neurons via TRPV1-dependent cellular uptake. Unlike QX-314, the channel blocking activity of QAQ can be quickly switched on and off via optical cis-to-trans (500nM) and trans-to-cis (320nM) isomerization. Its efficacy as a pain-selective, photochromic anesthetic has been demonstrated in rats in vivo. QAQ cellular uptake can also be achieved by ATP-activated P2X7 receptor. Group: Biochemicals. Grades: Highly Purified. Pack Sizes: 10mg. US Biological Life Sciences. | Worldwide |
Photoinduced CuInS2(CIS)/ZnS Quantum Dots Quick inquiry Where to buy Suppliers range | Photoinduced CuInS2(CIS)/ZnS Quantum Dots. Grades: Water. Product ID: ACMA00021678. | |
Photomirex Quick inquiry Where to buy Suppliers range | A toxic metabolite of Mirex. A photodegradaton product of the insecticide Mirex, is an environmental contaminant that has been identified in Great Lakes fish, soil, and human adipose tissue. Group: Biochemicals. Alternative Names: 1, 1a, 2, 2, 3, 3a, 4, 5, 5, 5a, 5b-Undecachlorooctahydro-. Grades: Highly Purified. CAS No. 39801-14-4. Pack Sizes: 5mg. US Biological Life Sciences. | Worldwide |
Photoregulin3 Quick inquiry Where to buy Suppliers range | ≥98% (HPLC). Uses: For analytical and research use. Group: Fluorescence/Luminescence Spectroscopy. CAS No. 785708-33-0. Pack Sizes: 5MG, 25MG. Mole weight: 377.44. Catalog: AP785708330. Assay: ≥98% (HPLC). | |
Photoswitchable PAD Inhibitor Quick inquiry Where to buy Suppliers range | Photoswitchable PAD inhibitor is a photoactivated inhibitor of protein arginine deiminase (PAD), which plays a role in the pathogenesis of various diseases, including rheumatoid arthritis, multiple sclerosis, lupus, ulcerative colitis, and breast cancer. Synonyms: Photoswitchable PAD inhibitor; 2226393-62-8; N-[(1S)-4-[(1-amino-2-chloroethylidene)amino]-1-(1H-benzimidazol-2-yl)butyl]-4-phenyldiazenylbenzamide; N-[(1S)-1-(1H-benzimidazol-2-yl)-4-[(2-chloro-1-iminoethyl)amino]butyl]-4-(2-phenyldiazenyl)-benzamide; AKOS040754853; PD121672; Photoswitchable PAD Inhibitor (technical grade). CAS No. 2226393-62-8. Molecular formula: C26H26ClN7O. Mole weight: 487.98. | |
Phoxim-d5 (phenyl-d5) (mixture of isomers) Quick inquiry Where to buy Suppliers range | Phoxim-d5 (phenyl-d5) (mixture of isomers). Uses: For analytical and research use. Group: Pesticides & Metabolites; Pesticides & Metabolites. Pack Sizes: 10MG. Catalog: APS011233. Format: Neat. Product Type: Stable Isotope Labelled. | |
PHP 501 trifluoroacetate Quick inquiry Where to buy Suppliers range | PHP 501 trifluoroacetate. Group: Biochemicals. Grades: Purified. CAS No. 1236105-75-1. Pack Sizes: 10mg, 50mg. US Biological Life Sciences. | Worldwide |
PHP 501 trifluoroacetate Quick inquiry Where to buy Suppliers range | PHP 501 trifluoroacetate is potent GABAA antagonist (Ki = 0.0028 μM at rat GABAA receptors; IC50 = 0.024 μM at human α1β2γ2 GABAA-expressing tsA201 cells), without disrupting hGAT-1, hGAT-2, hGAT-3 or hBGT-1 GABA transporters. Synonyms: PHP 501 trifluoroacetate; PHP501 trifluoroacetate; PHP-501 trifluoroacetate; 4-(5-[1,1'-Biphenyl]-3-yl-1-hydroxy-1H-pyrazol-4-yl)piperidine trifluoroacetate. Grades: ≥98% by HPLC. CAS No. 1236105-75-1. Molecular formula: C20H21N3O.CF3CO2H. Mole weight: 433.42. | |
PHPS1 Quick inquiry Where to buy Suppliers range | PHPS1 is a cell-permeable inhibitor of the protein tyrosine phosphatase Shp2, a positive modulator of growth factor signaling. It is selective for Shp2 over ECPTP, PTP1B, Shp1, and mycobacterium MptpA. Synonyms: Phenylhydrazonopyrazolone sulfonate 1; Protein Tyrosine Phosphatase Inhibitor V; PTP Inhibitor V; [4-[[5-[4-(nitromethyl)phenyl]-3-oxo-2-phenyl-1H-pyrazol-4-yl]diazenyl]phenyl]methanesulfonic acid. Grades: ≥98%. CAS No. 314291-83-3. Molecular formula: C21H15N5O6S. Mole weight: 465.4. | |
PHPS1 Sodium Quick inquiry Where to buy Suppliers range | PHPS1 Sodium, 98%. CAS No. 1177131-02-0. Ebrator Biochemicals provides scientists around the global scientific community with a wide range of high purity Life Science products & Fine Chemicals. | |
PHPS1 sodium salt Quick inquiry Where to buy Suppliers range | PHPS1 is a cell-permeable inhibitor of the protein tyrosine phosphatase Shp2, a positive modulator of growth factor signaling. It is selective for Shp2 over ECPTP, PTP1B, Shp1, and mycobacterium MptpA. Synonyms: 4-[2-[1,5-Dihydro-3-(4-nitrophenyl)-5-oxo-1-phenyl-4H-pyrazol-4-ylidene]hydrazinyl]benzenesulfonic acid sodium salt. Grades: ≥98% by HPLC. Molecular formula: C21H14N5O6SNa. Mole weight: 487.42. | |
PHPS1 sodium salt hydrate Quick inquiry Where to buy Suppliers range | ≥98% (HPLC). Uses: For analytical and research use. Group: Fluorescence/Luminescence Spectroscopy. CAS No. 314291-83-3 (free acid). Pack Sizes: 5MG, 25MG. Mole weight: 465.44 (anhydrous free acid basis). Catalog: ALP314291833. Assay: ≥98% (HPLC). | |
Phrixotoxin 3 Quick inquiry Where to buy Suppliers range | Phrixotoxin 3, a peptide toxin produced by the Chilean copper tarantula (Paraphysa scrofa), is a potent blocker of voltage-gated sodium channels (IC50= 0.6, 42, and 72 nM for NaV1.2, NaV1.3 and NaV1.5 respectively). Synonyms: 6-(phenylsulfinyl)-tetrazolo[1,5-b]pyridazine; DCLGFLWKCNPSNDKCCRPNLVCSRKDKWCKYQI. Grades: >99%. CAS No. 880886-00-0. Molecular formula: C176H269N51O48S6. Mole weight: 4059.74. | |
Phrixotoxin 3 Quick inquiry Where to buy Suppliers range | Phrixotoxin 3. Group: Biochemicals. Grades: Purified. CAS No. 880886-00-0. Pack Sizes: 100ug. US Biological Life Sciences. | Worldwide |
Phrixotoxin 3 Quick inquiry Where to buy Suppliers range | Effective voltage-gated sodium channels blocker (IC50 values are 0.6, 42, and 72 nM for NaV1.2, NaV1.3 and NaV1.5 respectively) that blocks inward sodium currents in a voltage-dependent manner. Uses: Peptide Inhibitors. CAS No. 880886-00-0. Product ID: R1061. | |
PHT 427 Quick inquiry Where to buy Suppliers range | PHT 427. Group: Biochemicals. Grades: Purified. CAS No. 1191951-57-1. Pack Sizes: 10mg, 50mg. US Biological Life Sciences. | Worldwide |
PHT-427 Quick inquiry Where to buy Suppliers range | PHT-427 is an AKT inhibitor that inhibits AKT and PDPK1 at low micromolar concentrations in numerous cancer cell lines and exhibits good oral anti-tumor activity in mouse xenograft models. PHT-427 reduces the phosphorylation of AKT and PDPK1. Following the administration of a single oral dose of PHT-427 to mice bearing BxPC-3 human pancreatic tumor xenografts, PHT-427 inhibited the phosphorylation of both Akt and PDPK1 as well as downstream targets maximally at 8-12 h after administration corresponding to its peak plasma concentration, with PDPK1 inhibition extending to 24 hr. Anti-tumor activity was observed in a number of human tumor xenografts with in some cases complete cessation of tumor growth during administration of the compound and some tumor regressions observed. Mutational profiles indicate that EGFR and PIK3CA activiating mutations provide greatest sensitivity to PHT-427. Pre-clinical development of PHT-427 continues. Synonyms: PHT-427; PHT427; PHT 427. CAS No. 1191951-57-1. Molecular formula: C20H31N3O2S2. Mole weight: 409.60904. | |
PHT4-Diol Tetrabromophthalate diol Quick inquiry Where to buy Suppliers range | It is a reactive Flame Retardant, mainly for the hardness of the polyurethane foam flame retardant adhesives and coatings. It is excellent for class 1 and class 2 rigid polyurethane foam, its foam can be formulated for excellent physical properties or favorable economics. Other application areas include polyurethane RIM, elastomers, coatings, adhesives and fibers. Uses: It is recommended as a reactive flame retardant for Class 1 and Class 2 rigid polyurethane foam. Its foams can be formulated for excellent physical properties with favorable economics. Other application areas include polyurethane RIM, elastomers, coatings, adhesives and fibers. Group: Brominated Flame Retardant. CAS No. 77098-07-8. Product ID: ACM77098078-2. Molecular formula: C15H16Br4O7. Mole weight: 627.8. Appearance: Light Amber Ropy Liquid. | |
PhTD1 Quick inquiry Where to buy Suppliers range | PhTD1 is an antimicrobial peptide found in Papio hamadryas (Hamadryas baboon), and has antibacterial and antifungal activity. Synonyms: PhTD-1; BTD 1; Baboon theta defensin 1; Cyclo(L-arginyl-L-cysteinyl-L-valyl-L-cysteinyl-arginyl-L-arginylglycyl-L-valyl-L-cysteinyl-L-arginyl-L-cysteinyl-L-valyl-L-cysteinyl-L-threonyl-rginylglycyl-L-phenylalanyl-cysteinyl), cyclic(2?11),(4?9),(13?18)-tris(disulfide); θ-Defensin 1 (Papio anubis); θ-Defensin 1 (Papio hamadryas); θ-Defensin 1 (baboon). Grades: >98%. CAS No. 1085365-19-0. Molecular formula: C80H133N33O19S6. Mole weight: 2053.51. | |
PhTD1 Quick inquiry Where to buy Suppliers range | PhTD1. Uses: Antimicrobial Peptides. Product ID: AF635. | |
PhTD3 Quick inquiry Where to buy Suppliers range | PhTD3. Uses: Antimicrobial Peptides. Product ID: AF639. | |
PhTD3 Quick inquiry Where to buy Suppliers range | PhTD3 is an antimicrobial peptide found in Papio hamadryas (Hamadryas baboon), and has antibacterial and antifungal activity. Synonyms: PhTD-3; BTD 3; Baboon theta defensin 3; Cyclo(L-arginyl-L-cysteinyl-L-valyl-L-cysteinyl-threonyl-L-arginylglycyl-L-phenylalanyl-L-cysteinyl-L-arginyl-L-cysteinyl-L-valyl-L-cysteinyl-L-threonyl-rginylglycyl-L-phenylalanyl-cysteinyl), cyclic(2?11),(4?9),(13?18)-tris(disulfide); θ-Defensin 3 (Papio anubis); θ-Defensin 3 (Papio hamadryas); θ-Defensin 3 (baboon). Grades: >98%. CAS No. 1085365-23-6. Molecular formula: C82H128N30O20S6. Mole weight: 2046.47. | |
Pht-Gly-b-Ala-OH 99+% Quick inquiry Where to buy Suppliers range | Pht-Gly-b-Ala-OH 99+%. Group: Biochemicals. Grades: Reagent Grade. Pack Sizes: 1g, 2.5g. US Biological Life Sciences. | Worldwide |
Pht-Gly-β-Ala-OH Quick inquiry Where to buy Suppliers range | Synonyms: Phthaloyl-glycyl-β-alanine; 3-(2-(1,3-Dioxoisoindolin-2-yl)acetamido)propanoic acid; Pht Gly β Ala OH. Grades: ≥ 99%. CAS No. 17896-84-3. Molecular formula: C13H12N2O5. Mole weight: 276.25. |