A directory of where to buy chemicals in the USA, including: distributors, industrial manufacturers, bulk supplies and wholesalers of raw ingredients & finished goods.
Search for products or services, then visit the suppliers website for prices or more information.
| Product | Description | |
|---|---|---|
| SD 1029 | SD 1029 is cel-permeable and selective inhibitor of JAK2. It directly abrogates the Jak-Stat3 signaling pathway in human cancer cells expressing constitutively active Stat, suggesting its potential for cancer therapy. Synonyms: JAK2 Inhibitor III; Janus-Associated Kinase 2 Inhibitor III; SD1029; SD-1029; 9-(3,4-dichlorophenyl)-2,7-bis[(dimethylamino)methyl]-3,4,5,6,7,9-hexahydro-2H-xanthene-1,8-dione dihydrobromide. CAS No. 118372-34-2. Molecular formula: C25H30Cl2N2O3·2HBr. Mole weight: 639.3. |  |
| SD2 | Sd2 is an antibacterial peptide isolated from Helianthus annuus (Common sunflower). It has activity against fungi. Synonyms: Asn-Glu-Met-Gly-Gly-Pro-Leu-Val-Val-Glu-Ala-Arg-Thr-Cys-Glu-Ser-Gln-Ser-His-Lys-Phe-Lys-Gly-Thr-Cys-Leu-Ser-Asp-Thr-Asn-Cys-Ala-Asn-Val-Cys-His-Ser-Glu-Arg-Phe-Ser-Gly-Gly-Lys-Cys-Arg-Gly-Phe-Arg-Arg-Arg-Cys-Phe-Cys-Thr-Thr-His-Cys. | |
| SD 208 | SD 208. Group: Biochemicals. Grades: Purified. CAS No. 627536-09-8. Pack Sizes: 10mg, 50mg. US Biological Life Sciences. |  Worldwide |
| SD-208 | SD-208 is a selective TGF-βRI (ALK5) inhibitor with IC 50 of 48 nM, and > 100-fold selectivity over TGF-βRII. Uses: Scientific research. Group: Signaling pathways. CAS No. 627536-09-8. Pack Sizes: 10 mM * 1 mL; 5 mg; 10 mg; 25 mg; 50 mg; 100 mg. Product ID: HY-13227. |  |
| SD-208 | ?98% (HPLC), powder. Group: Fluorescence/luminescence spectroscopy. |  |
| SD-208 | SD-208 is a selective TGF-βRI (ALK5) inhibitor with IC50 of 48 nM, >100-fold selectivity over TGF-βRII. Synonyms: SD-208; SD 208; SD208; TGF-β RI Kinase Inhibitor V. Grades: >98%. CAS No. 627536-09-8. Molecular formula: C17H10ClFN6. Mole weight: 352.75. | |
| SD 2590 hydrochloride | SD 2590 hydrochloride is a potent and orally bioactive MMP inhibitor (IC50 <0.1, <0.1, 0.18, 1.7, 13 and 28.7 nM for MMP-2, -13, -9, -8, -14 and -3, respectively) displaying 100,000-fold selectivity for MMP-2 and -13 over MMP-1. SD 2590 may be beneficial for cancer, arthritis and cardiovascular disease treatment. Synonyms: SD-2590 HCl; SD 2590 HCl; SD2590 HCl; SD-2590 Hydrochloride; SD 2590 Hydrochloride; SD2590 Hydrochloride; SC-78080; SC 78080; SC78080; N-Hydroxy-1- (2-methoxyethyl) -4-[4-[4- (trifluoromethoxy) phenoxy]phenyl]sulfonyl]-4-piperidinecarboxamide hydrochloride. Grades: ≥98% by HPLC. CAS No. 226395-93-3. Molecular formula: C22H25F3N2O7S.HCl. Mole weight: 554.96. | |
| SD-282 | SD-282 is an ATP-competitive inhibitor of p38 kinase. SD-282 reduces inflammation in a subchronic model of tobacco smoke-induced airway inflammation. SD-282 may have potential therapeutic value of p38alpha MAPK inhibitors in the treatment of aberrant pain sensitivity produced by diabetes. Synonyms: SD282; SD 282; SCIO-282; SCIO 282; SCIO282; rac-Talmapimod. CAS No. 309915-13-7. Molecular formula: C27H30ClFN4O3. Mole weight: 513.00. | |
| Sd3 | Sd3 is an antibacterial peptide isolated from Saccharum officinarum (Sugarcane). It has activity against fungi. Synonyms: Arg-His-Arg-His-Cys-Phe-Ser-Gln-Ser-His-Lys-Phe-Val-Gly-Ala-Cys-Leu-Arg-Glu-Ser-Asn-Cys-Glu-Asn-Val-Cys-Lys-Thr-Glu-Gly-Phe-Pro-Ser-Gly-Glu-Cys-Lys-Trp-His-Gly-Ile-Val-Ser-Lys-Cys-His-Cys-Lys-Arg-Ile-Cys. | |
| SD-6 | SD-6 is an orally active inhibitor of hAChE and hBChE with IC 50 values of 0.907 μM and 1.579 μM, respectively. SD-6 has excellent blood-brain barrier (BBB) permeability and no neurotoxicity, which can be used for research on Alzheimer's disease [1]. Uses: Scientific research. Group: Signaling pathways. CAS No. 744206-31-3. Pack Sizes: 10 mM * 1 mL; 5 mg; 10 mg; 25 mg; 50 mg; 100 mg. Product ID: HY-149212. | |
| SD-70 | SD-70 is an inhibitor for histone demethylase JMJD2C and exhibits antitumor efficacy. SD-70 inhibits viability of cancer cells CWR22Rv1 (9% cell survival at 10 μM), PC3 (14% cell survival at 2 μM) and DU145 (26% cell survival at 2 μM) [1]. Uses: Scientific research. Group: Signaling pathways. CAS No. 332173-89-4. Pack Sizes: 10 mM * 1 mL; 5 mg; 10 mg; 25 mg; 50 mg; 100 mg. Product ID: HY-121522. | |
| SD Agar | for microbiology. Group: Fluorescence/luminescence spectroscopy. | |
| SDDC-0001190 | SDDC-0001190 is an inhibitor of dihydrofolate reductase (DHFR) uesd for the treatment of Mycobacterium tuberculosis (MTB). In a previous study, SDDC-0001190 showed high selectivity, low toxicity as well as decent pharmacokinetics with half-life 3.1 h and bioavailability 26%. Uses: The treatment of mycobacterium tuberculosis (mtb). Synonyms: SDDC 0001190; SDDC0001190. | |
| S-Decyanomethyl-S-(1-methyl-1H-tetrazol-5-yl) cefmetazole | S-Decyanomethyl-S-(1-methyl-1H-tetrazol-5-yl) cefmetazole. Group: Biochemicals. Alternative Names: (6R-cis)-7-Methoxy-7-[[[(1-methyl-1H-tetrazol-5-yl)thio]acetyl]amino]-3-[[(1-methyl-1H-tetrazol-5-yl)thio]methyl]-8-oxo-5-thia-1-azabicyclo[4.2.0]oct-2-ene-2-carboxylic acid. Grades: Highly Purified. CAS No. 74228-11-8. Pack Sizes: 5mg, 10mg, 25mg, 50mg, 100mg. Molecular Formula: C15H18N10O5S3. US Biological Life Sciences. | Worldwide |
| S-Decyanomethyl-S-(1-methyl-1H-tetrazol-5-yl) Cefmetazole | Cefmetazole derivative as bactericide cephalosporin. Synonyms: (6R-cis)-7-Methoxy-7-[[[(1-methyl-1H-tetrazol-5-yl)thio]acetyl]amino]-3-[[(1-methyl-1H-tetrazol-5-yl)thio]methyl]-8-oxo-5-thia-1-azabicyclo[4.2.0]oct-2-ene-2-carboxylic Acid Sodium Salt. Grades: > 95%. CAS No. 74228-11-8. Molecular formula: C15H18N10O5S3. Mole weight: 514.57. | |
| S-DECYLGLUTATHIONE | Synonyms: S-DECYLGLUTATHIONE. CAS No. 102814-04-0. Molecular formula: C20H37N3O6S. Mole weight: 447.59. | |
| S-Deoxo-3,17 β-bis-(O-tetrahydro-2H-pyran-2-yl)-6-oxo-fulvestrant | Fulvestrant impurity E derivative. Used in the preparation of antiestrogenic 17-alkylene-16α-hydroxyestratrienes for cancer treatment. Group: Biochemicals. Alternative Names: 7-[9-[ (4, 4, 5, 5, 5-Pentafluoropentyl) sulfenyl]nonyl]--3, 17 β-bis-(O-tetrahydro-2H-pyran-2-yl)estra-1,3,5(10)-triene-6-one. Grades: Highly Purified. CAS No. 862700-70-7. Pack Sizes: 5mg. US Biological Life Sciences. | Worldwide |
| S-Deoxo-3,17β-bis-(O-tetrahydro-2H-pyran-2-yl)-6-oxo-fulvestrant | S-Deoxo-3,17β-bis-(O-tetrahydro-2H-pyran-2-yl)-6-oxo-fulvestrant is an impurity of Fulvestrant, which is a selective estrogen receptor degrader (SERD) used to treat hormone receptor (HR)-positive metastatic breast cancer in postmenopausal women. Synonyms: 7-[9-[(4,4,5,5,5-Pentafluoropentyl)sulfenyl]nonyl]-3,17β-bis-(O-tetrahydro-2H-pyran-2-yl)estra-1,3,5(10)-triene-6-one; (17β)-7-{9-[(4,4,5,5,5-Pentafluoropentyl)sulfanyl]nonyl}-3,17-bis(tetrahydro-2H-pyran-2-yloxy)estra-1,3,5(10)-trien-6-one; Estra-1,3,5(10)-trien-6-one, 7-[9-[(4,4,5,5,5-pentafluoropentyl)thio]nonyl]-3,17-bis[(tetrahydro-2H-pyran-2-yl)oxy]-, (17β)-. Grades: ≥95%. CAS No. 862700-70-7. Molecular formula: C42H61F5O5S. Mole weight: 772.99. | |
| S-Deoxo-3,17-bis-(O-tetrahydro-2H-pyran-2-yl)-6-hydroxy-fulvestrant | S-Deoxo-3,17-bis-(O-tetrahydro-2H-pyran-2-yl)-6-hydroxy-fulvestrant is an impurity of Fulvestrant, which is a selective estrogen receptor degrader (SERD) used to treat hormone receptor (HR)-positive metastatic breast cancer in postmenopausal women. Synonyms: (7S,8R,9S,13S,14S,17S)-13-methyl-7-(9-((4,4,5,5,5-pentafluoropentyl)thio)nonyl)-3,17-bis((tetrahydro-2H-pyran-2-yl)oxy)-7,8,9,11,12,13,14,15,16,17-decahydro-6H-cyclopenta[a]phenanthren-6-ol; 7-[9-[ (4, 4, 5, 5, 5-Pentafluoropentyl) sulfenyl]nonyl]estra-1, 3, 5 (10) -triene-6-ol-3, 17β -bis- (O-tetrahydro-2H-pyran-2-yl). Grades: >98%. Molecular formula: C42H63F5O5S. Mole weight: 775.00. | |
| S-Deoxo-3,17-bis-(O-tetrahydro-2H-pyran-2-yl)-6-hydroxy-fulvestrant | Fulvestrant impurity E derivative. Group: Biochemicals. Alternative Names: 7-[9-[ (4, 4, 5, 5, 5-Pentafluoropentyl) sulfenyl]nonyl]estra-1, 3, 5 (10) -triene-6-ol-3, 17 β-bis-(O-tetrahydro-2H-pyran-2-yl). Grades: Highly Purified. Pack Sizes: 1mg. US Biological Life Sciences. | Worldwide |
| S-Deoxo-3-Keto-17-Acetoxy Fulvestrant | S-Deoxo-3-Keto-17-Acetoxy Fulvestrant is an intermediate of Fulvestrant, which is a drug for breast cancer. Synonyms: (7α,17β)-17-(Acetyloxy)-7-[9-[(4,4,5,5,5-pentafluoropentyl)thio]nonyl]-estr-4-en-3-one; (7R,8R,9S,10R,13S,14S,17S)-13-Methyl-3-oxo-7-(9-((4,4,5,5,5-pentafluoropentyl)thio)nonyl)-2,3,6,7,8,9,10,11,12,13,14,15,16,17-tetradecahydro-1H-cyclopenta[a]phenanthren-17-yl Acetate. Grades: ≥95%. CAS No. 415927-29-6. Molecular formula: C34H51F5O3S. Mole weight: 634.82. | |
| S-Deoxo ?6-Fulvestrant | Fulvestrant impurity E derivative. Group: Biochemicals. Alternative Names: 7-[9-[ (4, 4, 5, 5, 5-Pentafluoropentyl) sulfenyl]nonyl]estra-1, 3, 5 (10) , 6-tetraene-3, 17 β-diol; S-Deoxo Fulvestrant Impurity E. Grades: Highly Purified. Pack Sizes: 1mg. US Biological Life Sciences. | Worldwide |
| S-Deoxo ?6-Fulvestrant | S-Deoxo ?6-Fulvestrant is an impurity of Fulvestrant, which is a drug for breast cancer. Synonyms: 7-[9-[ (4, 4, 5, 5, 5-Pentafluoropentyl) sulfenyl]nonyl]estra-1, 3, 5 (10) , 6-tetraene-3, 17β -diol; S-Deoxo Fulvestrant Impurity E. CAS No. 2170200-16-3. Molecular formula: C32H45F5O2S. Mole weight: 588.75. | |
| S-Deoxo-6-oxo-fulvestrant | S-Deoxo-6-oxo-fulvestrant is an impurity of Fulvestrant, which is a selective estrogen receptor degrader (SERD) used to treat hormone receptor (HR)-positive metastatic breast cancer in postmenopausal women. Synonyms: (7α,17β)-3,17-Dihydroxy-7-[9-[(4,4,5,5,5-pentafluoropentyl)thio]nonyl]-estra-1,3,5(10)-trien-6-one; Estra-1,3,5(10)-trien-6-one, 3,17-dihydroxy-7-[9-[(4,4,5,5,5-pentafluoropentyl)thio]nonyl]-, (7α,17β)-; (7α , 17β ) -3, 17-Dihydroxy-7-{9-[ (4, 4, 5, 5, 5-pentafluoropentyl) sulfanyl]nonyl}estra-1, 3, 5 (10) -trien-6-one. Grades: ≥95%. CAS No. 1107606-70-1. Molecular formula: C32H45F5O3S. Mole weight: 604.75. | |
| S-Deoxo-6-oxo-fulvestrant | Fulvestrant impurity E derivative. Used in the preparation of steroids precursor with hormonal activity. Group: Biochemicals. Alternative Names: (7α,17 β ) -3, 17-Dihydroxy-7-[9-[ (4, 4, 5, 5, 5-pentafluoropentyl) thio]nonyl]-estra-1, 3, 5 (10) -trien-6-one. Grades: Highly Purified. CAS No. 1107606-70-1. Pack Sizes: 2.5mg. US Biological Life Sciences. | Worldwide |
| S-Deoxo-6-oxo-fulvestrant | S-Deoxo-6-oxo-fulvestrant. Uses: For analytical and research use. Group: Impurity standards. Pack Sizes: 2.5MG. Catalog: APS012062. Format: Neat. Shipping: Room Temperature. | |
| S-Deoxo Fulvestrant | S-Deoxo Fulvestrant is a derivative of Fulvestrant, an estrogen receptor antagonist used as a medication indicated for the treatment of hormone receptor (HR)-positive metastatic breast cancer in postmenopausal women. Synonyms: (7a,17b)-7-[9-[(4,4,5,5,5-Pentafluoropentyl)thio]nonyl]-estra-1,3,5(10)-triene-3,17-diol. Grades: 95%. CAS No. 153004-31-0. Molecular formula: C32H47F5O2S. Mole weight: 590.77. | |
| S-(+)-Deprenyl Hydrochloride | (N,a-dimethyl-N-2-propynylbenzeneethanamine). less active enantiomer, water soluble. CAS No. 4528-52-3. Product ID: 1-01043. Molecular formula: C13H17N. Mole weight: 223.75. Purity: 0.98. |  |
| S-Des[2-(1-methyl-2-pyrrolidinyl)ethyl]amine S-Hydroxy Udenafil | S-Des[2-(1-methyl-2-pyrrolidinyl)ethyl]amine S-Hydroxy Udenafil is a metabolite of Udenafil. Udenafil is a PDE5 inhibitor used for the treatment of erectile dysfunction. Synonyms: Udenafil Impurity 1; 3-(1-Methyl-7-oxo-3-propyl-6,7-dihydro-1H-pyrazolo[4,3-d]pyrimidin-5-yl)-4-propoxybenzenesulfonic Acid. Molecular formula: C18H22N4O5S. Mole weight: 406.46. | |
| S-Desethylpiperidino S-[2-Carboxyl-2-oxo-ethyl-(2-aminoethyl)amino] Vardenafil | An impurity of Vardenafil. Vardenafil is a PDE5 inhibitor used for the treatment of erectile dysfunction. Synonyms: Vardenafil Impurity 4; 2- [ [2- [ [ [3- (1, 4-Dihydro-5-methyl-4-oxo-7-propylimidazo [5, 1-f] [1, 2, 4] triazin-2-yl) -4-ethoxyphenyl] sulfonyl] amino] ethyl] amino] -2-oxoacetic Acid; [ [2- [ [ [3- (1, 4-Dihydro-5-methyl-4-oxo-7-propylimidazo [5, 1-f] [1, 2, 4] triazin-2-yl) -4-ethoxyphenyl] sulfonyl] amino] ethyl] amino] oxoacetic Acid; Vardenafil Oxoacetic Acid Impurity. CAS No. 448184-56-3. Molecular formula: C21H26N6O7S. Mole weight: 506.54. | |
| S-Desmethyl Citalopram Hydrochloride | A metabolite of Citalopram, an inhibitor of serotonin (5-HT) uptake. Used as an antidepressant. Group: Biochemicals. Alternative Names: 1S)-1-(4-Fluorophenyl)-1,3-dihydro-1-[3-(methylamino)propyl]-5-isobenzo-furancarbonitrile Hydrochloride; (S)-1-(3-Methylaminopropyl)-1-(4-fluorophenyl)-1,3-dihydroisobenzofuran-5-carbonitrile Hydrochloride. Grades: Highly Purified. Pack Sizes: 1mg. US Biological Life Sciences. | Worldwide |
| S-Desmethyl-S-(2-hydroxy-2-methylpropyl) Rosuvastatin Sodium Salt | S-Desmethyl-S-(2-hydroxy-2-methylpropyl) Rosuvastatin Sodium Salt. Uses: For analytical and research use. Group: Impurity standards. Alternative Names: (3R,5S,6E)-7-[4-(4-Fluorophenyl)-2-[[(2-hydroxy-2-methylpropyl)sulfonyl]methylamino]-6-(1-methylethyl)-5-pyrimidinyl]-3,5-dihydroxy-6-heptenoic Acid Sodium Salt (1:1), Rosuvastatin Calcium Imp. A (EP) as Sodium Salt. CAS No. 1714147-50-8. Pack Sizes: 10MG. IUPAC Name: sodium;(E,3R,5S)-7-[4-(4-fluorophenyl)-2-[(2-hydroxy-2-methylpropyl)sulfonyl-methylamino]-6-propan-2-ylpyrimidin-5-yl]-3,5-dihydroxyhept-6-enoate. Molecular formula: C25H33FN3O7S.Na. Mole weight: 561.60. Catalog: APS1714147508. SMILES: [Na+].CC(C)c1nc(nc(c2ccc(F)cc2)c1\C=C\[C@@H](O)C[C@@H](O)CC(=O)[O-])N(C)S(=O)(=O)CC(C)(C)O. Format: Neat. Shipping: Room Temperature. | |
| S-Desmethyl-S-(2-hydroxy-2-methylpropyl) Rosuvastatin tert-Butyl Ester | S-Desmethyl-S-(2-hydroxy-2-methylpropyl) Rosuvastatin tert-Butyl Ester. Uses: For analytical and research use. Group: Impurity standards. Pack Sizes: 10MG. Catalog: APS012063. Format: Neat. Shipping: Room Temperature. | |
| SDF-1alpha (CXCL12) from mouse | recombinant, expressed in E. coli, ?99% (SDS-PAGE), ?99% (HPLC). Group: Fluorescence/luminescence spectroscopy. | |
| SDF-1 alpha from rat | recombinant, expressed in E. coli, ?98% (SDS-PAGE), ?98% (HPLC), suitable for cell culture. Group: Fluorescence/luminescence spectroscopy. | |
| SDF-1α (human) | SDF-1α (human) is a synthetic peptide containing a 1:50 ratio of BSA (low levels of endotoxins) and is a multifunctional cytokine signaling through CXCR4. SDF-1α is involved in many pathological conditions such as rheumatoid arthritis, pulmonary fibrosis, metastasis and leukemia cell progression. Internalization of SDF-1α dependence of CXCR4 HIV coreceptor contributes to inhibition of HIV replication. Synonyms: Stromal Cell-Derived Factor-1α (human); H-Lys-Pro-Val-Ser-Leu-Ser-Tyr-Arg-Cys-Pro-Cys-Arg-Phe-Phe-Glu-Ser-His-Val-Ala-Arg-Ala-Asn-Val-Lys-His-Leu-Lys-Ile-Leu-Asn-Thr-Pro-Asn-Cys-Ala-Leu-Gln-Ile-Val-Ala-Arg-Leu-Lys-Asn-Asn-Asn-Arg-Gln-Val-Cys-Ile-Asp-Pro-Lys-Leu-Lys-Trp-Ile-Gln-Glu-Tyr-Leu-Glu-Lys-Ala-Leu-Asn-Lys-OH (Disulfide bridge: Cys9-Cys34, Cys11-Cys50). Grades: ≥95%. CAS No. 1268129-65-2. Molecular formula: C356H578N106O93S4. Mole weight: 7959.43. | |
| SDF-1 ALPHA human | Animal-component free, recombinant, expressed in E. coli, ?98% (SDS-PAGE), ?98% (HPLC). Group: Fluorescence/luminescence spectroscopy. | |
| SDF-1beta (CXCL12) from mouse | recombinant, expressed in E. coli, ?98% (SDS-PAGE), ?98% (HPLC). Group: Fluorescence/luminescence spectroscopy. | |
| SDF-1 beta from rat | recombinant, expressed in E. coli, ?95% (SDS-PAGE), ?95% (HPLC), suitable for cell culture. Group: Fluorescence/luminescence spectroscopy. | |
| SDF-1 BETA human | Animal-component free, recombinant, expressed in E. coli, ?98% (SDS-PAGE), ?98% (HPLC). Group: Fluorescence/luminescence spectroscopy. | |
| SDG | SDG. Group: Biochemicals. CAS No. 158932-33-3. Pack Sizes: 5mg. US Biological Life Sciences. | Worldwide |
| SDGRG | SDGRG has been used as a control peptide which does not affect integrin function, in various studies. Synonyms: S-D-G-R-G; H-SER-ASP-GLY-ARG-GLY-OH. Grades: >95%. CAS No. 108608-63-5. Molecular formula: C17H30N8O9. Mole weight: 490.5. | |
| S-Diclofenac | S-Diclofenac is a hybrid molecule of an H 2 S donor and the NSAID diclofenac. S-Diclofenac spares the gastric mucosa of injury despite markedly suppressing prostaglandin synthesis [1]. Uses: Scientific research. Group: Signaling pathways. Alternative Names: ACS 15; ATB-337. CAS No. 912758-00-0. Pack Sizes: 10 mM * 1 mL; 5 mg; 10 mg; 25 mg; 50 mg; 100 mg. Product ID: HY-15035. | |
| SDIC(Sodium DiChloro Isocyanurate) | SDIC(Sodium DiChloro Isocyanurate). |  International |
| S- (Di methyl carbamoyl methyl ) O,O-Dimethyl Ester Phosphorodithioic Acid | S- (Di methyl carbamoyl methyl ) O,O-Dimethyl Ester Phosphorodithioic Acid. Group: Biochemicals. Alternative Names: O,O-dimethyl Ester Phosphorodithioic Acid S-Ester with 2-Mercapto-N,N-dimethylacetamide. Grades: Highly Purified. CAS No. 60823-19-0. Pack Sizes: 100mg. Molecular Formula: C6H14NO3PS2, Molecular Weight: 243.28. US Biological Life Sciences. | Worldwide |
| S- (Di methyl carbamoyl methyl ) O,O-Dimethyl Ester Phosphorodithioic Acid-d6 | S- (Di methyl carbamoyl methyl ) O,O-Dimethyl Ester Phosphorodithioic Acid-d6. Group: Biochemicals. Alternative Names: O,O-dimethyl Ester Phosphorodithioic Acid S-Ester with 2-Mercapto-N,N-dimethylacetamide-d6. Grades: Highly Purified. Pack Sizes: 5mg. Molecular Formula: C6H8D6NO3PS2, Molecular Weight: 249.32. US Biological Life Sciences. | Worldwide |
| S-Diphenylmethyl-L-cysteine | S-Diphenylmethyl-L-cysteine. Group: Biochemicals. Alternative Names: L-Cys(Dpm)-OH. Grades: Highly Purified. CAS No. 5191-80-0. Pack Sizes: 500mg, 1g. US Biological Life Sciences. | Worldwide |
| S-Diphenylmethyl-L-cysteine | The S-diphenylmethyl group is one of the most effective S-protecting groups for cysteine. Synonyms: L-Cys(Dpm)-OH; (R)-2-Amino-3-(Benzhydrylthio)Propanoic Acid. Grades: ≥ 99% (TLC). CAS No. 5191-80-0. Molecular formula: C16H17NO2S. Mole weight: 287.38. | |
| S-Diphenylmethyl-L-cysteine 99+% (TLC) | S-Diphenylmethyl-L-cysteine 99+% (TLC). Group: Biochemicals. Grades: Reagent Grade. Pack Sizes: 250mg, 1g. US Biological Life Sciences. | Worldwide |
| sDLL-1 human | recombinant, expressed in HEK 293 cells, ?95% (SDS-PAGE), ?95% (HPLC), suitable for cell culture. Group: Fluorescence/luminescence spectroscopy. | |
| sDLL-4 human | recombinant, expressed in HEK 293 cells, ?95% (SDS-PAGE), ?95% (HPLC), suitable for cell culture. Group: Fluorescence/luminescence spectroscopy. | |
| SDM25N hydrochloride | SDM25N is a highly selective non-peptide δ receptor antagonist. Synonyms: SDM25N HCl; (4bS,8R,8aS,14bR)-5,6,7,8,14,14b-Hexahydro-7-(2-methyl-2-propenyl)-4,8-methanobenzofuro[2,3-a]pyrido[4,3-b]carbazole-1,8a(9H)-diol hydrochloride. Grades: ≥99% by HPLC. CAS No. 342884-71-3. Molecular formula: C26H26N2O3·HCl. Mole weight: 450.96. | |
| SDM25N hydrochloride | SDM25N hydrochloride. Group: Biochemicals. Grades: Purified. CAS No. 342884-71-3. Pack Sizes: 10mg, 50mg. US Biological Life Sciences. | Worldwide |
| SDMA | SDMA (Symmetric dimethylarginine) is an endogenous inhibitor of nitric oxide ( NO ) synthase activity. SDMA, a novel kidney biomarker, permits earlier diagnosis of kidney disease than traditional creatinine testing. Uses: Scientific research. Group: Natural products. Alternative Names: Symmetric dimethylarginine; NG,NG'-Dimethyl-L-arginine. CAS No. 30344-00-4. Pack Sizes: 10 mM * 1 mL; 5 mg; 10 mg; 25 mg; 50 mg; 100 mg. Product ID: HY-101410. | |
| SDMA | An endogenous inhibitor of nitric oxide (NO) synthase activity. Synonyms: (2S) -2-amino-5-[ (N, N'-dimethylcarbamimidoyl) amino]pentanoic acid; guanidino-N(1),N(2)-dimethylarginine; N(G1),N(G2)-dimethylarginine; N,N'-dimethylarginine; NG,N'G-dimethyl-L-arginine; omega-N(G),N'(G)-dimethylarginine; sDMA arginine; symmetric dimethylarginine. CAS No. 30344-00-4. Molecular formula: C8H18N4O2. Mole weight: 202.25. | |
| S-Doxazosin | (S)-(+)-Doxazosin is an Isomer of Doxazosin Mesylate. Synonyms: (S)-1-(4-Amino-6,7-dimethoxy-2-quinazolinyl)-4-[(2,3-dihydro-1,4-benzodioxin-2-yl)carbonyl]-piperazine; 1-(4-Amino-6,7-dimethoxy-2-quinazolinyl)-4-[[(2S)-2,3-dihydro-1,4-benzodioxin-2-yl]carbonyl]piperazine. Grades: > 95%. CAS No. 104874-86-4. Molecular formula: C23H25N5O5. Mole weight: 451.48. | |
| SDS (Sodium dodecyl sulfate) | 500g Pack Size. Group: Detergents. Formula: C12H25NaO4S. CAS No. 151-21-3. Prepack ID 15171947-500g. Molecular Weight 288.38. See USA prepack pricing. |  |
| SDS (Sodium dodecyl sulfate) | 1kg Pack Size. Group: Detergents. Formula: C12H25NaO4S. CAS No. 151-21-3. Prepack ID 15171947-1kg. Molecular Weight 288.38. See USA prepack pricing. | |
| SDS (Sodium dodecyl sulfate) Ultrapure | 500g Pack Size. Group: Biochemicals, Detergents, Reagents. Formula: C12H26O4S.Na. CAS No. 151-21-3. Prepack ID 10325163-500g. Molecular Weight 288.38. See USA prepack pricing. | |
| SDS (Sodium dodecyl sulfate) Ultrapure | 100g Pack Size. Group: Biochemicals, Detergents, Reagents. Formula: C12H26O4S.Na. CAS No. 151-21-3. Prepack ID 10325163-100g. Molecular Weight 288.38. See USA prepack pricing. | |
| SDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS | SDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS is a 32-amino acid peptide. Synonyms: Ser-Asp-Val-Ser-Lys-Gln-Met-Glu-Glu-Glu-Ala-Val-Arg-Leu-Phe-Ile-Glu-Trp-Leu-Lys-Asn-Gly-Gly-Pro-Ser-Ser-Gly-Ala-Pro-Pro-Pro-Ser. Grades: >98%. Molecular formula: C151H236N40O50S. Mole weight: 3443.84. | |
| SDZ 205-557 hydrochloride | SDZ 205-557 hydrochloride is a 5-HT3/5-HT4 receptor antagonist that can promote intestinal peristalsis and gastric emptying. Synonyms: 4-Amino-5-chloro-2-methoxybenzoic acid 2-(diethylamino)ethyl ester hydrochloride; 2-(diethylamino)ethyl 4-amino-5-chloro-2-methoxybenzoate hydrochloride. Grades: ≥99% by HPLC. CAS No. 1197334-02-3. Molecular formula: C14H21ClN2O3.HCl. Mole weight: 337.25. | |
| SDZ 205-557 hydrochloride | SDZ 205-557 hydrochloride. Group: Biochemicals. Grades: Purified. CAS No. 1197334-02-3. Pack Sizes: 10mg, 50mg. US Biological Life Sciences. | Worldwide |
| SDZ-205,557 hydrochloride | solid. Group: Fluorescence/luminescence spectroscopy. | |
| SDZ 21009 | SDZ 21009. Group: Biochemicals. Grades: Purified. CAS No. 39731-05-0. Pack Sizes: 10mg, 50mg. US Biological Life Sciences. | Worldwide |
| SDZ 21009 | SDZ 21009 is a β-adrenoceptor and 5-HT1A/1B receptor antagonist (pKB/pA2 = 8.3 and 8.0 for 5-HT1A and 5-HT1B receptors, respectively). Synonyms: Carpindolol; LM 21009; LM-21009; LM21009; SDZ 21009; SDZ21009; SDZ-21009; 4-[3-[(1,1-Dimethylethyl)amino]-2-hydroxypropoxy]-1H-indole-2-carboxylic acid, 1-methylethyl ester. CAS No. 39731-05-0. Molecular formula: C19H28N2O4. Mole weight: 348.44. | |
| SDZ 220-040 | SDZ 220-040 is a potent competitive antagonist at the NMDA receptor (pKi = 8.5). Synonyms: SDZ 220-040; SDZ220-040; SDZ-220-040; (S)-α-Amino-2',4'-dichloro-4-hydroxy-5-(phosphonomethyl)-[1,1'-biphenyl]-3-propanoic acid. CAS No. 174575-40-7. Molecular formula: C16H16Cl2NO6P. Mole weight: 420.19. | |
| SDZ 220-581 | SDZ 220-581 is a competitive NMDA receptor antagonist (pKi = 7.7). SDZ 220-581 was indicated a reverse effect on haloperidol-induced catalepsy in the rat model of Parkinson's disease. Synonyms: (S)-α-Amino-2'-chloro-5-(phosphonomethyl)[1,1'-biphenyl]-3-propanoic acid. Grades: ≥98% by HPLC. CAS No. 174575-17-8. Molecular formula: C16H17ClNO5P. Mole weight: 369.74. | |
| SDZ 220-581 | SDZ 220-581 is an orally active, potent, competitive NMDA receptor antagonist with pK i value of 7.7 [1]. Uses: Scientific research. Group: Signaling pathways. CAS No. 174575-17-8. Pack Sizes: 10 mM * 1 mL; 5 mg; 10 mg; 25 mg; 50 mg. Product ID: HY-13059. | |
| SDZ 220-581 hydrochloride | SDZ 220-581 hydrochloride is an orally active, potent, competitive NMDA receptor antagonist with pK i value of 7.7 [1]. Uses: Scientific research. Group: Signaling pathways. CAS No. 179411-93-9. Pack Sizes: 10 mM * 1 mL; 5 mg; 10 mg; 50 mg. Product ID: HY-13059B. | |
Our database is helping our users find suppliers everyday.
