American Chemical Suppliers
A directory of where to buy chemicals in the USA, including: distributors, industrial manufacturers, bulk supplies and wholesalers of raw ingredients & finished goods.
Search for products or services, then visit the suppliers website for prices or more information.
Product | Description | |
---|---|---|
SDG Quick inquiry Where to buy Suppliers range | SDG. Group: Biochemicals. CAS No. 158932-33-3. Pack Sizes: 5mg. US Biological Life Sciences. | Worldwide |
SDGRG Quick inquiry Where to buy Suppliers range | SDGRG has been used as a control peptide which does not affect integrin function, in various studies. Uses: API. CAS No. 108608-63-5. Product ID: 10-101-316. | |
SDGRG Quick inquiry Where to buy Suppliers range | SDGRG has been used as a control peptide which does not affect integrin function, in various studies. Synonyms: S-D-G-R-G; H-SER-ASP-GLY-ARG-GLY-OH. Grades: >95%. CAS No. 108608-63-5. Molecular formula: C17H30N8O9. Mole weight: 490.5. | |
SDIC(Sodium DiChloro Isocyanurate) Quick inquiry Where to buy Suppliers range | SDIC(Sodium DiChloro Isocyanurate). | International |
S- (Di methyl carbamoyl methyl ) O,O-Dimethyl Ester Phosphorodithioic Acid Quick inquiry Where to buy Suppliers range | S- (Di methyl carbamoyl methyl ) O,O-Dimethyl Ester Phosphorodithioic Acid. Group: Biochemicals. Alternative Names: O,O-dimethyl Ester Phosphorodithioic Acid S-Ester with 2-Mercapto-N,N-dimethylacetamide. Grades: Highly Purified. CAS No. 60823-19-0. Pack Sizes: 100mg. Molecular Formula: C6H14NO3PS2, Molecular Weight: 243.28. US Biological Life Sciences. | Worldwide |
S- (Di methyl carbamoyl methyl ) O,O-Dimethyl Ester Phosphorodithioic Acid-d6 Quick inquiry Where to buy Suppliers range | S- (Di methyl carbamoyl methyl ) O,O-Dimethyl Ester Phosphorodithioic Acid-d6. Group: Biochemicals. Alternative Names: O,O-dimethyl Ester Phosphorodithioic Acid S-Ester with 2-Mercapto-N,N-dimethylacetamide-d6. Grades: Highly Purified. Pack Sizes: 5mg. Molecular Formula: C6H8D6NO3PS2, Molecular Weight: 249.32. US Biological Life Sciences. | Worldwide |
S-Diphenylmethyl-L-cysteine Quick inquiry Where to buy Suppliers range | S-Diphenylmethyl-L-cysteine. Group: Biochemicals. Alternative Names: L-Cys(Dpm)-OH. Grades: Highly Purified. CAS No. 5191-80-0. Pack Sizes: 500mg, 1g. US Biological Life Sciences. | Worldwide |
S-Diphenylmethyl-L-cysteine Quick inquiry Where to buy Suppliers range | The S-diphenylmethyl group is one of the most effective S-protecting groups for cysteine. Synonyms: L-Cys(Dpm)-OH; (R)-2-Amino-3-(Benzhydrylthio)Propanoic Acid. Grades: ≥ 99% (TLC). CAS No. 5191-80-0. Molecular formula: C16H17NO2S. Mole weight: 287.38. | |
S-Diphenylmethyl-L-cysteine 99+% (TLC) Quick inquiry Where to buy Suppliers range | S-Diphenylmethyl-L-cysteine 99+% (TLC). Group: Biochemicals. Grades: Reagent Grade. Pack Sizes: 250mg, 1g. US Biological Life Sciences. | Worldwide |
SDM25N hydrochloride Quick inquiry Where to buy Suppliers range | SDM25N is a highly selective non-peptide δ receptor antagonist. Synonyms: SDM25N HCl; (4bS,8R,8aS,14bR)-5,6,7,8,14,14b-Hexahydro-7-(2-methyl-2-propenyl)-4,8-methanobenzofuro[2,3-a]pyrido[4,3-b]carbazole-1,8a(9H)-diol hydrochloride. Grades: ≥99% by HPLC. CAS No. 342884-71-3. Molecular formula: C26H26N2O3·HCl. Mole weight: 450.96. | |
SDM25N hydrochloride Quick inquiry Where to buy Suppliers range | SDM25N hydrochloride. Group: Biochemicals. Grades: Purified. CAS No. 342884-71-3. Pack Sizes: 10mg, 50mg. US Biological Life Sciences. | Worldwide |
SDMA Quick inquiry Where to buy Suppliers range | An endogenous inhibitor of nitric oxide (NO) synthase activity. Synonyms: (2S) -2-amino-5-[ (N, N'-dimethylcarbamimidoyl) amino]pentanoic acid; guanidino-N(1),N(2)-dimethylarginine; N(G1),N(G2)-dimethylarginine; N,N'-dimethylarginine; NG,N'G-dimethyl-L-arginine; omega-N(G),N'(G)-dimethylarginine; sDMA arginine; symmetric dimethylarginine. CAS No. 30344-00-4. Molecular formula: C8H18N4O2. Mole weight: 202.25. | |
S-DNTT-10 [for organic electronics] Quick inquiry Where to buy Suppliers range | S-DNTT-10 [for organic electronics]. Group: p-Type Organic Semiconductors. Alternative Names: 3,10-Didecylnaphtho[2,1-b]naphtho[1',2':4,5]thieno[2,3-d]thiophene;21DNTT-10. Grades: >99.5%(HPLC). Product ID: ACMA00024314. Molecular formula: C42H52S2. Mole weight: 621.00. Appearance: White to Almost white powder to crystal. Melting Point: 480 °C. Storage: Store under inert gas. | |
S-Doxazosin Quick inquiry Where to buy Suppliers range | (S)-(+)-Doxazosin is an Isomer of Doxazosin Mesylate. Synonyms: (S)-1-(4-Amino-6,7-dimethoxy-2-quinazolinyl)-4-[(2,3-dihydro-1,4-benzodioxin-2-yl)carbonyl]-piperazine; 1-(4-Amino-6,7-dimethoxy-2-quinazolinyl)-4-[[(2S)-2,3-dihydro-1,4-benzodioxin-2-yl]carbonyl]piperazine. Grades: > 95%. CAS No. 104874-86-4. Molecular formula: C23H25N5O5. Mole weight: 451.48. | |
SDS (Sodium dodecyl sulfate) Quick inquiry Where to buy Suppliers range | 1kg Pack Size. Group: Detergents. Formula: C12H25NaO4S. CAS No. 151-21-3. Prepack ID 15171947-1kg. Molecular Weight 288.38. See USA prepack pricing. | |
SDS (Sodium dodecyl sulfate) Quick inquiry Where to buy Suppliers range | 500g Pack Size. Group: Detergents. Formula: C12H25NaO4S. CAS No. 151-21-3. Prepack ID 15171947-500g. Molecular Weight 288.38. See USA prepack pricing. | |
SDS (Sodium dodecyl sulfate) Quick inquiry Where to buy Suppliers range | 1kg Pack Size. Group: Detergents. Formula: C12H25NaO4S. CAS No. 151-21-3. Prepack ID 15171947-1kg. Molecular Weight 288.38. See USA prepack pricing. | |
SDS (Sodium dodecyl sulfate) Quick inquiry Where to buy Suppliers range | 500g Pack Size. Group: Detergents. Formula: C12H25NaO4S. CAS No. 151-21-3. Prepack ID 15171947-500g. Molecular Weight 288.38. See USA prepack pricing. | |
SDS (Sodium dodecyl sulfate) Ultrapure Quick inquiry Where to buy Suppliers range | 100g Pack Size. Group: Biochemicals, Detergents, Reagents. Formula: C12H26O4S.Na. CAS No. 151-21-3. Prepack ID 10325163-100g. Molecular Weight 288.38. See USA prepack pricing. | |
SDS (Sodium dodecyl sulfate) Ultrapure Quick inquiry Where to buy Suppliers range | 500g Pack Size. Group: Biochemicals, Detergents, Reagents. Formula: C12H26O4S.Na. CAS No. 151-21-3. Prepack ID 10325163-500g. Molecular Weight 288.38. See USA prepack pricing. | |
SDS (Sodium dodecyl sulfate) Ultrapure Quick inquiry Where to buy Suppliers range | 500g Pack Size. Group: Biochemicals, Detergents, Reagents. Formula: C12H26O4S.Na. CAS No. 151-21-3. Prepack ID 10325163-500g. Molecular Weight 288.38. See USA prepack pricing. | |
SDS (Sodium dodecyl sulfate) Ultrapure Quick inquiry Where to buy Suppliers range | 100g Pack Size. Group: Biochemicals, Detergents, Reagents. Formula: C12H26O4S.Na. CAS No. 151-21-3. Prepack ID 10325163-100g. Molecular Weight 288.38. See USA prepack pricing. | |
SDVSKQMEEEAVRLFIEWLKNGG PSSGAPPPS Quick inquiry Where to buy Suppliers range | SDVSKQMEEEAVRLFIEWLKNGG PSSGAPPPS is a 32-amino acid peptide. Uses: Peptide Inhibitors. Product ID: R1667. | |
SDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS Quick inquiry Where to buy Suppliers range | SDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS is a 32-amino acid peptide. Synonyms: Ser-Asp-Val-Ser-Lys-Gln-Met-Glu-Glu-Glu-Ala-Val-Arg-Leu-Phe-Ile-Glu-Trp-Leu-Lys-Asn-Gly-Gly-Pro-Ser-Ser-Gly-Ala-Pro-Pro-Pro-Ser. Grades: >98%. Molecular formula: C151H236N40O50S. Mole weight: 3443.84. | |
SDZ 205-557 hydrochloride Quick inquiry Where to buy Suppliers range | SDZ 205-557 hydrochloride. Group: Biochemicals. Grades: Purified. CAS No. 1197334-02-3. Pack Sizes: 10mg, 50mg. US Biological Life Sciences. | Worldwide |
SDZ 205-557 hydrochloride Quick inquiry Where to buy Suppliers range | SDZ 205-557 hydrochloride is a 5-HT3/5-HT4 receptor antagonist that can promote intestinal peristalsis and gastric emptying. Synonyms: 4-Amino-5-chloro-2-methoxybenzoic acid 2-(diethylamino)ethyl ester hydrochloride; 2-(diethylamino)ethyl 4-amino-5-chloro-2-methoxybenzoate hydrochloride. Grades: ≥99% by HPLC. CAS No. 1197334-02-3. Molecular formula: C14H21ClN2O3.HCl. Mole weight: 337.25. | |
SDZ 21009 Quick inquiry Where to buy Suppliers range | SDZ 21009 is a β-adrenoceptor and 5-HT1A/1B receptor antagonist (pKB/pA2 = 8.3 and 8.0 for 5-HT1A and 5-HT1B receptors, respectively). Synonyms: Carpindolol; LM 21009; LM-21009; LM21009; SDZ 21009; SDZ21009; SDZ-21009; 4-[3-[(1,1-Dimethylethyl)amino]-2-hydroxypropoxy]-1H-indole-2-carboxylic acid, 1-methylethyl ester. CAS No. 39731-05-0. Molecular formula: C19H28N2O4. Mole weight: 348.44. | |
SDZ 21009 Quick inquiry Where to buy Suppliers range | SDZ 21009. Group: Biochemicals. Grades: Purified. CAS No. 39731-05-0. Pack Sizes: 10mg, 50mg. US Biological Life Sciences. | Worldwide |
SDZ 220-040 Quick inquiry Where to buy Suppliers range | SDZ 220-040 is a potent competitive antagonist at the NMDA receptor (pKi = 8.5). Synonyms: SDZ 220-040; SDZ220-040; SDZ-220-040; (S)-α-Amino-2',4'-dichloro-4-hydroxy-5-(phosphonomethyl)-[1,1'-biphenyl]-3-propanoic acid. CAS No. 174575-40-7. Molecular formula: C16H16Cl2NO6P. Mole weight: 420.19. | |
SDZ 220-040 Quick inquiry Where to buy Suppliers range | 174575-40-7, SDZ 220-040, (2S)-2-amino-3-[2',4'-dichloro-4-hydroxy-5-(phosphonomethyl)biphenyl-3-yl]propanoic acid, CHEMBL409024, (2S)-2-amino-3-[5-(2,4-dichlorophenyl)-2-hydroxy-3-(phosphonomethyl)phenyl]propanoic acid, (S)-2-Amino-3-(2',4'-dichloro-4-hydroxy-5-(phosphonomethyl)-[1,1'-biphenyl]-3-yl)propanoic acid, SDZ-220-040, QGP, NCGC00025080-01, Tocris-1251, SCHEMBL1998462, HMS3267H17, HMS3412C10, HMS3676C10, BDBM50373122, MFCD02262130, AKOS024456491, SR-01000597391, J-011012, SR-01000597391-1, (S)-?-Amino-2',4'-dichloro-4-hydroxy-5-(phosphonomethyl)-[1,1'-biphenyl]-3-propanoic acid, [1,1'-Biphenyl]-3-propanoicacid,a-amino-2',4'-dichloro-4-hydroxy-5-(phosphonomethyl)-,(as)-. | |
SDZ 220-581 Quick inquiry Where to buy Suppliers range | SDZ 220-581 is a competitive NMDA receptor antagonist (pKi = 7.7). SDZ 220-581 was indicated a reverse effect on haloperidol-induced catalepsy in the rat model of Parkinson's disease. Synonyms: (S)-α-Amino-2'-chloro-5-(phosphonomethyl)[1,1'-biphenyl]-3-propanoic acid. Grades: ≥98% by HPLC. CAS No. 174575-17-8. Molecular formula: C16H17ClNO5P. Mole weight: 369.74. | |
SDZ285-428 Quick inquiry Where to buy Suppliers range | SDZ285-428 is a CYP24A1 inhibitor. Synonyms: SDZ285 428; 4-(4-chlorophenyl)-N-(2-imidazol-1-yl-2-phenylethyl)benzamide; NVP-VID-400; NVP VID 400; NVP-VID-400; NVP-VID 400; NVP-VID400; SDZ285428; SDZ 285428; SDZ-285428; SDZ285-428; SDZ 285-428; SDZ-285-428. CAS No. 174262-13-6. Molecular formula: C24H20ClN3O. Mole weight: 401,894. | |
Sdz ict 322 Quick inquiry Where to buy Suppliers range | Sdz ict 322. Group: Heterocyclic Organic Compound. CAS No. 122732-06-3. | |
SDZ NKT 343 Quick inquiry Where to buy Suppliers range | SDZ NKT 343 is a highly selective human tachykinin NK1 receptor antagonist (IC50 = 0.62 and 451 nM for human and rat receptors, respectively), displaying > 130-fold selectivity over human NK2 and NK3 receptors. SDZ NKT 343 was shown to antagonize SP-induced Ca2+ efflux in vitro and inhibit mechanical hyperalgesia in vivo. Uses: Neurokinin-1 receptor antagonists. Synonyms: 1-[[(2-Nitrophenyl)amino]carbonyl]-L-prolyl-N-methyl-3-(2-naphthalenyl)-N-(phenylmethyl)-L-alaninamide. Grades: ≥98% by HPLC. CAS No. 180046-99-5. Molecular formula: C33H33N5O5. Mole weight: 579.65. | |
SDZ NKT 343 Quick inquiry Where to buy Suppliers range | SDZ NKT 343. Group: Biochemicals. Grades: Purified. CAS No. 180046-99-5. Pack Sizes: 10mg. US Biological Life Sciences. | Worldwide |
SDZ SER 082 Quick inquiry Where to buy Suppliers range | SDZ SER 082. Group: Biochemicals. Alternative Names: (7aR,11aS)-rel-4,5,7a,8,9,10,11,11a-Octahydro-10-methyl-7H-indolo[1,7-bc][2,6]naphthyridine. Grades: Highly Purified. CAS No. 141474-54-6. Pack Sizes: 10mg. Molecular Formula: C15H20N2, Molecular Weight: 228.33. US Biological Life Sciences. | Worldwide |
SDZ SER 082 fumarate Quick inquiry Where to buy Suppliers range | SDZ SER 082 fumarate is a selective 5-HT2B/2C receptor antagonist with low affinity for 5-HT1A receptors. SDZ SER 082 fumarate inhibits [3H]-mesulergine binding to 5-HT2C receptors (pKD = 7.8), and suppresses 5-HT2B mediated responses in the rat fundus (pKB = 7.34). Synonyms: 7H-Indolo[1,7-bc][2,6]naphthyridine, 4,5,7a,8,9,10,11,11a-octahydro-10-methyl-, (7aR,11aS)-rel-, (2E)-2-butenedioate (1:1); (+)-cis-4,5,7a,8,9,10,11,11a-Octahydro-7H-10-methylindolo[1,7-bc][2,6]-naphthyridine fumarate; rel-(7aR,11aS)-4,5,7a,8,9,10,11,11a-Octahydro-10-methyl-7H-indolo[1,7-bc][2,6]naphthyridine fumarate; SDZ-SER 082 fumarate. Grades: ≥95%. CAS No. 1417343-80-6. Molecular formula: C15H20N2.C4H4O4. Mole weight: 344.41. | |
SDZ WAG 994 Quick inquiry Where to buy Suppliers range | SDZ WAG 994. Group: Biochemicals. Grades: Purified. CAS No. 130714-47-5. Pack Sizes: 10mg. US Biological Life Sciences. | Worldwide |
SDZ WAG 994 Quick inquiry Where to buy Suppliers range | SDZ WAG 994 is a potent and selective adenosine A1 receptor agonist (Ki = 23, > 10000 and 25000 nM for A1, A2A and A2B receptors, respectively). SDZ WAG 994 has been shown to lower blood pressure levels and heart rate in spontaneous hypertensive rats, and inhibit adenosine deaminase-stimulated lipolysis in rat adipocytes (Ki = 8 nM). Synonyms: Adenosine, N-cyclohexyl-2'-O-methyl-; N-Cyclohexyl-2'-O-methyladenosine; SDZ-WAG 994; WAG 994. Grades: ≥99% by HPLC. CAS No. 130714-47-5. Molecular formula: C17H25N5O4. Mole weight: 363.41. | |
Se-(4-Nitrobenzoyl)-6-selenoinosine Quick inquiry Where to buy Suppliers range | Se (4 Nitrobenzoyl) 6 selenoinosine. CAS No. 40144-12-5. | |
SE 563 Quick inquiry Where to buy Suppliers range | SE 563. Group: Biochemicals. Alternative Names: (4S)-6-Chloro-4-(2-cyclopropylethynyl)-1,4-dihydro-1-[(4-methoxyphenyl)methyl]-4-(trifluoromethyl)-2H-3,1-benzoxazin-2-one; (4S)-6-Chloro-4-(cyclopropylethynyl)-1,4-dihydro-1-[(4-methoxyphenyl)methyl]-4-(trifluoromethyl)-2H-3,1-benzoxazin-2-one; (S)-6-Chloro-4-(cyclopropylethynyl)-1,4-dihydro-1-[(4-methoxyphenyl)methyl]-4-(trifluoromethyl)-2H-3,1-benzoxazin-2-one. Grades: Highly Purified. CAS No. 174819-21-7. Pack Sizes: 10mg. Molecular Formula: C22H17ClF3NO3, Molecular Weight: 435.82. US Biological Life Sciences. | Worldwide |
SE 563 Quick inquiry Where to buy Suppliers range | SE 563. Uses: For analytical and research use. Group: Enzyme Activators, Inhibitors & Substrates. Alternative Names: 2H-3,1-Benzoxazin-2-one, 6-chloro-4-(2-cyclopropylethynyl)-1,4-dihydro-1-[(4-methoxyphenyl)methyl]-4-(trifluoromethyl)-, (4S)-, 2H-3,1-Benzoxazin-2-one, 6-chloro-4-(cyclopropylethynyl)-1,4-dihydro-1-[(4-methoxyphenyl)methyl]-4-(trifluoromethyl)-, (S)-, SE 563, 2H-3,1-Benzoxazin-2-one, 6-chloro-4-(cyclopropylethynyl)-1,4-dihydro-1-[(4-methoxyphenyl)methyl]-4-(trifluoromethyl)-, (4S)- (9CI). CAS No. 174819-21-7. Pack Sizes: 10MG. IUPAC Name: (4S)-6-chloro-4-(2-cyclopropylethynyl)-1-[(4-methoxyphenyl)methyl]-4-(trifluoromethyl)-3,1-benzoxazin-2-one. Molecular formula: C22H17ClF3NO3. Mole weight: 435.82. Catalog: APS174819217. SMILES: COc1ccc (CN2C (=O)O[C@@] (C#CC3CC3) (c4cc (Cl)ccc24)C (F) (F)F)cc1. Format: Neat. Shipping: Room Temperature. | |
Se +6 @ 100 μg/mL, Packaged as (4) 25mL Bottles Quick inquiry Where to buy Suppliers range | Se +6 @ 100 μg/mL, Packaged as (4) 25mL Bottles. Uses: For analytical and research use. Group: Aqueous Inorganic; Aqueous Inorganic. Alternative Names: Selenium(6+), Selenium, ion (Se6+),Selenium(+6) cation. Pack Sizes: 4 x 25ML. IUPAC Name: selenium(6+). Molecular formula: Se+6. Mole weight: 78.97. Catalog: APS012064. SMILES: [Se+6]. Format: Single Solution. Shipping: Room Temperature. | |
SEA0400 Quick inquiry Where to buy Suppliers range | SEA0400 is a selective inhibitior of Na+/Ca2+ exchanger. In an MPTP mouse model of Parkinson's disease, SEA0400 prevents dopaminergic neurotoxicity. It has an obvious suppressing effect on tachyarrhythmias induced by digitalis in in vivo canine models. Synonyms: 2-[4-[(2,5-difluorophenyl)methoxy]phenoxy]-5-ethoxyaniline 2-(4-((2,5-difluorophenyl)methoxy)phenoxy)-5-ethoxyaniline SEA 0400 SEA-0400 SEA0400. CAS No. 223104-29-8. Molecular formula: C21H19F2NO3. Mole weight: 371.38. | |
Sea buckthorn extract Quick inquiry Where to buy Suppliers range | Yellowish green or yellowish brown powder. Group: Material of health food. Grades: 10:1. CAS No. 90106-68-6. | |
Sea buckthorn Powder Quick inquiry Where to buy Suppliers range | Sea buckthorn powder takes sea buckthorn as raw material, adopts spray drying technology, low temperature physical grinding technology, instant grinding, to obtain edible high quality avocado powder. Uses: Used for research and manufacturing. Group: Flavor Enhancers. Grades: Food Grade. Product ID: CDF4-0230. | |
Sea Clean 2 Quick inquiry Where to buy Suppliers range | 5lt Pack Size. Group: Analytical Reagents. Prepack ID 90023807-5lt. See USA prepack pricing. | |
Sea Clean 2 (25lt) Quick inquiry Where to buy Suppliers range | 25lt Pack Size. Group: Analytical Reagents. Prepack ID 90023808-25lt. See USA prepack pricing. | |
Sea cucumber peptide Quick inquiry Where to buy Suppliers range | Sea cucumber peptide is a product of wild sea cucumber as raw material and processed by enzymatic hydrolysis technology. Sea cucumber peptide contains rich polypeptide, sea cucumber polysaccharide and other components. Uses: Used for research and manufacturing. Group: Protein Peptides. Product ID: CDF4-0247. | |
Sea Cucumber Powder & P.E. 25% (Mucopolysaccharides) Quick inquiry Where to buy Suppliers range | Sea Cucumber Powder & P.E. 25% (Mucopolysaccharides). | CA, FL & NJ |
SeaFerment SA Quick inquiry Where to buy Suppliers range | Active ingredient obtained through biotechnology from pseudo-alteromonas bacteria inhabiting extreme marine environments. Activity: Contains 25% active ingredient. Uses: Anti-aging & anti-wrinkle products, lip creams & gels, use twice daily for best results. Group: Skin Actives. CAS No. 7732-18-5 / 267233-41-0 / 69-72-7 / 77-92-9 / 54-21-7. Product ID: ACM7732185-16. Appearance: Clear liquid. | |
Sea salts Quick inquiry Where to buy Suppliers range | Sea salts. Group: Electrolytes. | |
Seawater certified reference material for trace metals and other constituents. Quick inquiry Where to buy Suppliers range | Seawater certified reference material for trace metals and other constituents. Uses: For analytical and research use. Group: Aqueous Inorganic; Aluminium Base; Metal alloys. Catalog: APS012065. | |
SEAWEED (bladderwrack) (trace elements) Quick inquiry Where to buy Suppliers range | SEAWEED (bladderwrack) (trace elements). Uses: For analytical and research use. Group: Process Materials, Geological, Cement & Soils. Catalog: APS012067. Format: Matrix Material. Shipping: Room Temperature. | |
Seaweed Oil Quick inquiry Where to buy Suppliers range | Seaweed (Fucus) oil is an oily extract produced by maceration of Fucus vesiculosis in sunflower oil (Helianthus annuus). Stabilized in ascorbyl palmitate. Uses: Anti-aging, photo-protection moisturizers, hair conditioners, shampoos, eye serums and sculpting creams. Group: Skin Actives. CAS No. 84696-13-9 / 8001-21-6. Product ID: ACM84696139-2. Appearance: Yellow oily liquid. | |
Seaweed powder Quick inquiry Where to buy Suppliers range | Seaweed powder is made of seaweed as raw material and processed by spray drying technology. Uses: Used for research and manufacturing. Group: Flavor Enhancers. Grades: Food Grade. Product ID: CDF4-0232. | |
Seaweed-Trace Elements and Arsenic Compound (Hijiki) Quick inquiry Where to buy Suppliers range | Seaweed-Trace Elements and Arsenic Compound (Hijiki). Uses: For analytical and research use. Group: Process Materials, Geological, Cement & Soils. Catalog: APS012066. | |
Sebacic acid Quick inquiry Where to buy Suppliers range | Sebacic acid is a white granular powder. Melting point 153°F. Slightly soluble in water. Sublimes slowly at 750 mm Hg when heated to melting point.;DryPowder; DryPowder, PelletsLargeCrystals; OtherSolid; PelletsLargeCrystals;Solid;WHITE POWDER WITH CHARACTERISTIC ODOUR. Group: Biobased Products. Alternative Names: 1,10-Decanedioic acid. Grades: 98%. CAS No. 111-20-6. Product ID: BBC111206. Molecular formula: C10H18O4. Mole weight: 202.25. IUPAC Name: Decanedioic acid. Appearance: Solid. Density: 1.21 g/cm³. SMILES: C(CCCCC(=O)O)CCCC(=O)O. | |
Sebacic acid Quick inquiry Where to buy Suppliers range | Sebacic acid. Group: Biochemicals. Grades: Highly Purified. CAS No. 111-20-6. Pack Sizes: 100g, 250g, 500g, 1kg, 2kg. Molecular Formula: HO2C(CH2)8CO2H. US Biological Life Sciences. | Worldwide |
Sebacic Acid Quick inquiry Where to buy Suppliers range | Sebacic Acid. We stock inventory in warehouses throughout the United States, allowing us to serve customers in all regions in a timely and cost effective manner. | California |
Sebacic Acid Quick inquiry Where to buy Suppliers range | Sebacic Acid. Category ACIDS. Pack Sizes Drums/ bags/ bulk | |
Sebacic acid, bis(2-ethylhexyl) ester Quick inquiry Where to buy Suppliers range | Food Contact Materials. Uses: For analytical and research use. Group: reagents. Alternative Names: Bis(2-ethylhexyl) sebacate, Bis(ethylhexyl) sebacate, DOS, BEHS, Neosolue-EHS, Octoil S, PX 438, Monoplex DOS, Trivent DOS, NSC 68878, Synative ES DEHS, Bisoflex,Decanedioic acid, bis(2-ethylhexyl) ester (9CI), Plexol 201J, Edenor DEHS, Bis(2-ethylhexyl) decanedioate, Decanedioic acid di(2-ethylhexyl) ester, Ergoplast SDO, Plexol, Di-2-ethylhexyl sebacate, Dioctyl sebacate, Plasthall DOS, Uniflex DOS, Edenol DOS 888, Hallstar DOS, Bisoflex DOS, Reomol DDS, Staflex DOS, Edenol 888, Jeetox T-5, Sansocizer DOS, Reolube DOS, Sebacic acid di-2-ethylhexyl diester, Sebacic acid di(2-ethylhexyl) ester, Sebacic acid, bis(2-ethylhexyl) ester (6CI,8CI). CAS No. 122-62-3. IUPAC Name: bis(2-ethylhexyl) decanedioate. | |
Sebacic acid, bis-n-butyl ester Quick inquiry Where to buy Suppliers range | Food Contact Materials; Standards for Food Regulatory Methods. Uses: For analytical and research use. Group: reagents. Alternative Names: Kodaflex DBS, NSC 3893, DBS, Polycizer DBS, PX 404, Dibutyl sebacate, Di-n-Butyl sebacate,Decanedioic acid, dibutyl ester (9CI), Staflex DBS, Ergoplast SDB, Sebacic acid di-n-butyl ester, Reomol DBS, Uniflex DBS, Sebacic acid, dibutyl ester (6CI,8CI), Bis(n-butyl) sebacate, Dibutyl decanedioate. CAS No. 109-43-3. IUPAC Name: dibutyl decanedioate. | |
Sebacic acid, diethyl ester Quick inquiry Where to buy Suppliers range | Food Contact Materials. Uses: For analytical and research use. Group: reagents. Alternative Names: Nikkol DES-SP,Decanedioic acid, diethyl ester (9CI), Diethyl sebacate, Sebacic acid, diethyl ester (6CI,8CI), Bisoflex DES, NSC 8911, SDE, Diethyl decanedioate, Ethyl sebacate, Diethyl 1,10-decanedioate. CAS No. 110-40-7. IUPAC Name: diethyl decanedioate. | |
Sebacoyl chloride Quick inquiry Where to buy Suppliers range | Sebacoyl chloride. Group: Biochemicals. Grades: Highly Purified. CAS No. 111-19-3. Pack Sizes: 250g, 500g, 1kg, 2kg, 5kg. US Biological Life Sciences. | Worldwide |
Sebacoyl chloride Quick inquiry Where to buy Suppliers range | 25g Pack Size. Group: Biochemicals, Building Blocks, Organics. Formula: ClCO(CH2)8COCl. CAS No. 111-19-3. Prepack ID 25445778-25g. Molecular Weight 239.14. See USA prepack pricing. | |
Sebacoyl Chloride Quick inquiry Where to buy Suppliers range | Sebacoyl Chloride. Group: Polymers. IUPAC Name: decanedioyl dichloride. Molecular Weight: 239.14g/mol. Molecular Formula: C10H16Cl2O2. SMILES: C(CCCCC(=O)Cl)CCCC(=O)Cl. InChI: InChI=1S/C10H16Cl2O2/c11-9(13)7-5-3-1-2-4-6-8-10(12)14/h1-8H2. InChIKey: WMPOZLHMGVKUEJ-UHFFFAOYSA-N. Melting Point: -2.5 ?. | |
Sebacoyl Chloride, 4%, Laboratory Grade, 100 mL Quick inquiry Where to buy Suppliers range | Formula: C10H16Cl2O2. Formula Weight: 239. 14. Characteristic: Clear; corrosive; fumes irritating to eyes; toxic by ingestion or inhalation. Storage Code: Red; flammable. Alternative Names: Sebacyl chloride. Grades: chem-grade laboratory. CAS No. 111-19-3. Product ID: 887302. -- SOLD FOR EDUCATIONAL USE ONLY -- | |
SEB Domain 144-153 Quick inquiry Where to buy Suppliers range | SEB Domain 144-153 is Staphylococcal Enterotoxin B domain amino acid residue 144-153. SEB Domain 144-153 inhibits transcytosis of multiple staphylococcal enterotoxins, SEA, SEE, and TSST-1. Staphylococcal enterotoxin B (SEB) is a toxin produced by Staphylococcus aureus. Uses: Peptide Inhibitors. CAS No. 210229-94-0. Product ID: R1668. | |
Sebetralstat Quick inquiry Where to buy Suppliers range | Sebetralstatum is a kallikrein inhibitor. Synonyms: N-[(3-fluoro-4-methoxypyridin-2-yl)methyl]-3-(methoxymethyl)-1-({4-[(2-oxopyridin-1(2H)-yl)methyl]phenyl}methyl)-1H-pyrazole-4-carboxamide. Grades: >98%. CAS No. 1933514-13-6. Molecular formula: C26H26FN5O4. Mole weight: 491.5. |