A directory of where to buy chemicals in the USA, including: distributors, industrial manufacturers, bulk supplies and wholesalers of raw ingredients & finished goods.
recombinant, expressed in E. coli, ?98% (SDS-PAGE), ?98% (HPLC), suitable for cell culture. Group: Fluorescence/luminescence spectroscopy.
SDF-1α (human)
SDF-1α (human) is a synthetic peptide containing a 1:50 ratio of BSA (low levels of endotoxins) and is a multifunctional cytokine signaling through CXCR4. SDF-1α is involved in many pathological conditions such as rheumatoid arthritis, pulmonary fibrosis, metastasis and leukemia cell progression. Internalization of SDF-1α dependence of CXCR4 HIV coreceptor contributes to inhibition of HIV replication. Synonyms: Stromal Cell-Derived Factor-1α (human); H-Lys-Pro-Val-Ser-Leu-Ser-Tyr-Arg-Cys-Pro-Cys-Arg-Phe-Phe-Glu-Ser-His-Val-Ala-Arg-Ala-Asn-Val-Lys-His-Leu-Lys-Ile-Leu-Asn-Thr-Pro-Asn-Cys-Ala-Leu-Gln-Ile-Val-Ala-Arg-Leu-Lys-Asn-Asn-Asn-Arg-Gln-Val-Cys-Ile-Asp-Pro-Lys-Leu-Lys-Trp-Ile-Gln-Glu-Tyr-Leu-Glu-Lys-Ala-Leu-Asn-Lys-OH (Disulfide bridge: Cys9-Cys34, Cys11-Cys50). Grade: ≥95%. CAS No. 1268129-65-2. Molecular formula: C356H578N106O93S4. Mole weight: 7959.43.
SDF-1 ALPHA human
Animal-component free, recombinant, expressed in E. coli, ?98% (SDS-PAGE), ?98% (HPLC). Group: Fluorescence/luminescence spectroscopy.
SDF-1beta (CXCL12) from mouse
recombinant, expressed in E. coli, ?98% (SDS-PAGE), ?98% (HPLC). Group: Fluorescence/luminescence spectroscopy.
SDF-1 beta from rat
recombinant, expressed in E. coli, ?95% (SDS-PAGE), ?95% (HPLC), suitable for cell culture. Group: Fluorescence/luminescence spectroscopy.
SDF-1 BETA human
Animal-component free, recombinant, expressed in E. coli, ?98% (SDS-PAGE), ?98% (HPLC). Group: Fluorescence/luminescence spectroscopy.
SDG
SDG. Group: Biochemicals. CAS No. 158932-33-3. Pack Sizes: 5mg. US Biological Life Sciences.
Worldwide
SDGRG
SDGRG has been used as a control peptide which does not affect integrin function, in various studies. Synonyms: S-D-G-R-G; H-SER-ASP-GLY-ARG-GLY-OH. Grade: >95%. CAS No. 108608-63-5. Molecular formula: C17H30N8O9. Mole weight: 490.5.
S-Diclofenac
S-Diclofenac is a hybrid molecule of an H 2 S donor and the NSAID diclofenac. S-Diclofenac spares the gastric mucosa of injury despite markedly suppressing prostaglandin synthesis [1]. Uses: Scientific research. Group: Signaling pathways. Alternative Names: ACS 15; ATB-337. CAS No. 912758-00-0. Pack Sizes: 10 mM * 1 mL; 5 mg; 10 mg; 25 mg; 50 mg; 100 mg. Product ID: HY-15035.
S- (Di methyl carbamoyl methyl ) O,O-Dimethyl Ester Phosphorodithioic Acid-d6. Group: Biochemicals. Alternative Names: O,O-dimethyl Ester Phosphorodithioic Acid S-Ester with 2-Mercapto-N,N-dimethylacetamide-d6. Grades: Highly Purified. Pack Sizes: 5mg. Molecular Formula: C6H8D6NO3PS2, Molecular Weight: 249.32. US Biological Life Sciences.
Worldwide
S-Diphenylmethyl-L-cysteine
The S-diphenylmethyl group is one of the most effective S-protecting groups for cysteine. Synonyms: L-Cys(Dpm)-OH; (R)-2-Amino-3-(Benzhydrylthio)Propanoic Acid. Grade: ≥ 99% (TLC). CAS No. 5191-80-0. Molecular formula: C16H17NO2S. Mole weight: 287.38.
S-Diphenylmethyl-L-cysteine
S-Diphenylmethyl-L-cysteine. Group: Biochemicals. Alternative Names: L-Cys(Dpm)-OH. Grades: Highly Purified. CAS No. 5191-80-0. Pack Sizes: 500mg, 1g. US Biological Life Sciences.
Worldwide
S-Diphenylmethyl-L-cysteine 99+% (TLC)
S-Diphenylmethyl-L-cysteine 99+% (TLC). Group: Biochemicals. Grades: Reagent Grade. Pack Sizes: 250mg, 1g. US Biological Life Sciences.
Worldwide
sDLL-1 human
recombinant, expressed in HEK 293 cells, ?95% (SDS-PAGE), ?95% (HPLC), suitable for cell culture. Group: Fluorescence/luminescence spectroscopy.
sDLL-4 human
recombinant, expressed in HEK 293 cells, ?95% (SDS-PAGE), ?95% (HPLC), suitable for cell culture. Group: Fluorescence/luminescence spectroscopy.
SDM25N hydrochloride
SDM25N hydrochloride. Group: Biochemicals. Grades: Purified. CAS No. 342884-71-3. Pack Sizes: 10mg, 50mg. US Biological Life Sciences.
Worldwide
SDMA
SDMA (Symmetric dimethylarginine) is an endogenous inhibitor of nitric oxide ( NO ) synthase activity. SDMA, a novel kidney biomarker, permits earlier diagnosis of kidney disease than traditional creatinine testing. Uses: Scientific research. Group: Natural products. Alternative Names: Symmetric dimethylarginine; NG,NG'-Dimethyl-L-arginine. CAS No. 30344-00-4. Pack Sizes: 10 mM * 1 mL; 5 mg; 10 mg; 25 mg; 50 mg; 100 mg. Product ID: HY-101410.
SDS (Sodium dodecyl sulfate)
500g Pack Size. Group: Detergents. Formula: C12H25NaO4S. CAS No. 151-21-3. Prepack ID 15171947-500g. Molecular Weight 288.38. See USA prepack pricing.
SDS (Sodium dodecyl sulfate)
1kg Pack Size. Group: Detergents. Formula: C12H25NaO4S. CAS No. 151-21-3. Prepack ID 15171947-1kg. Molecular Weight 288.38. See USA prepack pricing.
SDS (Sodium dodecyl sulfate) Ultrapure
500g Pack Size. Group: Biochemicals, Detergents, Reagents. Formula: C12H26O4S.Na. CAS No. 151-21-3. Prepack ID 10325163-500g. Molecular Weight 288.38. See USA prepack pricing.
SDS (Sodium dodecyl sulfate) Ultrapure
100g Pack Size. Group: Biochemicals, Detergents, Reagents. Formula: C12H26O4S.Na. CAS No. 151-21-3. Prepack ID 10325163-100g. Molecular Weight 288.38. See USA prepack pricing.
SDU-071
SDU-071 is a potent and orally active inhibitor of BRD4-p53 inhibitor. SDU-071 inhibits MDA-MB-231 cells proliferation with an IC50 of 10.5 ?M. SDU-071 induces cell cycle arrest and apoptosis[1]. Uses: Scientific research. Group: Signaling pathways. CAS No. 3036109-10-8. Pack Sizes: 5 mg; 10 mg; 25 mg. Product ID: HY-162352.
SDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS
SDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS is a 32-amino acid peptide. Synonyms: Ser-Asp-Val-Ser-Lys-Gln-Met-Glu-Glu-Glu-Ala-Val-Arg-Leu-Phe-Ile-Glu-Trp-Leu-Lys-Asn-Gly-Gly-Pro-Ser-Ser-Gly-Ala-Pro-Pro-Pro-Ser. Grade: >98%. Molecular formula: C151H236N40O50S. Mole weight: 3443.84.
SDZ 205-557 hydrochloride
SDZ 205-557 hydrochloride. Group: Biochemicals. Grades: Purified. CAS No. 1197334-02-3. Pack Sizes: 10mg, 50mg. US Biological Life Sciences.
SE 563. Group: Biochemicals. Alternative Names: (4S)-6-Chloro-4-(2-cyclopropylethynyl)-1,4-dihydro-1-[(4-methoxyphenyl)methyl]-4-(trifluoromethyl)-2H-3,1-benzoxazin-2-one; (4S)-6-Chloro-4-(cyclopropylethynyl)-1,4-dihydro-1-[(4-methoxyphenyl)methyl]-4-(trifluoromethyl)-2H-3,1-benzoxazin-2-one; (S)-6-Chloro-4-(cyclopropylethynyl)-1,4-dihydro-1-[(4-methoxyphenyl)methyl]-4-(trifluoromethyl)-2H-3,1-benzoxazin-2-one. Grades: Highly Purified. CAS No. 174819-21-7. Pack Sizes: 10mg. Molecular Formula: C22H17ClF3NO3, Molecular Weight: 435.82. US Biological Life Sciences.
Worldwide
SE-7552
SE-7552, a 2-(difluoromethyl)-1,3,4-oxadiazole (DFMO) derivative, is an orally active, highly selective, non-hydroxamate HDAC6 inhibitor with an IC50 of 33 nM. SE-7552 is greater than 850-fold selectivity versus all other known HDAC isozymes. SE-7552 is capable of blocking multiple myeloma growth in vivo. SE-7552 acts as an anti-obesity agent in diet-induced obese mice[1][2]. Uses: Scientific research. Group: Signaling pathways. CAS No. 2243575-79-1. Pack Sizes: 10 mM * 1 mL; 5 mg; 10 mg; 25 mg; 50 mg; 100 mg. Product ID: HY-161305.
SEA0400 is a novel and selective inhibitor of the Na+-Ca2+ exchanger (NCX), inhibiting Na+-dependent Ca2+ uptake in cultured neurons, astrocytes, and microglia with IC50s of from 5 to 33 nM. Uses: Scientific research. Group: Signaling pathways. CAS No. 223104-29-8. Pack Sizes: 10 mM * 1 mL; 2 mg; 5 mg; 10 mg; 50 mg; 100 mg. Product ID: HY-15515.
Sea buckthorn extract
Sea buckthorn extract. Uses: Designed for use in research and industrial production. Product Category: Material of health food. Appearance: Yellowish green or yellowish brown powder. CAS No. 90106-68-6. Product ID: ACM90106686. Alfa Chemistry ISO 9001:2015 Certified.
Sea buckthorn powder takes sea buckthorn as raw material, adopts spray drying technology, low temperature physical grinding technology, instant grinding, to obtain edible high quality avocado powder. Product ID: CDF4-0230. Category: Flavour. Product Keywords: Flavor Enhancers; Sea buckthorn Powder; CDF4-0230; Flavour;. Grade: Food Grade. Color: Aurantium powder. Physical State: powder. Storage: Room Temperature. Applications: Sea buckthorn powder has good fluidity, good taste, easy to dissolve, easy to preserve, widely used in health nutrition, infant food, solid drinks.
Seabuckthorn Powder
Seabuckthorn powder is a kind of pure natural active components extracted from seabuckthorn seeds with high nutrition and economic value. The nutrient component of seabuckthorn fruit juice powder is plentiful which including multiple kinds of vitamin, fatty acid, microelement, flavone compounds and many kinds of amino acid needed by human bodies. Group: Others. Seabuckthorn Powder; Hippophae rhamnoides L. Cat No: EXTC-084.
Sea Buckthorn Powder
Sea buckthorn Powder is fresh squeezed juice, made by spray drying. Seabuckthorn contains all the nutrients. Sea buckthorn is rich in protein, 20 kinds of amino acids it contains, including eight kinds of essential amino acids. Its VC content is called "king of fruits", the content of vitamin E is 30 times yarn soybean oil, vitamin B1 is 2 times strawberries; others also contains vitamin B2, vitamin P, folic acid, and trace elements and leaves amides unsaturated fatty acids. Group: Others. Sea Buckthorn Powder. Cat No: EXTC-145.
Sea Clean 2
5lt Pack Size. Group: Analytical Reagents. Prepack ID 90023807-5lt. See USA prepack pricing.
Sea Clean 2 (25lt)
25lt Pack Size. Group: Analytical Reagents. Prepack ID 90023808-25lt. See USA prepack pricing.
Sea cucumber peptide is a product of wild sea cucumber as raw material and processed by enzymatic hydrolysis technology. Sea cucumber peptide contains rich polypeptide, sea cucumber polysaccharide and other components. Product ID: CDF4-0247. Category: Protein peptide. Product Keywords: Protein Peptides; Sea cucumber peptide; CDF4-0247; Protein peptide;. Applications: It is widely used in food, cosmetics and medicine.
SEAWEED (bladderwrack) (trace elements). Uses: For analytical and research use. Group: Process materials, geological, cement & soils. Catalog: APS012067. Format: Matrix Material. Shipping: Room Temperature.
Seaweed powder
Seaweed powder is made of seaweed as raw material and processed by spray drying technology. Product ID: CDF4-0232. Category: Flavour. Product Keywords: Flavor Enhancers; Seaweed powder; CDF4-0232; Flavour;. Grade: Food Grade. Color: Black green powder. Physical State: powder. Storage: Room Temperature. Applications: Seaweed contains A large amount of vitamin A and vitamin E, as well as a small amount of vitamin C, but also contains about 15% of minerals, widely used in a variety of functional foods, health products to improve the taste.
Sebacic acid
Sebacic acid. Group: Biochemicals. Grades: Highly Purified. CAS No. 111-20-6. Pack Sizes: 100g, 250g, 500g, 1kg, 2kg. Molecular Formula: HO2C(CH2)8CO2H. US Biological Life Sciences.
Worldwide
Sebacic acid
Sebacic acid is a white granular powder. Melting point 153°F. Slightly soluble in water. Sublimes slowly at 750 mm Hg when heated to melting point.;DryPowder; DryPowder, PelletsLargeCrystals; OtherSolid; PelletsLargeCrystals;Solid;WHITE POWDER WITH CHARACTERISTIC ODOUR. Group: Monomers. Alternative Names: 1,10-Decanedioic acid. CAS No. 111-20-6. Product ID: Decanedioic acid. Molecular formula: 202.25. Mole weight: C10H18O4. C(CCCCC(=O)O)CCCC(=O)O. InChI=1S/C10H18O4/c11-9 (12)7-5-3-1-2-4-6-8-10 (13)14/h1-8H2, (H, 11, 12) (H, 13, 14). CXMXRPHRNRROMY-UHFFFAOYSA-N. 98%.
Sebacic Acid. We stock inventory in warehouses throughout the United States, allowing us to serve customers in all regions in a timely and cost effective manner.
California
Sebacic Acid
Sebacic acid is an alpha,omega-dicarboxylic acid that is the 1,8-dicarboxy derivative of octane. It has a role as a human metabolite and a plant metabolite. It is an alpha,omega-dicarboxylic acid and a dicarboxylic fatty acid. It is a conjugate acid of a sebacate(2-) and a sebacate. It derives from a hydride of a decane. Alternative Names: DECANEDIOIC ACID. 1,8-Octanedicarboxylic acid. 1,10-Decanedioic acid. CAS No. 111-20-6. Product ID: CHE111206. Molecular formula: C10H18O4. Mole weight: 202.25. EINECS: 203-845-5. SMILES: C(CCCCC(=O)O)CCCC(=O)O. Appearance: white granular powder. Category: Acid.
Sebacic Acid 111-20-6
Sebacic Acid - Surface Coatings. SUPPLIERS TO BUSINESS CUSTOMERS ONLY.
Sebacic acid,compound with 2,2-iminodiethanol. Uses: Designed for use in research and industrial production. Additional or Alternative Names: EINECS 303-497-5; Sebacic acid,compound with 2,2-iminodiethanol; EINECS 282-256-5. Product Category: Heterocyclic Organic Compound. CAS No. 84145-30-2. Molecular formula: C14H29NO6. Mole weight: 307.3832. Purity: 0.96. IUPACName: decanedioic acid;2-(2-hydroxyethylamino)ethanol. Canonical SMILES: C(CCCCC(=O)O)CCCC(=O)O.C(CO)NCCO. Density: g/cm³. ECNumber: 303-497-5. Product ID: ACM84145302. Alfa Chemistry ISO 9001:2015 Certified.
Sebacic acid dioctyl ester
Sebacic acid dioctyl ester. Uses: Designed for use in research and industrial production. Additional or Alternative Names: Propionic Acid Benzyl Ester; benzyl propanoate; Benzyl Propionate. Product Category: Heterocyclic Organic Compound. Appearance: Colorless & Clear liquid. CAS No. 122-63-3. Molecular formula: C10H12O2. Mole weight: 164.201. Purity: 0.96. IUPACName: Benzyl propionate. Density: 1.031. Product ID: ACM122633. Alfa Chemistry ISO 9001:2015 Certified.
Sebacoyl chloride
Sebacoyl chloride. Group: Biochemicals. Grades: Highly Purified. CAS No. 111-19-3. Pack Sizes: 250g, 500g, 1kg, 2kg, 5kg. US Biological Life Sciences.
Worldwide
Sebacoyl chloride
25g Pack Size. Group: Biochemicals, Building Blocks, Organics. Formula: ClCO(CH2)8COCl. CAS No. 111-19-3. Prepack ID 25445778-25g. Molecular Weight 239.14. See USA prepack pricing.
Formula: C10H16Cl2O2. Formula Weight: 239. 14. Characteristic: Clear; corrosive; fumes irritating to eyes; toxic by ingestion or inhalation. Storage Code: Red; flammable. Alternative Names: Sebacyl chloride. Grades: chem-grade laboratory. CAS No. 111-19-3. Product ID: 887302. -- SOLD FOR EDUCATIONAL USE ONLY --
SEB Domain 144-153
SEB Domain 144-153, the 144-153 amino acid residues of the staphylococcal enterotoxin B (SEB) domain, inhibits transcytosis of multiple staphylococcal enterotoxins, SEA, SEE and TSST-1. SEB is a toxin produced by Staphylococcus aureus. Synonyms: Lys-Lys-Lys-Val-Thr-Ala-Gln-Glu-Leu-Asp; L-lysyl-L-lysyl-L-lysyl-L-valyl-L-threonyl-L-alanyl-L-glutaminyl-L-glutamyl-L-leucyl-L-aspartic acid. Grade: ≥95%. CAS No. 210229-94-0. Molecular formula: C50H90N14O17. Mole weight: 1159.33.
Sebetralstat
Sebetralstat (KVD900) is a plasma kallikrein inhibitor (WO2016083820). Sebetralstat can be used for the research of metabolic diseases [1]. Uses: Scientific research. Group: Signaling pathways. Alternative Names: KVD900. CAS No. 1933514-13-6. Pack Sizes: 10 mM * 1 mL; 5 mg; 10 mg; 25 mg; 50 mg; 100 mg. Product ID: HY-132830.
SEC induces activation of ANXA7 GTPase via the AMPK/mTORC1/STAT3 signaling pathway. SEC selectively promotes apoptosis in cancer cells, expressing a high level of ITGB4 by inducing ITGB4 nuclear translocation [1] [2]. Uses: Scientific research. Group: Signaling pathways. CAS No. 1802997-81-4. Pack Sizes: 10 mM * 1 mL; 5 mg; 10 mg; 25 mg; 50 mg; 100 mg. Product ID: HY-125355.
Secalciferol
A metabolite of Vitamin D, a possibly anti-inflammatory steroid. Group: Biochemicals. Grades: Highly Purified. CAS No. 55721-11-4. Pack Sizes: 1mg. US Biological Life Sciences.