A directory of where to buy chemicals in the USA, including: distributors, industrial manufacturers, bulk supplies and wholesalers of raw ingredients & finished goods.
Search for products or services, then visit the suppliers website for prices or more information.
| Product | Description | |
|---|---|---|
| S-Diphenylmethyl-L-cysteine | S-Diphenylmethyl-L-cysteine. Group: Biochemicals. Alternative Names: L-Cys(Dpm)-OH. Grades: Highly Purified. CAS No. 5191-80-0. Pack Sizes: 500mg, 1g. US Biological Life Sciences. |  Worldwide |
| S-Diphenylmethyl-L-cysteine | The S-diphenylmethyl group is one of the most effective S-protecting groups for cysteine. Synonyms: L-Cys(Dpm)-OH; (R)-2-Amino-3-(Benzhydrylthio)Propanoic Acid. Grades: ≥ 99% (TLC). CAS No. 5191-80-0. Molecular formula: C16H17NO2S. Mole weight: 287.38. |  |
| S-Diphenylmethyl-L-cysteine 99+% (TLC) | S-Diphenylmethyl-L-cysteine 99+% (TLC). Group: Biochemicals. Grades: Reagent Grade. Pack Sizes: 250mg, 1g. US Biological Life Sciences. | Worldwide |
| SDM25N hydrochloride | SDM25N hydrochloride. Group: Biochemicals. Grades: Purified. CAS No. 342884-71-3. Pack Sizes: 10mg, 50mg. US Biological Life Sciences. | Worldwide |
| SDM25N hydrochloride | SDM25N is a highly selective non-peptide δ receptor antagonist. Synonyms: SDM25N HCl; (4bS,8R,8aS,14bR)-5,6,7,8,14,14b-Hexahydro-7-(2-methyl-2-propenyl)-4,8-methanobenzofuro[2,3-a]pyrido[4,3-b]carbazole-1,8a(9H)-diol hydrochloride. Grades: ≥99% by HPLC. CAS No. 342884-71-3. Molecular formula: C26H26N2O3·HCl. Mole weight: 450.96. | |
| SDMA | SDMA (Symmetric dimethylarginine) is an endogenous inhibitor of nitric oxide ( NO ) synthase activity. SDMA, a novel kidney biomarker, permits earlier diagnosis of kidney disease than traditional creatinine testing. Uses: Scientific research. Group: Natural products. Alternative Names: Symmetric dimethylarginine; NG,NG'-Dimethyl-L-arginine. CAS No. 30344-00-4. Pack Sizes: 10 mM * 1 mL; 5 mg; 10 mg; 25 mg; 50 mg; 100 mg. Product ID: HY-101410. |  |
| SDMA | An endogenous inhibitor of nitric oxide (NO) synthase activity. Synonyms: (2S) -2-amino-5-[ (N, N'-dimethylcarbamimidoyl) amino]pentanoic acid; guanidino-N(1),N(2)-dimethylarginine; N(G1),N(G2)-dimethylarginine; N,N'-dimethylarginine; NG,N'G-dimethyl-L-arginine; omega-N(G),N'(G)-dimethylarginine; sDMA arginine; symmetric dimethylarginine. CAS No. 30344-00-4. Molecular formula: C8H18N4O2. Mole weight: 202.25. | |
| S-Doxazosin | (S)-(+)-Doxazosin is an Isomer of Doxazosin Mesylate. Synonyms: (S)-1-(4-Amino-6,7-dimethoxy-2-quinazolinyl)-4-[(2,3-dihydro-1,4-benzodioxin-2-yl)carbonyl]-piperazine; 1-(4-Amino-6,7-dimethoxy-2-quinazolinyl)-4-[[(2S)-2,3-dihydro-1,4-benzodioxin-2-yl]carbonyl]piperazine. Grades: > 95%. CAS No. 104874-86-4. Molecular formula: C23H25N5O5. Mole weight: 451.48. | |
| SDS (Sodium dodecyl sulfate) | 1kg Pack Size. Group: Detergents. Formula: C12H25NaO4S. CAS No. 151-21-3. Prepack ID 15171947-1kg. Molecular Weight 288.38. See USA prepack pricing. |  |
| SDS (Sodium dodecyl sulfate) | 500g Pack Size. Group: Detergents. Formula: C12H25NaO4S. CAS No. 151-21-3. Prepack ID 15171947-500g. Molecular Weight 288.38. See USA prepack pricing. | |
| SDS (Sodium dodecyl sulfate) Ultrapure | 500g Pack Size. Group: Biochemicals, Detergents, Reagents. Formula: C12H26O4S.Na. CAS No. 151-21-3. Prepack ID 10325163-500g. Molecular Weight 288.38. See USA prepack pricing. | |
| SDS (Sodium dodecyl sulfate) Ultrapure | 100g Pack Size. Group: Biochemicals, Detergents, Reagents. Formula: C12H26O4S.Na. CAS No. 151-21-3. Prepack ID 10325163-100g. Molecular Weight 288.38. See USA prepack pricing. | |
| SDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS | SDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS is a 32-amino acid peptide. Synonyms: Ser-Asp-Val-Ser-Lys-Gln-Met-Glu-Glu-Glu-Ala-Val-Arg-Leu-Phe-Ile-Glu-Trp-Leu-Lys-Asn-Gly-Gly-Pro-Ser-Ser-Gly-Ala-Pro-Pro-Pro-Ser. Grades: >98%. Molecular formula: C151H236N40O50S. Mole weight: 3443.84. | |
| SDZ 205-557 hydrochloride | SDZ 205-557 hydrochloride. Group: Biochemicals. Grades: Purified. CAS No. 1197334-02-3. Pack Sizes: 10mg, 50mg. US Biological Life Sciences. | Worldwide |
| SDZ 205-557 hydrochloride | SDZ 205-557 hydrochloride is a 5-HT3/5-HT4 receptor antagonist that can promote intestinal peristalsis and gastric emptying. Synonyms: 4-Amino-5-chloro-2-methoxybenzoic acid 2-(diethylamino)ethyl ester hydrochloride; 2-(diethylamino)ethyl 4-amino-5-chloro-2-methoxybenzoate hydrochloride. Grades: ≥99% by HPLC. CAS No. 1197334-02-3. Molecular formula: C14H21ClN2O3.HCl. Mole weight: 337.25. | |
| SDZ 21009 | SDZ 21009 is a β-adrenoceptor and 5-HT1A/1B receptor antagonist (pKB/pA2 = 8.3 and 8.0 for 5-HT1A and 5-HT1B receptors, respectively). Synonyms: Carpindolol; LM 21009; LM-21009; LM21009; SDZ 21009; SDZ21009; SDZ-21009; 4-[3-[(1,1-Dimethylethyl)amino]-2-hydroxypropoxy]-1H-indole-2-carboxylic acid, 1-methylethyl ester. CAS No. 39731-05-0. Molecular formula: C19H28N2O4. Mole weight: 348.44. | |
| SDZ 21009 | SDZ 21009. Group: Biochemicals. Grades: Purified. CAS No. 39731-05-0. Pack Sizes: 10mg, 50mg. US Biological Life Sciences. | Worldwide |
| SDZ 220-040 | SDZ 220-040 is a potent competitive antagonist at the NMDA receptor (pKi = 8.5). Synonyms: SDZ 220-040; SDZ220-040; SDZ-220-040; (S)-α-Amino-2',4'-dichloro-4-hydroxy-5-(phosphonomethyl)-[1,1'-biphenyl]-3-propanoic acid. CAS No. 174575-40-7. Molecular formula: C16H16Cl2NO6P. Mole weight: 420.19. | |
| SDZ 220-581 | SDZ 220-581 is a competitive NMDA receptor antagonist (pKi = 7.7). SDZ 220-581 was indicated a reverse effect on haloperidol-induced catalepsy in the rat model of Parkinson's disease. Synonyms: (S)-α-Amino-2'-chloro-5-(phosphonomethyl)[1,1'-biphenyl]-3-propanoic acid. Grades: ≥98% by HPLC. CAS No. 174575-17-8. Molecular formula: C16H17ClNO5P. Mole weight: 369.74. | |
| SDZ 220-581 | SDZ 220-581 is an orally active, potent, competitive NMDA receptor antagonist with pK i value of 7.7 [1]. Uses: Scientific research. Group: Signaling pathways. CAS No. 174575-17-8. Pack Sizes: 10 mM * 1 mL; 5 mg; 10 mg; 25 mg; 50 mg. Product ID: HY-13059. | |
| SDZ 220-581 hydrochloride | SDZ 220-581 hydrochloride is an orally active, potent, competitive NMDA receptor antagonist with pK i value of 7.7 [1]. Uses: Scientific research. Group: Signaling pathways. CAS No. 179411-93-9. Pack Sizes: 10 mM * 1 mL; 5 mg; 10 mg; 50 mg. Product ID: HY-13059B. | |
| SDZ285-428 | SDZ285-428 is a CYP24A1 inhibitor. Synonyms: SDZ285 428; 4-(4-chlorophenyl)-N-(2-imidazol-1-yl-2-phenylethyl)benzamide; NVP-VID-400; NVP VID 400; NVP-VID-400; NVP-VID 400; NVP-VID400; SDZ285428; SDZ 285428; SDZ-285428; SDZ285-428; SDZ 285-428; SDZ-285-428. CAS No. 174262-13-6. Molecular formula: C24H20ClN3O. Mole weight: 401,894. | |
| Sdz 880-431 | Heterocyclic Organic Compound. CAS No. 101662-30-0. Catalog: ACM101662300. |  |
| Sdz ict 322 | Heterocyclic Organic Compound. CAS No. 122732-06-3. Catalog: ACM122732063. | |
| Sdz mks 492 | Heterocyclic Organic Compound. CAS No. 114606-56-3. Catalog: ACM114606563. | |
| SDZ NKT 343 | SDZ NKT 343. Group: Biochemicals. Grades: Purified. CAS No. 180046-99-5. Pack Sizes: 10mg. US Biological Life Sciences. | Worldwide |
| SDZ NKT 343 | SDZ NKT 343 is a highly selective human tachykinin NK1 receptor antagonist (IC50 = 0.62 and 451 nM for human and rat receptors, respectively), displaying > 130-fold selectivity over human NK2 and NK3 receptors. SDZ NKT 343 was shown to antagonize SP-induced Ca2+ efflux in vitro and inhibit mechanical hyperalgesia in vivo. Uses: Neurokinin-1 receptor antagonists. Synonyms: 1-[[(2-Nitrophenyl)amino]carbonyl]-L-prolyl-N-methyl-3-(2-naphthalenyl)-N-(phenylmethyl)-L-alaninamide. Grades: ≥98% by HPLC. CAS No. 180046-99-5. Molecular formula: C33H33N5O5. Mole weight: 579.65. | |
| SDZ SER 082 | SDZ SER 082. Group: Biochemicals. Alternative Names: (7aR,11aS)-rel-4,5,7a,8,9,10,11,11a-Octahydro-10-methyl-7H-indolo[1,7-bc][2,6]naphthyridine. Grades: Highly Purified. CAS No. 141474-54-6. Pack Sizes: 10mg. Molecular Formula: C15H20N2, Molecular Weight: 228.33. US Biological Life Sciences. | Worldwide |
| SDZ SER 082 fumarate | SDZ SER 082 fumarate is a selective 5-HT2B/2C receptor antagonist with low affinity for 5-HT1A receptors. SDZ SER 082 fumarate inhibits [3H]-mesulergine binding to 5-HT2C receptors (pKD = 7.8), and suppresses 5-HT2B mediated responses in the rat fundus (pKB = 7.34). Synonyms: 7H-Indolo[1,7-bc][2,6]naphthyridine, 4,5,7a,8,9,10,11,11a-octahydro-10-methyl-, (7aR,11aS)-rel-, (2E)-2-butenedioate (1:1); (+)-cis-4,5,7a,8,9,10,11,11a-Octahydro-7H-10-methylindolo[1,7-bc][2,6]-naphthyridine fumarate; rel-(7aR,11aS)-4,5,7a,8,9,10,11,11a-Octahydro-10-methyl-7H-indolo[1,7-bc][2,6]naphthyridine fumarate; SDZ-SER 082 fumarate. Grades: ≥95%. CAS No. 1417343-80-6. Molecular formula: C15H20N2.C4H4O4. Mole weight: 344.41. | |
| SDZ WAG 994 | SDZ WAG 994 is a potent and selective adenosine A1 receptor agonist (Ki = 23, > 10000 and 25000 nM for A1, A2A and A2B receptors, respectively). SDZ WAG 994 has been shown to lower blood pressure levels and heart rate in spontaneous hypertensive rats, and inhibit adenosine deaminase-stimulated lipolysis in rat adipocytes (Ki = 8 nM). Synonyms: Adenosine, N-cyclohexyl-2'-O-methyl-; N-Cyclohexyl-2'-O-methyladenosine; SDZ-WAG 994; WAG 994. Grades: ≥99% by HPLC. CAS No. 130714-47-5. Molecular formula: C17H25N5O4. Mole weight: 363.41. | |
| SDZ WAG 994 | SDZ WAG 994. Group: Biochemicals. Grades: Purified. CAS No. 130714-47-5. Pack Sizes: 10mg. US Biological Life Sciences. | Worldwide |
| SE 563 | SE 563. Group: Biochemicals. Alternative Names: (4S)-6-Chloro-4-(2-cyclopropylethynyl)-1,4-dihydro-1-[(4-methoxyphenyl)methyl]-4-(trifluoromethyl)-2H-3,1-benzoxazin-2-one; (4S)-6-Chloro-4-(cyclopropylethynyl)-1,4-dihydro-1-[(4-methoxyphenyl)methyl]-4-(trifluoromethyl)-2H-3,1-benzoxazin-2-one; (S)-6-Chloro-4-(cyclopropylethynyl)-1,4-dihydro-1-[(4-methoxyphenyl)methyl]-4-(trifluoromethyl)-2H-3,1-benzoxazin-2-one. Grades: Highly Purified. CAS No. 174819-21-7. Pack Sizes: 10mg. Molecular Formula: C22H17ClF3NO3, Molecular Weight: 435.82. US Biological Life Sciences. | Worldwide |
| SEA0400 | SEA0400 is a selective inhibitior of Na+/Ca2+ exchanger. In an MPTP mouse model of Parkinson's disease, SEA0400 prevents dopaminergic neurotoxicity. It has an obvious suppressing effect on tachyarrhythmias induced by digitalis in in vivo canine models. Synonyms: 2-[4-[(2,5-difluorophenyl)methoxy]phenoxy]-5-ethoxyaniline 2-(4-((2,5-difluorophenyl)methoxy)phenoxy)-5-ethoxyaniline SEA 0400 SEA-0400 SEA0400. CAS No. 223104-29-8. Molecular formula: C21H19F2NO3. Mole weight: 371.38. | |
| Sea Buckthorn Extract | Contains the juice concentrate of sea buckthorn fruits (Hippophae Rhamnoides L.) dissolved in water and glycerin. Sea buckthorn is mainly collected in Eastern Europe. The fruit juice is obtained by squeezing the ripe berries and then filtered and concentrated by distillation at low temperatures. Uses: Serums, creams & lotions, skin cleansers, sun- and after-sun care, sunscreens, face & hair masks. Group: Skin actives. CAS No. 7732-18-5 / 56-81-5 / 90106-68-6 / 532-32-1 / 24634-61-5. Appearance: Orange-brown to brown clear liquid, characteristic odor. Catalog: CI-SC-0919. | |
| Sea Buckthorn Extract (Ratio) | Sea Buckthorn Extract (Ratio). Group: Others. Purity: 4:1~20:1. Sea Buckthorn Extract (Ratio). Cat No: EXTW-076. |  |
| Sea buckthorn Powder | Sea buckthorn powder takes sea buckthorn as raw material, adopts spray drying technology, low temperature physical grinding technology, instant grinding, to obtain edible high quality avocado powder. Product ID: CDF4-0230. Category: Flavour. Product Keywords: Flavor Enhancers; Sea buckthorn Powder; CDF4-0230; Flavour;. Grade: Food Grade. Color: Aurantium powder. Physical State: powder. Storage: Room Temperature. Applications: Sea buckthorn powder has good fluidity, good taste, easy to dissolve, easy to preserve, widely used in health nutrition, infant food, solid drinks. |  |
| Seabuckthorn Powder | Seabuckthorn powder is a kind of pure natural active components extracted from seabuckthorn seeds with high nutrition and economic value. The nutrient component of seabuckthorn fruit juice powder is plentiful which including multiple kinds of vitamin, fatty acid, microelement, flavone compounds and many kinds of amino acid needed by human bodies. Group: Others. Seabuckthorn Powder; Hippophae rhamnoides L. Cat No: EXTC-084. | |
| Sea Buckthorn Powder | Sea buckthorn Powder is fresh squeezed juice, made by spray drying. Seabuckthorn contains all the nutrients. Sea buckthorn is rich in protein, 20 kinds of amino acids it contains, including eight kinds of essential amino acids. Its VC content is called "king of fruits", the content of vitamin E is 30 times yarn soybean oil, vitamin B1 is 2 times strawberries; others also contains vitamin B2, vitamin P, folic acid, and trace elements and leaves amides unsaturated fatty acids. Group: Others. Sea Buckthorn Powder. Cat No: EXTC-145. | |
| Sea Clean 2 | 5lt Pack Size. Group: Analytical Reagents. Prepack ID 90023807-5lt. See USA prepack pricing. | |
| Sea Clean 2 (25lt) | 25lt Pack Size. Group: Analytical Reagents. Prepack ID 90023808-25lt. See USA prepack pricing. | |
| Sea Cucumber Extract | Sea Cucumber Extract. Group: Others. Purity: 5:1,10:1, 20:1. or polysaccharide 50%, 60%. Appearance: Brown powder. Sea Cucumber Extract. Cat No: EXTC-127. | |
| Sea cucumber peptide | Sea cucumber peptide is a product of wild sea cucumber as raw material and processed by enzymatic hydrolysis technology. Sea cucumber peptide contains rich polypeptide, sea cucumber polysaccharide and other components. Product ID: CDF4-0247. Category: Protein peptide. Product Keywords: Protein Peptides; Sea cucumber peptide; CDF4-0247; Protein peptide;. Applications: It is widely used in food, cosmetics and medicine. | |
| Sea Cucumber Powder & P.E. 25% (Mucopolysaccharides) | Sea Cucumber Powder & P.E. 25% (Mucopolysaccharides). |  CA, FL & NJ |
| Sea Fennel Extract | Sea fennel is a hardy plant that grows on rocky beaches and between pebbles; it has fleshy green leaves and yellow/green flowers. Contains 20% extract dissolved in water and glycerin. Uses: Creams, serums, eye-creams, lotions, sun and after-sun products. masks, gels and cleansers. Group: Skin actives. CAS No. 56-81-5 / 7732-18-5 / 89997-98-8 / 122-99-6. Appearance: Medium to dark amber liquid, characteristic odor. Catalog: CI-SC-0689. | |
| SeaFerment SA | Active ingredient obtained through biotechnology from pseudo-alteromonas bacteria inhabiting extreme marine environments. Activity: Contains 25% active ingredient. Uses: Anti-aging & anti-wrinkle products, lip creams & gels, use twice daily for best results. Group: Skin actives. CAS No. 7732-18-5 / 267233-41-0 / 69-72-7 / 77-92-9 / 54-21-7. Appearance: Clear liquid. Catalog: CI-SC-0761. | |
| Sea Kelp Extract | Kelp seaweed is a member of the brown algae family (phaeophyta). Root, stem and leaves have been used in this extract. Contains 20% extract dissolved in water and glycerin. Sea kelp can be found in the colder coastal waters of North America. Uses: Anti-aging creams, serums and face masks, hair treatments, root treatment and shampoos. Group: Skin actives. CAS No. 56-81-5 / 7732-18-5 / 347174-92-9 / 122-99-6. Appearance: Light to medium amber liquid, characteristic odor. Catalog: CI-SC-0657. | |
| Sea Kelp Extract, USDA Certified Organic | Organic sea kelp. Seaweed is a member of the brown algae family (phaeophyta). Root, stem and leaves have been used in this extract. Sea kelp can be found in the colder coastal waters of North America. Contains 20% extract dissolved in glycerin. Uses: Anti-aging creams, serums and face masks, hair treatments, root treatment and shampoos. Group: Skin actives. CAS No. 56-81-5/90046-12-1/92128-82-0. Appearance: Colorless, odorless, viscous liquid. Catalog: CI-SC-0709. | |
| Sea Minerals Complex | Sea minerals complex is an extract composed of fucus vesiculosus, algae extract and sea salt. Promoting calming, soothing, emollient and moisturizing effects for the skin. Uses: Moisturizers, serums, toners and skin cleansers. Group: Skin actives. CAS No. 57-55-6 / 7732-18-5 / 7647-14-5 / 84696-13-9 / 90046-12-1 / 92128-82-0 / 90046-13-2. Catalog: CI-SC-0713. | |
| Sea salts | Sea salts. Group: Electrolytes. |  |
| SEAWEED (bladderwrack) (trace elements) | SEAWEED (bladderwrack) (trace elements). Uses: For analytical and research use. Group: Process materials, geological, cement & soils. Catalog: APS012067. Format: Matrix Material. Shipping: Room Temperature. |  |
| Seaweed Oil | Seaweed (Fucus) oil is an oily extract produced by maceration of Fucus vesiculosis in sunflower oil (Helianthus annuus). Stabilized in ascorbyl palmitate. Uses: Anti-aging, photo-protection moisturizers, hair conditioners, shampoos, eye serums and sculpting creams. Group: Skin actives. CAS No. 84696-13-9/8001-21-6. Appearance: Yellow oily liquid. Catalog: CI-SC-0998. | |
| Seaweed powder | Seaweed powder is made of seaweed as raw material and processed by spray drying technology. Product ID: CDF4-0232. Category: Flavour. Product Keywords: Flavor Enhancers; Seaweed powder; CDF4-0232; Flavour;. Grade: Food Grade. Color: Black green powder. Physical State: powder. Storage: Room Temperature. Applications: Seaweed contains A large amount of vitamin A and vitamin E, as well as a small amount of vitamin C, but also contains about 15% of minerals, widely used in a variety of functional foods, health products to improve the taste. | |
| Sebacic acid | Sebacic acid is a white granular powder. Melting point 153°F. Slightly soluble in water. Sublimes slowly at 750 mm Hg when heated to melting point.;DryPowder; DryPowder, PelletsLargeCrystals; OtherSolid; PelletsLargeCrystals;Solid;WHITE POWDER WITH CHARACTERISTIC ODOUR. Group: Monomers. Alternative Names: 1,10-Decanedioic acid. CAS No. 111-20-6. Product ID: Decanedioic acid. Molecular formula: 202.25. Mole weight: C10H18O4. C(CCCCC(=O)O)CCCC(=O)O. InChI=1S/C10H18O4/c11-9 (12)7-5-3-1-2-4-6-8-10 (13)14/h1-8H2, (H, 11, 12) (H, 13, 14). CXMXRPHRNRROMY-UHFFFAOYSA-N. 98%. | |
| Sebacic acid | Sebacic acid. Group: Biochemicals. Grades: Highly Purified. CAS No. 111-20-6. Pack Sizes: 100g, 250g, 500g, 1kg, 2kg. Molecular Formula: HO2C(CH2)8CO2H. US Biological Life Sciences. | Worldwide |
| Sebacic Acid | Sebacic Acid. Category ACIDS. Pack Sizes Drums/ bags/ bulk |  |
| Sebacic Acid | Sebacic Acid. We stock inventory in warehouses throughout the United States, allowing us to serve customers in all regions in a timely and cost effective manner. |  California |
| Sebacic Acid 111-20-6 | Sebacic Acid - Surface Coatings. SUPPLIERS TO BUSINESS CUSTOMERS ONLY. |  North America & APAC |
| Sebacic acid, bis(2-ethylhexyl) ester | Food Contact Materials. Uses: For analytical and research use. Group: Reagents. Alternative Names: Bis(2-ethylhexyl) sebacate, Bis(ethylhexyl) sebacate, DOS, BEHS, Neosolue-EHS, Octoil S, PX 438, Monoplex DOS, Trivent DOS, NSC 68878, Synative ES DEHS, Bisoflex,Decanedioic acid, bis(2-ethylhexyl) ester (9CI), Plexol 201J, Edenor DEHS, Bis(2-ethylhexyl) decanedioate, Decanedioic acid di(2-ethylhexyl) ester, Ergoplast SDO, Plexol, Di-2-ethylhexyl sebacate, Dioctyl sebacate, Plasthall DOS, Uniflex DOS, DOS 888, Hallstar DOS, Bisoflex DOS, Reomol DDS, Staflex DOS, 888, Jeetox T-5, Sansocizer DOS, Reolube DOS, Sebacic acid di-2-ethylhexyl diester, Sebacic acid di(2-ethylhexyl) ester, Sebacic acid, bis(2-ethylhexyl) ester (6CI,8CI). CAS No. 122-62-3. IUPAC Name: bis(2-ethylhexyl) decanedioate. | |
| Sebacic acid dioctyl ester | Heterocyclic Organic Compound. Alternative Names: Propionic Acid Benzyl Ester; benzyl propanoate; Benzyl Propionate. CAS No. 122-63-3. Molecular formula: C10H12O2. Mole weight: 164.201. Appearance: Colorless & Clear liquid. Purity: 0.96. IUPACName: Benzyl propionate. Density: 1.031. Catalog: ACM122633. | |
| Sebacic dihydrazide | Heterocyclic Organic Compound. Alternative Names: SEBACIC DIHYDRAZIDE;SEBACIC ACID DIHYDRAZIDE;SEBACOHYDRAZIDE;AKOS BBS-00001041;1,8-OCTANEDICARBOXYLIC ACID DIHYDRAZIDE; DECANEDIOHYDRAZIDE; DECANEDIOIC ACID DIHYDRAZIDE;Decanedihydrazide. CAS No. 125-83-7. Molecular formula: C10H22N4O2. Mole weight: 230.31. Density: 1.082g/cm³. Catalog: ACM125837. | |
| Sebacoyl chloride | Sebacoyl chloride. Group: Biochemicals. Grades: Highly Purified. CAS No. 111-19-3. Pack Sizes: 250g, 500g, 1kg, 2kg, 5kg. US Biological Life Sciences. | Worldwide |
| Sebacoyl chloride | 25g Pack Size. Group: Biochemicals, Building Blocks, Organics. Formula: ClCO(CH2)8COCl. CAS No. 111-19-3. Prepack ID 25445778-25g. Molecular Weight 239.14. See USA prepack pricing. | |
| Sebacoyl Chloride | Sebacoyl Chloride. Group: Polymers. Product ID: decanedioyl dichloride. Molecular formula: 239.14g/mol. Mole weight: C10H16Cl2O2. C(CCCCC(=O)Cl)CCCC(=O)Cl. InChI=1S/C10H16Cl2O2/c11-9 (13)7-5-3-1-2-4-6-8-10 (12)14/h1-8H2. WMPOZLHMGVKUEJ-UHFFFAOYSA-N. | |
| Sebacoyl Chloride, 4%, Laboratory Grade, 100 mL | Formula: C10H16Cl2O2. Formula Weight: 239. 14. Characteristic: Clear; corrosive; fumes irritating to eyes; toxic by ingestion or inhalation. Storage Code: Red; flammable. Alternative Names: Sebacyl chloride. Grades: chem-grade laboratory. CAS No. 111-19-3. Product ID: 887302. -- SOLD FOR EDUCATIONAL USE ONLY -- |  |
| Sebetralstat | Sebetralstat (KVD900) is a plasma kallikrein inhibitor (WO2016083820). Sebetralstat can be used for the research of metabolic diseases [1]. Uses: Scientific research. Group: Signaling pathways. Alternative Names: KVD900. CAS No. 1933514-13-6. Pack Sizes: 10 mM * 1 mL; 5 mg; 10 mg; 25 mg; 50 mg; 100 mg. Product ID: HY-132830. | |
| Sebetralstat | Sebetralstatum is a kallikrein inhibitor. Synonyms: N-[(3-fluoro-4-methoxypyridin-2-yl)methyl]-3-(methoxymethyl)-1-({4-[(2-oxopyridin-1(2H)-yl)methyl]phenyl}methyl)-1H-pyrazole-4-carboxamide. Grades: >98%. CAS No. 1933514-13-6. Molecular formula: C26H26FN5O4. Mole weight: 491.5. | |
| Sebriplatin | Heterocyclic Organic Compound. Alternative Names: Sebriplatin, CID60407, CI-973, NK 121, NK-121, (+)-cis-(1,1-Cyclobutanedicarboxylato)((2R)-2-methyl-1,4-butanediamine-N,N)platinum, (Z)-(Cyclobutane-1,1-dicarboxylato)((R)-2-methyl-1,4-butanediammine)platinum(II), cis-1,1-Cyclobutanedicarboxylato-(2R)-2-methyl-1,4-butanediammineplatinum(II), Platinum(II), (cyclobutane-1,1-dicarboxylato)((R)-2-methyl-1,4-butanediammine)-, (Z)-, 110172-45-7. CAS No. 110172-45-7. Molecular formula: C11H20N2O4Pt. Mole weight: 439.37. Purity: 0.96. IUPACName: cyclobutane-1,1-dicarboxylic acid; (2R)-2-methylbutane-1,4-diamine; platinum. Catalog: ACM110172457. | |
| Sebum-REG | Botanical polyphenol-rich complex from argania spinosa kernel extract (argan oil), serenoa serrulata fruit extract and sesamum indicum (sesame) seed extract. High content of lignans & phytosterols to control sebum production. Uses: Skin care products such as light emulsions or cream-gels, moisturizers, foundations. Group: Skin actives. CAS No. 299184-75-1 / 84604-15-9 / 8008-74-0 / 83-46-5. Appearance: Clear, yellow-orange, viscous liquid. Catalog: CI-SC-0622. | |
| Sebuthylazine-d5 (ethyl-d5) | 2H Labeled Compounds. CAS No. 1219805-56-7. Mole weight: 234.74. Catalog: ACM1219805567. | |
| SEC | SEC induces activation of ANXA7 GTPase via the AMPK/mTORC1/STAT3 signaling pathway. SEC selectively promotes apoptosis in cancer cells, expressing a high level of ITGB4 by inducing ITGB4 nuclear translocation [1] [2]. Uses: Scientific research. Group: Signaling pathways. CAS No. 1802997-81-4. Pack Sizes: 10 mM * 1 mL; 5 mg; 10 mg; 25 mg; 50 mg; 100 mg. Product ID: HY-125355. | |
Our database is helping our users find suppliers everyday.
