A directory of where to buy chemicals in the USA, including: distributors, industrial manufacturers, bulk supplies and wholesalers of raw ingredients & finished goods.
Search for products or services, then visit the suppliers website for prices or more information.
| Product | Description | |
|---|---|---|
| SD-36 | SD-36 is a potent and efficacious STAT3 PROTAC degrader (Kd=~50 nM), and demonstrates high selectivity over other STAT members. SD-36 also effectively degrades mutated STAT3 proteins in cells and suppresses the transcriptional activity of STAT3 (IC50=10 nM). SD-36 exerts robust anti-tumor activity, and achieves complete and long-lasting tumor regression in mouse tumor models. SD-36 is composed of the STAT3 inhibitor SI-109, a linker, and an analog of Cereblon ligand Lenalidomide for E3 ubiquitin ligase[1]. SD-36 is a click chemistry reagent, it contains an Alkyne group and can undergo copper-catalyzed azide-alkyne cycloaddition (CuAAc) with molecules containing Azide groups. Uses: Scientific research. Group: Signaling pathways. CAS No. 2429877-44-9. Pack Sizes: 1 mg; 5 mg; 10 mg; 25 mg. Product ID: HY-129602. |  |
| SD-6 | SD-6 is an orally active inhibitor of hAChE and hBChE with IC 50 values of 0.907 μM and 1.579 μM, respectively. SD-6 has excellent blood-brain barrier (BBB) permeability and no neurotoxicity, which can be used for research on Alzheimer's disease [1]. Uses: Scientific research. Group: Signaling pathways. CAS No. 744206-31-3. Pack Sizes: 10 mM * 1 mL; 5 mg; 10 mg; 25 mg; 50 mg; 100 mg. Product ID: HY-149212. | |
| SD-70 | SD-70 is an inhibitor for histone demethylase JMJD2C and exhibits antitumor efficacy. SD-70 inhibits viability of cancer cells CWR22Rv1 (9% cell survival at 10 μM), PC3 (14% cell survival at 2 μM) and DU145 (26% cell survival at 2 μM) [1]. Uses: Scientific research. Group: Signaling pathways. CAS No. 332173-89-4. Pack Sizes: 10 mM * 1 mL; 5 mg; 10 mg; 25 mg; 50 mg; 100 mg. Product ID: HY-121522. | |
| SD Agar | for microbiology. Group: Fluorescence/luminescence spectroscopy. |  |
| SDDC-0001190 | SDDC-0001190 is an inhibitor of dihydrofolate reductase (DHFR) uesd for the treatment of Mycobacterium tuberculosis (MTB). In a previous study, SDDC-0001190 showed high selectivity, low toxicity as well as decent pharmacokinetics with half-life 3.1 h and bioavailability 26%. Uses: The treatment of mycobacterium tuberculosis (mtb). Synonyms: SDDC 0001190; SDDC0001190. |  |
| S-Decyanomethyl-S-(1-methyl-1H-tetrazol-5-yl) cefmetazole | S-Decyanomethyl-S-(1-methyl-1H-tetrazol-5-yl) cefmetazole. Group: Biochemicals. Alternative Names: (6R-cis)-7-Methoxy-7-[[[(1-methyl-1H-tetrazol-5-yl)thio]acetyl]amino]-3-[[(1-methyl-1H-tetrazol-5-yl)thio]methyl]-8-oxo-5-thia-1-azabicyclo[4.2.0]oct-2-ene-2-carboxylic acid. Grades: Highly Purified. CAS No. 74228-11-8. Pack Sizes: 5mg, 10mg, 25mg, 50mg, 100mg. Molecular Formula: C15H18N10O5S3. US Biological Life Sciences. |  Worldwide |
| S-Decyanomethyl-S-(1-methyl-1H-tetrazol-5-yl) Cefmetazole | Cefmetazole derivative as bactericide cephalosporin. Synonyms: (6R-cis)-7-Methoxy-7-[[[(1-methyl-1H-tetrazol-5-yl)thio]acetyl]amino]-3-[[(1-methyl-1H-tetrazol-5-yl)thio]methyl]-8-oxo-5-thia-1-azabicyclo[4.2.0]oct-2-ene-2-carboxylic Acid Sodium Salt. Grades: > 95%. CAS No. 74228-11-8. Molecular formula: C15H18N10O5S3. Mole weight: 514.57. | |
| S-DECYLGLUTATHIONE | Synonyms: S-DECYLGLUTATHIONE. CAS No. 102814-04-0. Molecular formula: C20H37N3O6S. Mole weight: 447.59. | |
| S-Deoxo-3,17 β-bis-(O-tetrahydro-2H-pyran-2-yl)-6-oxo-fulvestrant | Fulvestrant impurity E derivative. Used in the preparation of antiestrogenic 17-alkylene-16α-hydroxyestratrienes for cancer treatment. Group: Biochemicals. Alternative Names: 7-[9-[ (4, 4, 5, 5, 5-Pentafluoropentyl) sulfenyl]nonyl]--3, 17 β-bis-(O-tetrahydro-2H-pyran-2-yl)estra-1,3,5(10)-triene-6-one. Grades: Highly Purified. CAS No. 862700-70-7. Pack Sizes: 5mg. US Biological Life Sciences. | Worldwide |
| S-Deoxo-3,17β-bis-(O-tetrahydro-2H-pyran-2-yl)-6-oxo-fulvestrant | S-Deoxo-3,17β-bis-(O-tetrahydro-2H-pyran-2-yl)-6-oxo-fulvestrant is an impurity of Fulvestrant, which is a selective estrogen receptor degrader (SERD) used to treat hormone receptor (HR)-positive metastatic breast cancer in postmenopausal women. Synonyms: 7-[9-[(4,4,5,5,5-Pentafluoropentyl)sulfenyl]nonyl]-3,17β-bis-(O-tetrahydro-2H-pyran-2-yl)estra-1,3,5(10)-triene-6-one; (17β)-7-{9-[(4,4,5,5,5-Pentafluoropentyl)sulfanyl]nonyl}-3,17-bis(tetrahydro-2H-pyran-2-yloxy)estra-1,3,5(10)-trien-6-one; Estra-1,3,5(10)-trien-6-one, 7-[9-[(4,4,5,5,5-pentafluoropentyl)thio]nonyl]-3,17-bis[(tetrahydro-2H-pyran-2-yl)oxy]-, (17β)-. Grades: ≥95%. CAS No. 862700-70-7. Molecular formula: C42H61F5O5S. Mole weight: 772.99. | |
| S-Deoxo-3,17-bis-(O-tetrahydro-2H-pyran-2-yl)-6-hydroxy-fulvestrant | Fulvestrant impurity E derivative. Group: Biochemicals. Alternative Names: 7-[9-[ (4, 4, 5, 5, 5-Pentafluoropentyl) sulfenyl]nonyl]estra-1, 3, 5 (10) -triene-6-ol-3, 17 β-bis-(O-tetrahydro-2H-pyran-2-yl). Grades: Highly Purified. Pack Sizes: 1mg. US Biological Life Sciences. | Worldwide |
| S-Deoxo-3,17-bis-(O-tetrahydro-2H-pyran-2-yl)-6-hydroxy-fulvestrant | S-Deoxo-3,17-bis-(O-tetrahydro-2H-pyran-2-yl)-6-hydroxy-fulvestrant is an impurity of Fulvestrant, which is a selective estrogen receptor degrader (SERD) used to treat hormone receptor (HR)-positive metastatic breast cancer in postmenopausal women. Synonyms: (7S,8R,9S,13S,14S,17S)-13-methyl-7-(9-((4,4,5,5,5-pentafluoropentyl)thio)nonyl)-3,17-bis((tetrahydro-2H-pyran-2-yl)oxy)-7,8,9,11,12,13,14,15,16,17-decahydro-6H-cyclopenta[a]phenanthren-6-ol; 7-[9-[ (4, 4, 5, 5, 5-Pentafluoropentyl) sulfenyl]nonyl]estra-1, 3, 5 (10) -triene-6-ol-3, 17β -bis- (O-tetrahydro-2H-pyran-2-yl). Grades: >98%. Molecular formula: C42H63F5O5S. Mole weight: 775.00. | |
| S-Deoxo-3-Keto-17-Acetoxy Fulvestrant | S-Deoxo-3-Keto-17-Acetoxy Fulvestrant is an intermediate of Fulvestrant, which is a drug for breast cancer. Synonyms: (7α,17β)-17-(Acetyloxy)-7-[9-[(4,4,5,5,5-pentafluoropentyl)thio]nonyl]-estr-4-en-3-one; (7R,8R,9S,10R,13S,14S,17S)-13-Methyl-3-oxo-7-(9-((4,4,5,5,5-pentafluoropentyl)thio)nonyl)-2,3,6,7,8,9,10,11,12,13,14,15,16,17-tetradecahydro-1H-cyclopenta[a]phenanthren-17-yl Acetate. Grades: ≥95%. CAS No. 415927-29-6. Molecular formula: C34H51F5O3S. Mole weight: 634.82. | |
| S-Deoxo ?6-Fulvestrant | Fulvestrant impurity E derivative. Group: Biochemicals. Alternative Names: 7-[9-[ (4, 4, 5, 5, 5-Pentafluoropentyl) sulfenyl]nonyl]estra-1, 3, 5 (10) , 6-tetraene-3, 17 β-diol; S-Deoxo Fulvestrant Impurity E. Grades: Highly Purified. Pack Sizes: 1mg. US Biological Life Sciences. | Worldwide |
| S-Deoxo ?6-Fulvestrant | S-Deoxo ?6-Fulvestrant is an impurity of Fulvestrant, which is a drug for breast cancer. Synonyms: 7-[9-[ (4, 4, 5, 5, 5-Pentafluoropentyl) sulfenyl]nonyl]estra-1, 3, 5 (10) , 6-tetraene-3, 17β -diol; S-Deoxo Fulvestrant Impurity E. CAS No. 2170200-16-3. Molecular formula: C32H45F5O2S. Mole weight: 588.75. | |
| S-Deoxo-6-oxo-fulvestrant | S-Deoxo-6-oxo-fulvestrant. Uses: For analytical and research use. Group: Impurity standards. Pack Sizes: 2.5MG. Catalog: APS012062. Format: Neat. Shipping: Room Temperature. | |
| S-Deoxo-6-oxo-fulvestrant | S-Deoxo-6-oxo-fulvestrant is an impurity of Fulvestrant, which is a selective estrogen receptor degrader (SERD) used to treat hormone receptor (HR)-positive metastatic breast cancer in postmenopausal women. Synonyms: (7α,17β)-3,17-Dihydroxy-7-[9-[(4,4,5,5,5-pentafluoropentyl)thio]nonyl]-estra-1,3,5(10)-trien-6-one; Estra-1,3,5(10)-trien-6-one, 3,17-dihydroxy-7-[9-[(4,4,5,5,5-pentafluoropentyl)thio]nonyl]-, (7α,17β)-; (7α , 17β ) -3, 17-Dihydroxy-7-{9-[ (4, 4, 5, 5, 5-pentafluoropentyl) sulfanyl]nonyl}estra-1, 3, 5 (10) -trien-6-one. Grades: ≥95%. CAS No. 1107606-70-1. Molecular formula: C32H45F5O3S. Mole weight: 604.75. | |
| S-Deoxo-6-oxo-fulvestrant | Fulvestrant impurity E derivative. Used in the preparation of steroids precursor with hormonal activity. Group: Biochemicals. Alternative Names: (7α,17 β ) -3, 17-Dihydroxy-7-[9-[ (4, 4, 5, 5, 5-pentafluoropentyl) thio]nonyl]-estra-1, 3, 5 (10) -trien-6-one. Grades: Highly Purified. CAS No. 1107606-70-1. Pack Sizes: 2.5mg. US Biological Life Sciences. | Worldwide |
| S-Deoxo Fulvestrant | S-Deoxo Fulvestrant is a derivative of Fulvestrant, an estrogen receptor antagonist used as a medication indicated for the treatment of hormone receptor (HR)-positive metastatic breast cancer in postmenopausal women. Synonyms: (7a,17b)-7-[9-[(4,4,5,5,5-Pentafluoropentyl)thio]nonyl]-estra-1,3,5(10)-triene-3,17-diol. Grades: 95%. CAS No. 153004-31-0. Molecular formula: C32H47F5O2S. Mole weight: 590.77. | |
| S-(+)-Deprenyl Hydrochloride | (N,a-dimethyl-N-2-propynylbenzeneethanamine). less active enantiomer, water soluble. CAS No. 4528-52-3. Product ID: 1-01043. Molecular formula: C13H17N. Mole weight: 223.75. Purity: 0.98. |  |
| S-Des[2-(1-methyl-2-pyrrolidinyl)ethyl]amine S-Hydroxy Udenafil | S-Des[2-(1-methyl-2-pyrrolidinyl)ethyl]amine S-Hydroxy Udenafil is a metabolite of Udenafil. Udenafil is a PDE5 inhibitor used for the treatment of erectile dysfunction. Synonyms: Udenafil Impurity 1; 3-(1-Methyl-7-oxo-3-propyl-6,7-dihydro-1H-pyrazolo[4,3-d]pyrimidin-5-yl)-4-propoxybenzenesulfonic Acid. Molecular formula: C18H22N4O5S. Mole weight: 406.46. | |
| S-Desethylpiperidino S-[2-Carboxyl-2-oxo-ethyl-(2-aminoethyl)amino] Vardenafil | An impurity of Vardenafil. Vardenafil is a PDE5 inhibitor used for the treatment of erectile dysfunction. Synonyms: Vardenafil Impurity 4; 2- [ [2- [ [ [3- (1, 4-Dihydro-5-methyl-4-oxo-7-propylimidazo [5, 1-f] [1, 2, 4] triazin-2-yl) -4-ethoxyphenyl] sulfonyl] amino] ethyl] amino] -2-oxoacetic Acid; [ [2- [ [ [3- (1, 4-Dihydro-5-methyl-4-oxo-7-propylimidazo [5, 1-f] [1, 2, 4] triazin-2-yl) -4-ethoxyphenyl] sulfonyl] amino] ethyl] amino] oxoacetic Acid; Vardenafil Oxoacetic Acid Impurity. CAS No. 448184-56-3. Molecular formula: C21H26N6O7S. Mole weight: 506.54. | |
| S-Desmethyl Citalopram Hydrochloride | A metabolite of Citalopram, an inhibitor of serotonin (5-HT) uptake. Used as an antidepressant. Group: Biochemicals. Alternative Names: 1S)-1-(4-Fluorophenyl)-1,3-dihydro-1-[3-(methylamino)propyl]-5-isobenzo-furancarbonitrile Hydrochloride; (S)-1-(3-Methylaminopropyl)-1-(4-fluorophenyl)-1,3-dihydroisobenzofuran-5-carbonitrile Hydrochloride. Grades: Highly Purified. Pack Sizes: 1mg. US Biological Life Sciences. | Worldwide |
| S-Desmethyl-S-(2-hydroxy-2-methylpropyl) Rosuvastatin Sodium Salt | S-Desmethyl-S-(2-hydroxy-2-methylpropyl) Rosuvastatin Sodium Salt. Uses: For analytical and research use. Group: Impurity standards. Alternative Names: (3R,5S,6E)-7-[4-(4-Fluorophenyl)-2-[[(2-hydroxy-2-methylpropyl)sulfonyl]methylamino]-6-(1-methylethyl)-5-pyrimidinyl]-3,5-dihydroxy-6-heptenoic Acid Sodium Salt (1:1), Rosuvastatin Calcium Imp. A (EP) as Sodium Salt. CAS No. 1714147-50-8. Pack Sizes: 10MG. IUPAC Name: sodium;(E,3R,5S)-7-[4-(4-fluorophenyl)-2-[(2-hydroxy-2-methylpropyl)sulfonyl-methylamino]-6-propan-2-ylpyrimidin-5-yl]-3,5-dihydroxyhept-6-enoate. Molecular formula: C25H33FN3O7S.Na. Mole weight: 561.60. Catalog: APS1714147508. SMILES: [Na+].CC(C)c1nc(nc(c2ccc(F)cc2)c1\C=C\[C@@H](O)C[C@@H](O)CC(=O)[O-])N(C)S(=O)(=O)CC(C)(C)O. Format: Neat. Shipping: Room Temperature. | |
| S-Desmethyl-S-(2-hydroxy-2-methylpropyl) Rosuvastatin tert-Butyl Ester | S-Desmethyl-S-(2-hydroxy-2-methylpropyl) Rosuvastatin tert-Butyl Ester. Uses: For analytical and research use. Group: Impurity standards. Pack Sizes: 10MG. Catalog: APS012063. Format: Neat. Shipping: Room Temperature. | |
| SDF-1alpha (CXCL12) from mouse | recombinant, expressed in E. coli, ?99% (SDS-PAGE), ?99% (HPLC). Group: Fluorescence/luminescence spectroscopy. | |
| SDF-1 alpha from rat | recombinant, expressed in E. coli, ?98% (SDS-PAGE), ?98% (HPLC), suitable for cell culture. Group: Fluorescence/luminescence spectroscopy. | |
| SDF-1α (human) | SDF-1α (human) is a synthetic peptide containing a 1:50 ratio of BSA (low levels of endotoxins) and is a multifunctional cytokine signaling through CXCR4. SDF-1α is involved in many pathological conditions such as rheumatoid arthritis, pulmonary fibrosis, metastasis and leukemia cell progression. Internalization of SDF-1α dependence of CXCR4 HIV coreceptor contributes to inhibition of HIV replication. Synonyms: Stromal Cell-Derived Factor-1α (human); H-Lys-Pro-Val-Ser-Leu-Ser-Tyr-Arg-Cys-Pro-Cys-Arg-Phe-Phe-Glu-Ser-His-Val-Ala-Arg-Ala-Asn-Val-Lys-His-Leu-Lys-Ile-Leu-Asn-Thr-Pro-Asn-Cys-Ala-Leu-Gln-Ile-Val-Ala-Arg-Leu-Lys-Asn-Asn-Asn-Arg-Gln-Val-Cys-Ile-Asp-Pro-Lys-Leu-Lys-Trp-Ile-Gln-Glu-Tyr-Leu-Glu-Lys-Ala-Leu-Asn-Lys-OH (Disulfide bridge: Cys9-Cys34, Cys11-Cys50). Grades: ≥95%. CAS No. 1268129-65-2. Molecular formula: C356H578N106O93S4. Mole weight: 7959.43. | |
| SDF-1 ALPHA human | Animal-component free, recombinant, expressed in E. coli, ?98% (SDS-PAGE), ?98% (HPLC). Group: Fluorescence/luminescence spectroscopy. | |
| SDF-1beta (CXCL12) from mouse | recombinant, expressed in E. coli, ?98% (SDS-PAGE), ?98% (HPLC). Group: Fluorescence/luminescence spectroscopy. | |
| SDF-1 beta from rat | recombinant, expressed in E. coli, ?95% (SDS-PAGE), ?95% (HPLC), suitable for cell culture. Group: Fluorescence/luminescence spectroscopy. | |
| SDF-1 BETA human | Animal-component free, recombinant, expressed in E. coli, ?98% (SDS-PAGE), ?98% (HPLC). Group: Fluorescence/luminescence spectroscopy. | |
| SDG | SDG. Group: Biochemicals. CAS No. 158932-33-3. Pack Sizes: 5mg. US Biological Life Sciences. | Worldwide |
| SDGRG | SDGRG has been used as a control peptide which does not affect integrin function, in various studies. Synonyms: S-D-G-R-G; H-SER-ASP-GLY-ARG-GLY-OH. Grades: >95%. CAS No. 108608-63-5. Molecular formula: C17H30N8O9. Mole weight: 490.5. | |
| S-Diclofenac | S-Diclofenac is a hybrid molecule of an H 2 S donor and the NSAID diclofenac. S-Diclofenac spares the gastric mucosa of injury despite markedly suppressing prostaglandin synthesis [1]. Uses: Scientific research. Group: Signaling pathways. Alternative Names: ACS 15; ATB-337. CAS No. 912758-00-0. Pack Sizes: 10 mM * 1 mL; 5 mg; 10 mg; 25 mg; 50 mg; 100 mg. Product ID: HY-15035. | |
| S- (Di methyl carbamoyl methyl ) O,O-Dimethyl Ester Phosphorodithioic Acid | S- (Di methyl carbamoyl methyl ) O,O-Dimethyl Ester Phosphorodithioic Acid. Group: Biochemicals. Alternative Names: O,O-dimethyl Ester Phosphorodithioic Acid S-Ester with 2-Mercapto-N,N-dimethylacetamide. Grades: Highly Purified. CAS No. 60823-19-0. Pack Sizes: 100mg. Molecular Formula: C6H14NO3PS2, Molecular Weight: 243.28. US Biological Life Sciences. | Worldwide |
| S- (Di methyl carbamoyl methyl ) O,O-Dimethyl Ester Phosphorodithioic Acid-d6 | S- (Di methyl carbamoyl methyl ) O,O-Dimethyl Ester Phosphorodithioic Acid-d6. Group: Biochemicals. Alternative Names: O,O-dimethyl Ester Phosphorodithioic Acid S-Ester with 2-Mercapto-N,N-dimethylacetamide-d6. Grades: Highly Purified. Pack Sizes: 5mg. Molecular Formula: C6H8D6NO3PS2, Molecular Weight: 249.32. US Biological Life Sciences. | Worldwide |
| S-Diphenylmethyl-L-cysteine | The S-diphenylmethyl group is one of the most effective S-protecting groups for cysteine. Synonyms: L-Cys(Dpm)-OH; (R)-2-Amino-3-(Benzhydrylthio)Propanoic Acid. Grades: ≥ 99% (TLC). CAS No. 5191-80-0. Molecular formula: C16H17NO2S. Mole weight: 287.38. | |
| S-Diphenylmethyl-L-cysteine | S-Diphenylmethyl-L-cysteine. Group: Biochemicals. Alternative Names: L-Cys(Dpm)-OH. Grades: Highly Purified. CAS No. 5191-80-0. Pack Sizes: 500mg, 1g. US Biological Life Sciences. | Worldwide |
| S-Diphenylmethyl-L-cysteine 99+% (TLC) | S-Diphenylmethyl-L-cysteine 99+% (TLC). Group: Biochemicals. Grades: Reagent Grade. Pack Sizes: 250mg, 1g. US Biological Life Sciences. | Worldwide |
| sDLL-1 human | recombinant, expressed in HEK 293 cells, ?95% (SDS-PAGE), ?95% (HPLC), suitable for cell culture. Group: Fluorescence/luminescence spectroscopy. | |
| sDLL-4 human | recombinant, expressed in HEK 293 cells, ?95% (SDS-PAGE), ?95% (HPLC), suitable for cell culture. Group: Fluorescence/luminescence spectroscopy. | |
| SDM25N hydrochloride | SDM25N is a highly selective non-peptide δ receptor antagonist. Synonyms: SDM25N HCl; (4bS,8R,8aS,14bR)-5,6,7,8,14,14b-Hexahydro-7-(2-methyl-2-propenyl)-4,8-methanobenzofuro[2,3-a]pyrido[4,3-b]carbazole-1,8a(9H)-diol hydrochloride. Grades: ≥99% by HPLC. CAS No. 342884-71-3. Molecular formula: C26H26N2O3·HCl. Mole weight: 450.96. | |
| SDM25N hydrochloride | SDM25N hydrochloride. Group: Biochemicals. Grades: Purified. CAS No. 342884-71-3. Pack Sizes: 10mg, 50mg. US Biological Life Sciences. | Worldwide |
| SDMA | An endogenous inhibitor of nitric oxide (NO) synthase activity. Synonyms: (2S) -2-amino-5-[ (N, N'-dimethylcarbamimidoyl) amino]pentanoic acid; guanidino-N(1),N(2)-dimethylarginine; N(G1),N(G2)-dimethylarginine; N,N'-dimethylarginine; NG,N'G-dimethyl-L-arginine; omega-N(G),N'(G)-dimethylarginine; sDMA arginine; symmetric dimethylarginine. CAS No. 30344-00-4. Molecular formula: C8H18N4O2. Mole weight: 202.25. | |
| SDMA | SDMA (Symmetric dimethylarginine) is an endogenous inhibitor of nitric oxide ( NO ) synthase activity. SDMA, a novel kidney biomarker, permits earlier diagnosis of kidney disease than traditional creatinine testing. Uses: Scientific research. Group: Natural products. Alternative Names: Symmetric dimethylarginine; NG,NG'-Dimethyl-L-arginine. CAS No. 30344-00-4. Pack Sizes: 10 mM * 1 mL; 5 mg; 10 mg; 25 mg; 50 mg; 100 mg. Product ID: HY-101410. | |
| S-Doxazosin | (S)-(+)-Doxazosin is an Isomer of Doxazosin Mesylate. Synonyms: (S)-1-(4-Amino-6,7-dimethoxy-2-quinazolinyl)-4-[(2,3-dihydro-1,4-benzodioxin-2-yl)carbonyl]-piperazine; 1-(4-Amino-6,7-dimethoxy-2-quinazolinyl)-4-[[(2S)-2,3-dihydro-1,4-benzodioxin-2-yl]carbonyl]piperazine. Grades: > 95%. CAS No. 104874-86-4. Molecular formula: C23H25N5O5. Mole weight: 451.48. | |
| SDS (Sodium dodecyl sulfate) | 1kg Pack Size. Group: Detergents. Formula: C12H25NaO4S. CAS No. 151-21-3. Prepack ID 15171947-1kg. Molecular Weight 288.38. See USA prepack pricing. |  |
| SDS (Sodium dodecyl sulfate) | 500g Pack Size. Group: Detergents. Formula: C12H25NaO4S. CAS No. 151-21-3. Prepack ID 15171947-500g. Molecular Weight 288.38. See USA prepack pricing. | |
| SDS (Sodium dodecyl sulfate) Ultrapure | 100g Pack Size. Group: Biochemicals, Detergents, Reagents. Formula: C12H26O4S.Na. CAS No. 151-21-3. Prepack ID 10325163-100g. Molecular Weight 288.38. See USA prepack pricing. | |
| SDS (Sodium dodecyl sulfate) Ultrapure | 500g Pack Size. Group: Biochemicals, Detergents, Reagents. Formula: C12H26O4S.Na. CAS No. 151-21-3. Prepack ID 10325163-500g. Molecular Weight 288.38. See USA prepack pricing. | |
| SDU-071 | SDU-071 is a potent and orally active inhibitor of BRD4-p53 inhibitor. SDU-071 inhibits MDA-MB-231 cells proliferation with an IC50 of 10.5 ?M. SDU-071 induces cell cycle arrest and apoptosis[1]. Uses: Scientific research. Group: Signaling pathways. CAS No. 3036109-10-8. Pack Sizes: 5 mg; 10 mg; 25 mg. Product ID: HY-162352. | |
| SDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS | SDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS is a 32-amino acid peptide. Synonyms: Ser-Asp-Val-Ser-Lys-Gln-Met-Glu-Glu-Glu-Ala-Val-Arg-Leu-Phe-Ile-Glu-Trp-Leu-Lys-Asn-Gly-Gly-Pro-Ser-Ser-Gly-Ala-Pro-Pro-Pro-Ser. Grades: >98%. Molecular formula: C151H236N40O50S. Mole weight: 3443.84. | |
| SDZ 205-557 hydrochloride | SDZ 205-557 hydrochloride is a 5-HT3/5-HT4 receptor antagonist that can promote intestinal peristalsis and gastric emptying. Synonyms: 4-Amino-5-chloro-2-methoxybenzoic acid 2-(diethylamino)ethyl ester hydrochloride; 2-(diethylamino)ethyl 4-amino-5-chloro-2-methoxybenzoate hydrochloride. Grades: ≥99% by HPLC. CAS No. 1197334-02-3. Molecular formula: C14H21ClN2O3.HCl. Mole weight: 337.25. | |
| SDZ 205-557 hydrochloride | SDZ 205-557 hydrochloride. Group: Biochemicals. Grades: Purified. CAS No. 1197334-02-3. Pack Sizes: 10mg, 50mg. US Biological Life Sciences. | Worldwide |
| SDZ-205,557 hydrochloride | solid. Group: Fluorescence/luminescence spectroscopy. | |
| SDZ 21009 | SDZ 21009. Group: Biochemicals. Grades: Purified. CAS No. 39731-05-0. Pack Sizes: 10mg, 50mg. US Biological Life Sciences. | Worldwide |
| SDZ 21009 | SDZ 21009 is a β-adrenoceptor and 5-HT1A/1B receptor antagonist (pKB/pA2 = 8.3 and 8.0 for 5-HT1A and 5-HT1B receptors, respectively). Synonyms: Carpindolol; LM 21009; LM-21009; LM21009; SDZ 21009; SDZ21009; SDZ-21009; 4-[3-[(1,1-Dimethylethyl)amino]-2-hydroxypropoxy]-1H-indole-2-carboxylic acid, 1-methylethyl ester. CAS No. 39731-05-0. Molecular formula: C19H28N2O4. Mole weight: 348.44. | |
| SDZ 220-040 | SDZ 220-040 is a potent competitive antagonist at the NMDA receptor (pKi = 8.5). Synonyms: SDZ 220-040; SDZ220-040; SDZ-220-040; (S)-α-Amino-2',4'-dichloro-4-hydroxy-5-(phosphonomethyl)-[1,1'-biphenyl]-3-propanoic acid. CAS No. 174575-40-7. Molecular formula: C16H16Cl2NO6P. Mole weight: 420.19. | |
| SDZ 220-581 | SDZ 220-581 is a competitive NMDA receptor antagonist (pKi = 7.7). SDZ 220-581 was indicated a reverse effect on haloperidol-induced catalepsy in the rat model of Parkinson's disease. Synonyms: (S)-α-Amino-2'-chloro-5-(phosphonomethyl)[1,1'-biphenyl]-3-propanoic acid. Grades: ≥98% by HPLC. CAS No. 174575-17-8. Molecular formula: C16H17ClNO5P. Mole weight: 369.74. | |
| SDZ 220-581 | SDZ 220-581 is an orally active, potent, competitive NMDA receptor antagonist with pK i value of 7.7 [1]. Uses: Scientific research. Group: Signaling pathways. CAS No. 174575-17-8. Pack Sizes: 10 mM * 1 mL; 5 mg; 10 mg; 25 mg; 50 mg. Product ID: HY-13059. | |
| SDZ 220-581 hydrochloride | SDZ 220-581 hydrochloride is an orally active, potent, competitive NMDA receptor antagonist with pK i value of 7.7 [1]. Uses: Scientific research. Group: Signaling pathways. CAS No. 179411-93-9. Pack Sizes: 10 mM * 1 mL; 5 mg; 10 mg; 50 mg. Product ID: HY-13059B. | |
| SDZ 220-581 hydrochloride | ?98% (HPLC). Group: Fluorescence/luminescence spectroscopy. | |
| SDZ285-428 | SDZ285-428 is a CYP24A1 inhibitor. Synonyms: SDZ285 428; 4-(4-chlorophenyl)-N-(2-imidazol-1-yl-2-phenylethyl)benzamide; NVP-VID-400; NVP VID 400; NVP-VID-400; NVP-VID 400; NVP-VID400; SDZ285428; SDZ 285428; SDZ-285428; SDZ285-428; SDZ 285-428; SDZ-285-428. CAS No. 174262-13-6. Molecular formula: C24H20ClN3O. Mole weight: 401,894. | |
| SDZ NKT 343 | SDZ NKT 343 is a highly selective human tachykinin NK1 receptor antagonist (IC50 = 0.62 and 451 nM for human and rat receptors, respectively), displaying > 130-fold selectivity over human NK2 and NK3 receptors. SDZ NKT 343 was shown to antagonize SP-induced Ca2+ efflux in vitro and inhibit mechanical hyperalgesia in vivo. Uses: Neurokinin-1 receptor antagonists. Synonyms: 1-[[(2-Nitrophenyl)amino]carbonyl]-L-prolyl-N-methyl-3-(2-naphthalenyl)-N-(phenylmethyl)-L-alaninamide. Grades: ≥98% by HPLC. CAS No. 180046-99-5. Molecular formula: C33H33N5O5. Mole weight: 579.65. | |
| SDZ NKT 343 | SDZ NKT 343. Group: Biochemicals. Grades: Purified. CAS No. 180046-99-5. Pack Sizes: 10mg. US Biological Life Sciences. | Worldwide |
| SDZ SER 082 | SDZ SER 082. Group: Biochemicals. Alternative Names: (7aR,11aS)-rel-4,5,7a,8,9,10,11,11a-Octahydro-10-methyl-7H-indolo[1,7-bc][2,6]naphthyridine. Grades: Highly Purified. CAS No. 141474-54-6. Pack Sizes: 10mg. Molecular Formula: C15H20N2, Molecular Weight: 228.33. US Biological Life Sciences. | Worldwide |
| SDZ SER 082 fumarate | SDZ SER 082 fumarate is a selective 5-HT2B/2C receptor antagonist with low affinity for 5-HT1A receptors. SDZ SER 082 fumarate inhibits [3H]-mesulergine binding to 5-HT2C receptors (pKD = 7.8), and suppresses 5-HT2B mediated responses in the rat fundus (pKB = 7.34). Synonyms: 7H-Indolo[1,7-bc][2,6]naphthyridine, 4,5,7a,8,9,10,11,11a-octahydro-10-methyl-, (7aR,11aS)-rel-, (2E)-2-butenedioate (1:1); (+)-cis-4,5,7a,8,9,10,11,11a-Octahydro-7H-10-methylindolo[1,7-bc][2,6]-naphthyridine fumarate; rel-(7aR,11aS)-4,5,7a,8,9,10,11,11a-Octahydro-10-methyl-7H-indolo[1,7-bc][2,6]naphthyridine fumarate; SDZ-SER 082 fumarate. Grades: ≥95%. CAS No. 1417343-80-6. Molecular formula: C15H20N2.C4H4O4. Mole weight: 344.41. | |
| SDZ WAG 994 | SDZ WAG 994. Group: Biochemicals. Grades: Purified. CAS No. 130714-47-5. Pack Sizes: 10mg. US Biological Life Sciences. | Worldwide |
| SDZ WAG 994 | SDZ WAG 994 is a potent and selective adenosine A1 receptor agonist (Ki = 23, > 10000 and 25000 nM for A1, A2A and A2B receptors, respectively). SDZ WAG 994 has been shown to lower blood pressure levels and heart rate in spontaneous hypertensive rats, and inhibit adenosine deaminase-stimulated lipolysis in rat adipocytes (Ki = 8 nM). Synonyms: Adenosine, N-cyclohexyl-2'-O-methyl-; N-Cyclohexyl-2'-O-methyladenosine; SDZ-WAG 994; WAG 994. Grades: ≥99% by HPLC. CAS No. 130714-47-5. Molecular formula: C17H25N5O4. Mole weight: 363.41. | |
Our database is helping our users find suppliers everyday.
