A directory of where to buy chemicals in the USA, including: distributors, industrial manufacturers, bulk supplies and wholesalers of raw ingredients & finished goods.
VPM peptide is a dithiol protease-cleavable peptide cross-linker. VPM peptide can be incorporated into the backbone of the PEG-diacrylate (PEG-DA) macromer to form PEG hydrogel [1] [2]. Uses: Scientific research. Group: Peptides. CAS No. 1428885-83-9. Pack Sizes: 5 mg; 10 mg. Product ID: HY-P3159.
VPS34 human
recombinant, expressed in Sf9 cells. Group: Fluorescence/luminescence spectroscopy.
Vps34-IN-1
Vps34-IN-1 is a potent and selective inhibitor of class III Vps34 PI3K. Vps34-IN-1 inhibits phosphorylation of PtdIns by recombinant insect cell expressed Vps34-Vps15 complex with an IC50 of ~25 nM. Vps34-IN-1 can suppress SGK3 activation by reducing PtdIns(3)P levels via lowering phosphorylation of T-loop and hydrophobic motifs. Vps34-IN-1 modulates autophagy[1][2][3]. Uses: Scientific research. Group: Signaling pathways. CAS No. 1383716-33-3. Pack Sizes: 10 mM * 1 mL; 5 mg; 10 mg; 50 mg; 100 mg. Product ID: HY-12795.
Vps34-PIK-III
Vps34-PIK-III is an orally active and selective VPS34 inhibitor (IC50=18 nM). Vps34-PIK-III effectively inhibits autophagy and can be used as a molecular tool. vps34-PIK-III is also a PI3K inhibitor that inhibits the expression of genes in liver cancer stem cells (CSCs)[1][2][3]. Uses: Scientific research. Group: Signaling pathways. CAS No. 1383716-40-2. Pack Sizes: 10 mM * 1 mL; 2 mg; 5 mg; 10 mg; 25 mg; 50 mg; 100 mg. Product ID: HY-12794.
VR23
VR23 is a small molecule that potently inhibits the activities of trypsin-like proteasomes (IC50=1 nM), chymotrypsin-like proteasomes (IC50=50-100 nM), and caspase-like proteasomes (IC50=3 ?M). Uses: Scientific research. Group: Signaling pathways. CAS No. 1624602-30-7. Pack Sizes: 10 mM * 1 mL; 5 mg; 10 mg; 50 mg; 100 mg. Product ID: HY-18741.
VrCRP is a peptide isolated from V. radiata (a bruchid-resistant mungbean). It has activity against bacteria and fungi. Synonyms: Arg-Thr-Cys-Met-Ile-Lys-Lys-Glu-Gly-Trp-Gly-Lys-Cys-Leu-Ile-Asp-Thr-Thr-Cys-Ala-His-Ser-Cys-Lys-Asn-Arg-Gly-Tyr-Ile-Gly-Gly-Asp-Cys-Lys-Gly-Met-Thr-Arg-Thr-Cys-Tyr-Cys-Leu-Val-Asn-Cys. Molecular formula: C211H347N65O63S10. Mole weight: 5123.07.
VrD1
VrD1 is an antimicrobial plant peptide isolated from Vigna radiata. It has activity against fungi. Synonyms: Arg-Thr-Cys-Met-Ile-Lys-Lys-Glu-Gly-Trp-Gly-Lys-Cys-Leu-Ile-Asp-Thr-Thr-Cys-Ala-His-Ser-Cys-Lys-Asn-Arg-Gly-Tyr-Ile-Gly-Gly-Asn-Cys-Lys-Gly-Met-Thr-Arg-Thr-Cys-Tyr-Cys-Leu-Val-Asn-Cys.
VrD2
VrD2 is an plant antimicrobial peptide isolated from Vigna radiata. It has activity against gram-positive bacteria, gram-negative bacteria and fungi. Synonyms: Lys-Thr-Cys-Glu-Asn-Leu-Ala-Asn-Thr-Tyr-Arg-Gly-Pro-Cys-Phe-Thr-Thr-Gly-Ser-Cys-Asp-Asp-His-Cys-Lys-Asn-Lys-Glu-His-Leu-Arg-Ser-Gly-Arg-Cys-Arg-Asp-Asp-Phe-Arg-Cys-Trp-Cys-Thr-Arg-Asn-Cys. Molecular formula: C222H347N77O72S8. Mole weight: 5503.15.
VRK1/CK1-IN-1 (compound 36) is a dual inhibitor of vaccinia-related kinase 1 (VRK1) and casein kinase 1 (CK1), with the Ki of 37.9 nM for VRK1 and IC50s of 17 nM and 15 nM for ? and ? isoforms of CK1, respectively[1]. Uses: Scientific research. Group: Signaling pathways. CAS No. 3050772-20-5. Pack Sizes: 10 mM * 1 mL; 5 mg; 10 mg; 25 mg. Product ID: HY-158975.
VRK-IN-1 is a potent and selective inhibitor of vaccinia-related kinases 1 (VRK1), with an IC50 of 150 nM. VRK1 is human Ser/Thr protein kinases associated with increased cell division and neurological disorders[1]. Uses: Scientific research. Group: Signaling pathways. CAS No. 2378855-09-3. Pack Sizes: 10 mM * 1 mL; 5 mg; 10 mg; 25 mg; 50 mg; 100 mg. Product ID: HY-126542.
VRT-043198
VRT-043198, the agent metabolite of VX-765 (Belnacasan), is a potent, selective and blood-brain barrier permeable inhibitor of interleukin-converting enzyme/caspase-1 subfamily caspases. VRT-043198 exhibits Ki values of 0.8 nM and 0.6 nM for ICE/caspase-1 and caspase-4, respectively[1]. Uses: Scientific research. Group: Signaling pathways. CAS No. 244133-31-1. Pack Sizes: 10 mM * 1 mL; 5 mg; 10 mg; 25 mg; 50 mg; 100 mg. Product ID: HY-112226.
VS-5584 is a pan-PI3K/mTOR kinase inhibitor with IC50s of 16 nM, 68 nM, 42 nM, 25 nM, and 37 nM for PI3K?, PI3K?, PI3K?, PI3K? and mTOR, respectively. VS-5584 simultaneously blocks mTORC2 as well as mTORC1. Uses: Scientific research. Group: Signaling pathways. Alternative Names: SB2343. CAS No. 1246560-33-7. Pack Sizes: 10 mM * 1 mL; 5 mg; 10 mg; 25 mg; 50 mg; 100 mg. Product ID: HY-16585.
VSe2 Crystal
VSe2 Crystal. Uses: Designed for use in research and industrial production. Product Category: Graphene-like Materials Series. CAS No. 12299-51-3. Purity: 0.99995. Product ID: ACM12299513. Alfa Chemistry ISO 9001:2015 Certified. Categories: Vanadium selenide (VSe2).
VSKQMEEEAVRLFIEWLKNGGPSSGAPPPS
VSKQMEEEAVRLFIEWLKNGGPSSGAPPPS is the first N-terminal 1-28 residues of Exendin-4 peptide. Exendin-4 is a pure GLP-1 receptor agonist. Mole weight: 3241.7.
Vsp I
One unit of the enzyme is the amount required to hydrolyze 1 μg of Lambda DNA in 1 hour at 37°C in a total reaction volume of 50 μl. Applications: After 10-fold overdigestion with enzyme 70% of the dna fragments can be ligated.of these, 90% can be recut. in the presence of 10% peg ligation is better. Group: Restriction Enzymes. Purity: 1000U; 5000U. AT↑TAAT TAAT↓TA. Activity: 10000u.a./ml. Appearance: 10 X SE-buffer W. Storage: -20°C. Form: Liquid. Source: An E.coli strain, that carries the cloned gene VspI from Vibrio species 343. Pack: 10 mM Tris-HCl (pH 7.6); 50 mM NaCl; 0.1 mM EDTA; 1 mM DTT; 200 μg/ml BSA; 50% glycerol. Cat No: ET-1187RE.
VSPPLTLGQLLS
VSPPLTLGQLLS is a small peptide FGFR3 inhibitor, peptide P3, inhibits FGFR3 phosphorylation. VSPPLTLGQLLS inhibits 9-cisRA-induced tracheal lymphangiogenesis and blocks lymphatic endothelial cell (LEC) proliferation, migration, and tubule formation [1] [2]. Uses: Scientific research. Group: Peptides. CAS No. 1206896-24-3. Pack Sizes: 5 mg; 10 mg. Product ID: HY-P3695.
VSV-G Peptide
VSV-G Peptide, vesicular stomatitis virus G (VSV-G) protein fragment, is commonly engineered onto the N- or C- terminus of a protein of interest so that the tagged protein can be analyzed and visualized using immunochemical methods. Synonyms: H-Tyr-xiThr-Asp-xiIle-Glu-Met-Asn-Arg-Leu-Gly-Lys-OH; L-tyrosyl-(3xi)-L-threonyl-L-alpha-aspartyl-(3xi)-L-isoleucyl-L-alpha-glutamyl-L-methionyl-L-asparagyl-L-arginyl-L-leucyl-glycyl-L-lysine. Molecular formula: C57H94N16O19S. Mole weight: 1339.52.
VT103
VT103, an analog of VT101, is an orally active and selective TEAD1 protein palmitoylation inhibitor. VT103 inhibits YAP/TAZ-TEAD promoted gene transcription, blocks TEAD auto-palmitoylation, and disrupts interaction between YAP/TAZ and TEAD. VT103 can be used for the research of cancer[1]. Uses: Scientific research. Group: Signaling pathways. CAS No. 2290608-13-6. Pack Sizes: 10 mM * 1 mL; 5 mg; 10 mg; 25 mg; 50 mg; 100 mg. Product ID: HY-134955.
VT104
VT104 is a potent and orally active YAP/TAZ inhibitor. VT104 prevents palmitoylation of endogenous TEAD1 and TEAD3 proteins. VT104 can be used in research of cancer[1][2]. Uses: Scientific research. Group: Signaling pathways. CAS No. 2417718-25-1. Pack Sizes: 10 mM * 1 mL; 1 mg; 5 mg; 10 mg; 25 mg; 50 mg; 100 mg; 250 mg; 500 mg; 1 g. Product ID: HY-134956.
VT107
VT-107, as an analogous to VT104, is an orally active and potent pan-TEAD auto-palmitoylation inhibitor. VT-107 can be used for the research of cancer[1]. Uses: Scientific research. Group: Signaling pathways. CAS No. 2417718-63-7. Pack Sizes: 10 mM * 1 mL; 5 mg; 10 mg; 25 mg; 50 mg; 100 mg; 250 mg; 500 mg; 1 g. Product ID: HY-134957.
VT-1598
VT-1598 is an orally active and selective fungal inhibitor targeting CYP51. VT-1598 shows anti-fungal activity against Candida auris [1] [2]. VT-1598 is a click chemistry reagent, it contains an Alkyne group and can undergo copper-catalyzed azide-alkyne cycloaddition (CuAAc) with molecules containing Azide groups. Uses: Scientific research. Group: Signaling pathways. CAS No. 2089320-99-8. Pack Sizes: 10 mM * 1 mL; 5 mg; 10 mg; 25 mg; 50 mg; 100 mg. Product ID: HY-123777.
VTP-27999 Hydrochloride
VTP-27999 Hcl is an alkyl amine Renin inhibitor; VTP-27999 is useful for Hypertension and End-Organ Diseases. Uses: Scientific research. Group: Signaling pathways. CAS No. 1264191-73-2. Pack Sizes: 10 mM * 1 mL; 5 mg; 10 mg; 50 mg; 100 mg. Product ID: HY-76652.
VTP-27999 TFA
VTP-27999 TFA is an alkyl amine Renin inhibitor; VTP-27999 TFA is useful for Hypertension and End-Organ Diseases. Uses: Scientific research. Group: Signaling pathways. CAS No. 1013937-63-7. Pack Sizes: 5 mg; 10 mg; 25 mg; 50 mg; 100 mg. Product ID: HY-50769.
VTP50469
VTP50469 is a potent, highly selective and orally active Menin-MLL interaction inhibitor with a Ki of 104 pM. VTP50469 has potently anti-leukemia activity[1][2]. Uses: Scientific research. Group: Signaling pathways. CAS No. 2169916-18-9. Pack Sizes: 10 mM * 1 mL; 1 mg; 5 mg; 10 mg; 25 mg; 50 mg; 100 mg. Product ID: HY-114162.
VTP50469 fumarate is a potent, highly selective and orally active Menin-MLL interaction inhibitor with a Ki of 104 pM. VTP50469 fumarate has potently anti-leukemia activity[1][2]. Uses: Scientific research. Group: Signaling pathways. CAS No. 2169919-29-1. Pack Sizes: 10 mM * 1 mL; 5 mg; 10 mg; 50 mg; 100 mg. Product ID: HY-114162A.
VTX-27
Selective PKC inhibitor. VTX-27 is a potent and selective inhibitor of the PKCth enzyme, with over 1000-fold against classical isoforms and over 10,000-fold against atypical isoforms. Group: Biochemicals. Grades: Highly Purified. CAS No. 1321924-70-2. Pack Sizes: 1mg, 5mg. Molecular Formula: C20H24ClFN6O, Form: Supplied as a. US Biological Life Sciences.
Worldwide
VTX-27
VTX-27 is a selective protein kinase C ? (PKC ?) inhibitor, with Kis of 0.08 nM and 16 nM for PKC ? and PKC ?. Uses: Scientific research. Group: Signaling pathways. CAS No. 1321924-70-2. Pack Sizes: 10 mM * 1 mL; 2 mg; 5 mg; 10 mg; 25 mg; 50 mg; 100 mg. Product ID: HY-112782.
V type AAO Template(hole depth:260 nm)
V type AAO Template(hole depth:260 nm). Uses: Designed for use in research and industrial production. Product Category: Inorganic Nanomaterials. CAS No. 11092-32-3. Product ID: ACM11092323-52. Alfa Chemistry ISO 9001:2015 Certified. Categories: ALUMINUM OXIDE.
V type AAO Template(hole depth :500 nm)
V type AAO Template(hole depth :500 nm). Uses: Designed for use in research and industrial production. Product Category: Inorganic Nanomaterials. CAS No. 11092-32-3. Product ID: ACM11092323-33. Alfa Chemistry ISO 9001:2015 Certified. Categories: ALUMINUM OXIDE.
V type AAO Template(pore diameter: 450 nm)
V type AAO Template(pore diameter: 450 nm). Uses: Designed for use in research and industrial production. Product Category: Inorganic Nanomaterials. CAS No. 11092-32-3. Product ID: ACM11092323-57. Alfa Chemistry ISO 9001:2015 Certified. Categories: ALUMINUM OXIDE.
V type AAO Template(pore diameter: 90-40 nm)
V type AAO Template(pore diameter: 90-40 nm). Uses: Designed for use in research and industrial production. Product Category: Inorganic Nanomaterials. CAS No. 11092-32-3. Product ID: ACM11092323-51. Alfa Chemistry ISO 9001:2015 Certified. Categories: ALUMINUM OXIDE.
VU0134992 hydrochloride is the first subtype-preferring, orally active and selective Kir4.1 potassium channel pore blocker, with an IC 50 of 0.97 μM. VU0134992 hydrochloride is 9-fold selective for homomeric Kir4.1 over Kir4.1/5.1 concatemeric channels (IC 50 =9 μM) at -120 mV [1]. Uses: Scientific research. Group: Signaling pathways. CAS No. 1052515-91-9. Pack Sizes: 10 mM * 1 mL; 5 mg; 10 mg; 50 mg; 100 mg. Product ID: HY-122560A.
VU 0155041. Group: Biochemicals. Grades: Purified. CAS No. 1093757-42-6. Pack Sizes: 10mg, 50mg. US Biological Life Sciences.
Worldwide
VU 0155041 sodium salt
VU 0155041 sodium salt. Group: Biochemicals. Grades: Purified. CAS No. 1259372-69-4. Pack Sizes: 10mg, 50mg. US Biological Life Sciences.
Worldwide
VU0155041, Sodium Salt (cis-2- (3, 5-Dichlorophenyl carbamoyl ) cyclohexane carboxyl ic Acid Sodium Salt)
A highly potent, selective positive allosteric modulator for mGlu receptor subtype 4 (EC50 = 0.8 and 0.7uM at human and rat mGlu4 receptors respectively). Does not interact with other mGluR subtypes. Significant antiparkinsonian effects in two preclinical rodent models of Parkinson's disease when administered intracerebroventri cularlly (icv). Group: Biochemicals. Grades: Highly Purified. Pack Sizes: 10mg. US Biological Life Sciences.
VU 0240551 is a potent neuronal K-Cl cotransporter KCC2 inhibitor (IC50=560 nM) and is selective versus NKCC1. VU 0240551 also inhibits hERG and L-type Ca2+ channels. VU 0240551 attenuates GABA-induced hyperpolarization of P cells, produces a positive shift in the P cell GABA reversal potential and enhances P cell synaptic transmission[1][2]. Uses: Scientific research. Group: Signaling pathways. CAS No. 893990-34-6. Pack Sizes: 10 mM * 1 mL; 5 mg; 10 mg; 25 mg; 50 mg; 100 mg. Product ID: HY-16689.
VU 0240551
VU 0240551. Group: Biochemicals. Grades: Purified. CAS No. 893990-34-6. Pack Sizes: 10mg, 50mg. US Biological Life Sciences.
Worldwide
VU 0255035
VU 0255035. Group: Biochemicals. Grades: Purified. CAS No. 1135243-19-4. Pack Sizes: 10mg, 50mg. US Biological Life Sciences.
Worldwide
VU 0255035
VU0255035 is a highly selective and competitive M1 mAChR antagonist. VU0255035 blocks M1 mAChR signals to reduce epileptic seizures and regulate neuronal membrane potential. VU0255035 can be used in research related to central nervous system diseases, such as epilepsy, Parkinson's disease, and dystonia[1][2][3]. Uses: Scientific research. Group: Signaling pathways. Alternative Names: VU 255035. CAS No. 1135243-19-4. Pack Sizes: 10 mM * 1 mL; 5 mg; 10 mg; 25 mg; 50 mg; 100 mg. Product ID: HY-108234.
VU 0357121. Group: Biochemicals. Alternative Names: 4-Butoxy-N-(2,4-difluorophenyl)-benzamide. Grades: Highly Purified. CAS No. 433967-28-3. Pack Sizes: 25mg. Molecular Formula: C17H17F2NO2, Molecular Weight: 305.32. US Biological Life Sciences.
Worldwide
VU0359595
VU0359595 (CID-53361951; ML-270) is a potent and selective pharmacological phospholipase D1 (PLD1) inhibitor with an IC50 of 3.7 nM. VU0359595 is >1700-fold selective for PLD1 over PLD2 (IC50 of 6.4 ?M). VU0359595 can be used for the research of cancer, diabetes, neurodegenerative and inflammatory diseases[1][2][3][4]. Uses: Scientific research. Group: Signaling pathways. Alternative Names: CID-53361951; ML-270. CAS No. 1246303-14-9. Pack Sizes: 10 mM * 1 mL; 5 mg; 10 mg; 25 mg; 50 mg; 100 mg. Product ID: HY-101293.
VU0360172 is a potent and selective mGlu5 receptor positive allosteric modulator with an EC 50 value of 16 nM and a K i of 195 nM, respectively. VU0360172 stimulates polyphosphoinositide (PI) hydrolysis in vivo , which is abrogated in mGlu5 receptors gene deleted mice [1]. VU0360172 is a click chemistry reagent, it contains an Alkyne group and can undergo copper-catalyzed azide-alkyne cycloaddition (CuAAc) with molecules containing Azide groups. Uses: Scientific research. Group: Signaling pathways. CAS No. 1310012-12-4. Pack Sizes: 5 mg; 10 mg; 25 mg; 50 mg. Product ID: HY-120589.
VU 0360172
VU 0360172. Group: Biochemicals. Alternative Names: N-Cyclobutyl-6-[2-(3-fluorophenyl)ethynyl]-3-pyridinecarboxamide Hydrochloride. Grades: Highly Purified. CAS No. 1309976-62-2. Pack Sizes: 10mg. Molecular Formula: C18H16ClFN2O, Molecular Weight: 330.78. US Biological Life Sciences.
Worldwide
VU 0360172 hydrochloride
VU 0360172 hydrochloride. Group: Biochemicals. Grades: Purified. CAS No. 1309976-62-2. Pack Sizes: 10mg, 50mg. US Biological Life Sciences.
Worldwide
VU 0360223
VU 0360223. Group: Biochemicals. Grades: Purified. CAS No. 1274859-33-4. Pack Sizes: 10mg, 50mg. US Biological Life Sciences.
VU 0361737. Group: Biochemicals. Grades: Purified. CAS No. 1161205-04-4. Pack Sizes: 10mg, 50mg. US Biological Life Sciences.
Worldwide
VU0364289
VU0364289 is a highly selective mGlu5 positive allosteric modulator (PAM) (binds to the MPEP (HY-14609A) site), with an EC 50 of 1.6 μM. VU0364289 can reverse amphetamine-induced hyperlocomotion in a dose-dependent manner, which can be used for schizophrenia and other psychiatric research [1] [2] [3]. Uses: Scientific research. Group: Signaling pathways. CAS No. 1242443-29-3. Pack Sizes: 5 mg; 10 mg; 25 mg; 50 mg; 100 mg. Product ID: HY-120727.
VU0364439
VU0364439 is a positive allosteric modulator (PAM) of mGlu4 receptors (EC50 = 19.8 nM in vitro for human mGlu4). Uses: Designed for use in research and industrial production. Additional or Alternative Names: VU0364439, VU-0364439, VU 0364439. Product Category: Others. Appearance: Solid powder. CAS No. 1246086-78-1. Molecular formula: C18H13Cl2N3O3S. Mole weight: 422.28. Purity: >98%. IUPACName: N-[3-Chloro-4-[[(2-chlorophenyl)amino]sulfonyl]phenyl]-2-pyridinecarboxamide. Canonical SMILES: O=C(C1=NC=CC=C1)NC2=CC=C(S(=O)(NC3=CC=CC=C3Cl)=O)C(Cl)=C2. Product ID: ACM1246086781. Alfa Chemistry ISO 9001:2015 Certified. Categories: CS-1000.
VU 0364439
VU 0364439. Group: Biochemicals. Grades: Purified. CAS No. 1246086-78-1. Pack Sizes: 10mg, 50mg. US Biological Life Sciences.
Worldwide
VU0364739
VU0364739 is a selective PLD2 inhibitor (IC50: 22 nM). VU0364739 decreases cancer cell proliferation[1]. Uses: Scientific research. Group: Signaling pathways. CAS No. 1244639-78-8. Pack Sizes: 10 mM * 1 mL; 5 mg; 10 mg; 50 mg; 100 mg. Product ID: HY-150412.