American Chemical Suppliers

A directory of where to buy chemicals in the USA, including: distributors, industrial manufacturers, bulk supplies and wholesalers of raw ingredients & finished goods.

Search for products or services, then visit the suppliers website for prices or more information.

Product
Vortioxetine Impurity 14 Vortioxetine Impurity 14. Uses: For analytical and research use. Group: Impurity standards. CAS No. 1240670-85-2. Molecular formula: C28H34N4S. Mole weight: 458.67. Catalog: APB1240670852. Alfa Chemistry Analytical Products 4
Vortioxetine Impurity 16 Vortioxetine Impurity 16. Uses: For analytical and research use. Group: Impurity standards. CAS No. 16704-47-5. Molecular formula: C14H14S. Mole weight: 214.33. Catalog: APB16704475. Alfa Chemistry Analytical Products 4
Vortioxetine Impurity 29 Vortioxetine Impurity 29. Uses: For analytical and research use. Group: Impurity standards. CAS No. 10468-16-3. Molecular formula: C6H6ClNO. Mole weight: 143.57. Catalog: APB10468163. Alfa Chemistry Analytical Products 4
Vortioxetine Impurity 33 Vortioxetine Impurity 33. Uses: For analytical and research use. Group: Impurity standards. CAS No. 1019453-85-0. Molecular formula: C14H15NS. Mole weight: 229.34. Catalog: APB1019453850. Alfa Chemistry Analytical Products 4
Vortioxetine Impurity 59 Vortioxetine Impurity 59. Uses: For analytical and research use. Group: Impurity standards. CAS No. 1025895-66-2. Molecular formula: C17H19NS. Mole weight: 269.41. Catalog: APB1025895662. Alfa Chemistry Analytical Products 4
Vortioxetine Impurity 61 Vortioxetine Impurity 61. Uses: For analytical and research use. Group: Impurity standards. CAS No. 107832-66-6. Molecular formula: C10H14S. Mole weight: 166.28. Catalog: APB107832666. Alfa Chemistry Analytical Products 4
Vortioxetine Lactose Adduct Vortioxetine Lactose Adduct. Uses: For analytical and research use. Group: Impurity standards. Catalog: APS003497. Format: Neat. Alfa Chemistry Analytical Products 4
Voruciclib Voruciclib is an orally active and selective CDK inhibitor with K i values of 0.626 nM-9.1 nM. Voruciclib potently blocks CDK9, the transcriptional regulator of MCL-1. Voruciclib represses expression of MCL-1 in multiple models of diffuse large B-cell lymphoma (DLBCL) [1]. Uses: Scientific research. Group: Signaling pathways. CAS No. 1000023-04-0. Pack Sizes: 10 mM * 1 mL; 1 mg; 5 mg; 10 mg; 50 mg. Product ID: HY-12422. MedChemExpress MCE
Voruciclib hydrochloride Voruciclib hydrochloride is an orally active and selective CDK inhibitor with K i values of 0.626 nM-9.1 nM. Voruciclib hydrochloride potently blocks CDK9, the transcriptional regulator of MCL-1. Voruciclib hydrochloride represses expression of MCL-1 in multiple models of diffuse large B-cell lymphoma (DLBCL) [1]. Uses: Scientific research. Group: Signaling pathways. CAS No. 1000023-05-1. Pack Sizes: 10 mM * 1 mL; 5 mg; 10 mg; 50 mg; 100 mg. Product ID: HY-12422A. MedChemExpress MCE
Vosaroxin hydrochloride ?98% (HPLC). Group: Fluorescence/luminescence spectroscopy. Alfa Chemistry Analytical Products 2
Vosilasarm Vosilasarm (RAD140) is a potent, orally active, nonsteroidal selective androgen receptor modulator (SARM) with a Ki of 7 nM. Vosilasarm shows good selectivity over other steroid hormone nuclear receptors[1]. Uses: Scientific research. Group: Signaling pathways. Alternative Names: RAD140; EP0062. CAS No. 1182367-47-0. Pack Sizes: 10 mM * 1 mL; 5 mg; 10 mg; 50 mg; 100 mg. Product ID: HY-14383. MedChemExpress MCE
Vosoritide Vosoritide is a medicine used to treat achondroplasia. Vosoritide works by binding to a receptor (target) called natriuretic peptide receptor type B (NPR-B), which reduces the activity of fibroblast growth factor receptor 3 (FGFR3). Uses: Vosoritide, a synthetic analog of the human growth hormone receptor antagonist bmp-7, has emerged as a promising candidate in drug development, particularly in the area of ??rare genetic diseases characterized by impaired skeletal growth and development. achondroplasia is the most common form of disproportionate dwarfism and is characterized by abnormal skeletal growth and development, especially. Synonyms: Voxzogo; BMN-111. Grade: ≥95%. CAS No. 1480724-61-5. Molecular formula: C176H290N56O51S3. Mole weight: 4103.… BOC Sciences 8
Vosoritide acetate Vosoritide (BMN 111) acetate is a natriuretic peptide receptor 2 (NPR2) agonist that acts on the proliferation and differentiation of chondrocytes to promote bone growth[1]. Uses: Scientific research. Group: Peptides. Alternative Names: BMN 111 acetate. Pack Sizes: 1 mg; 5 mg; 10 mg. Product ID: HY-P3503A. MedChemExpress MCE
Votoplam Votoplam (PTC518) (Example 37) is an HTT gene regulator with an IC50 ? 0.1 ?M. Votoplam can be used in the research of Huntington's disease[1]. Uses: Scientific research. Group: Signaling pathways. Alternative Names: PTC518. CAS No. 2407849-89-0. Pack Sizes: 5 mg; 10 mg; 25 mg. Product ID: HY-156650. MedChemExpress MCE
Voxelotor Voxelotor (GBT 440) is a potent inhibitor of haemoglobin S (HbS) polymerization. Voxelotor has the potential for sickle cell disease (SCD) treatment [1]. Uses: Scientific research. Group: Signaling pathways. Alternative Names: GBT 440. CAS No. 1446321-46-5. Pack Sizes: 10 mM * 1 mL; 5 mg; 10 mg; 25 mg; 50 mg; 100 mg; 200 mg; 500 mg. Product ID: HY-18681. MedChemExpress MCE
Voxilaprevir Voxilaprevir (GS-9857) is a noncovalent, reversible inhibitor of HCV NS3/4A protease inhibitor (PI) with pangenotypic antiviral activity [1]. Voxilaprevir inhibits genotype 1b and 3a wild-type NS3 proteases with K i values of 0.038 nM and 0.066 nM, respectively [1]. Voxilaprevir is an orally active direct-acting antiviral agent ( DAA ) and can be used for HCV infection research [2]. Uses: Scientific research. Group: Signaling pathways. Alternative Names: GS-9857. CAS No. 1535212-07-7. Pack Sizes: 10 mM * 1 mL; 1 mg; 5 mg; 10 mg. Product ID: HY-19840. MedChemExpress MCE
Voxtalisib Voxtalisib (XL765) is a potent PI3K inhibitor, which has a similar activity toward class I PI3K (IC50s=39, 113, 9 and 43?nM for p110?, p110?, p110? and p110?, respectively), also inhibits DNA-PK (IC50=150?nM) and mTOR (IC50=157?nM). Voxtalisib (XL765) inhibits mTORC1 and mTORC2 with IC50s of 160 and 910 nM, respectively. Uses: Scientific research. Group: Signaling pathways. Alternative Names: XL765; SAR245409. CAS No. 934493-76-2. Pack Sizes: 10 mM * 1 mL; 5 mg; 10 mg; 25 mg; 50 mg; 100 mg. Product ID: HY-15900. MedChemExpress MCE
VP11 Reagent 10ml Pack Size. Group: Analytical Reagents, Biochemicals, Diagnostic Raw Materials. Formula: KOH ,C4H9N3O2 , H2O. Prepack ID 90004975-10ml. See USA prepack pricing. Molekula Americas
VP 14637 Human respiratory syncytial virus (HRSV) is a major respiratory viral pathogen causing moderate to severe upper and lower respiratory tract infections in all ages and across a wide range of patient populations. Group: Biochemicals. Alternative Names: 2, 2'-[ (4-Hydroxyphenyl) methylene]bis[4-[[ (5-methyl-1H-tetrazol-1-yl) imino]methyl]phenol. Grades: Highly Purified. CAS No. 235106-62-4. Pack Sizes: 10mg. US Biological Life Sciences. USBiological 3
Worldwide
VP16 (411-490), GST tagged from human herpesvirus 2 recombinant, expressed in E. coli, ?80% (SDS-PAGE). Group: Fluorescence/luminescence spectroscopy. Alfa Chemistry Analytical Products 3
VP1 Reagent 10ml Pack Size. Group: Analytical Reagents, Biochemicals, Diagnostic Raw Materials. Formula: CH3CH2OH ,C10H8O , H2O. Prepack ID 90005085-10ml. See USA prepack pricing. Molekula Americas
VP-22 VP-22 peptide is from herpes simplex virus type-1. Synonyms: H-Asp-Ala-Ala-Thr-Ala-Thr-Arg-Gly-Arg-Ser-Ala-Ala-Ser-Arg-Pro-Thr-Glu-Arg-Pro-Arg-Ala-Pro-Ala-Arg-Ser-Ala-Ser-Arg-Pro-Arg-Arg-Pro-Val-Asp-OH; HSV-1 protein VP22. Grade: >98%. Molecular formula: C147H255N61O48. Mole weight: 3645.02. BOC Sciences 11
VPC 01091 VPC 01091. Group: Others. Purity: >99%. Mole weight: 339.943. Stability: 6 Months. Storage: -20°C. Avanti Polar Lipids; lipid products; bioactive lipids; fluorescent lipids; singnal transduction; cell pathways; VPC 01091; ((1R,3S)-1-amino-3-(3-octylphenyl)cyclopentyl)methanol (hydrochloride salt). Cat No: FLBZ-104. Creative Enzymes
VPC01091.4 VPC01091.4 (VPC4) is a TRPM7 inhibitor and blocks TRPM7 current at low micromolar concentrations. VPC01091.4 is an efficacious anti-inflammatory agent that arrests systemic inflammation in vivo[1]. Uses: Scientific research. Group: Signaling pathways. Alternative Names: VPC4. CAS No. 945604-76-2. Pack Sizes: 5 mg; 10 mg; 25 mg; 50 mg; 100 mg. Product ID: HY-157227. MedChemExpress MCE
VPC 01211 VPC 01211. Group: Others. Purity: >99%. Mole weight: 383.462. Stability: 6 Months. Storage: -20°C. Avanti Polar Lipids; lipid products; bioactive lipids; fluorescent lipids; singnal transduction; cell pathways; VPC 01211; ((1R,3S)-1-ammonio-3-(4-octylphenyl)cyclopentyl)methyl hydrogen phosphate. Cat No: FLBZ-093. Creative Enzymes
VPC 23019 VPC 23019. Group: Biochemicals. Grades: Purified. CAS No. 449173-19-7. Pack Sizes: 10mg. US Biological Life Sciences. USBiological 5
Worldwide
VPC 51299 VPC 51299. Group: Others. Purity: >99%. Mole weight: 670.74. Stability: 6 Months. Storage: -20°C. Avanti Polar Lipids; lipid products; bioactive lipids; fluorescent lipids; singnal transduction; cell pathways; VPC 51299; (R,E)-(3-palmitamido-4-(4-((4-(2,2,2-trifluoroethoxy)pyriDin-2-yl)methoxy)phenyl)but-1-en-1-yl)phosphonic acid. Cat No: FLBZ-019. Creative Enzymes
VPC-70063 VPC-70063 is a Myc-Max inhibitor. VPC-70067 is a close analog of the previously identified Myc inhibitor 10058-F4. VPC-70063, of a chemically different scaffold, was the best performer in a panel of in vitro assays, and the forerunner for future hit-to-lead optimization efforts. Uses: Designed for use in research and industrial production. Additional or Alternative Names: VPC-70063; VPC 70063; VPC70063. Product Category: Inhibitors. Appearance: Solid powder. CAS No. 13571-44-3. Molecular formula: C16H12F6N2S. Mole weight: 378.34. Purity: >98%. IUPACName: N-[3,5-Bis(trifluoromethyl)phenyl]-N'-(phenylmethyl)thiourea. Canonical SMILES: S=C(NCC1=CC=CC=C1)NC2=CC(C(F)(F)F)=CC(C(F)(F)F)=C2. Product ID: ACM13571443. Alfa Chemistry — ISO 9001:2015 Certified. Alfa Chemistry.
vp/eicosene copolymer vp/eicosene copolymer. Group: Polymers. CAS No. 28211-18-9. Product ID: 1-ethenylpyrrolidin-2-one; icos-1-ene. Molecular formula: 391.7g/mol. Mole weight: C26H49NO. CCCCCCCCCCCCCCCCCCC=C.C=CN1CCCC1=O. InChI= 1S / C20H40. C6H9NO / c1-3-5-7-9-11-13-15-17-19-20-18-16-14 -12-10-8-6-4-2; 1-2-7-5-3-4-6 (7) 8 / h3H, 1, 4-20H2, 2H3; 2H, 1, 3-5H2. HTLWOXWXUHOLEJ-UHFFFAOYSA-N. Alfa Chemistry Materials 3
VPM peptide VPM peptide is a dithiol protease-cleavable peptide cross-linker. VPM peptide can be incorporated into the backbone of the PEG-diacrylate (PEG-DA) macromer to form PEG hydrogel [1] [2]. Uses: Scientific research. Group: Peptides. CAS No. 1428885-83-9. Pack Sizes: 5 mg; 10 mg. Product ID: HY-P3159. MedChemExpress MCE
VPS34 human recombinant, expressed in Sf9 cells. Group: Fluorescence/luminescence spectroscopy. Alfa Chemistry Analytical Products 2
Vps34-IN-1 Vps34-IN-1 is a potent and selective inhibitor of class III Vps34 PI3K. Vps34-IN-1 inhibits phosphorylation of PtdIns by recombinant insect cell expressed Vps34-Vps15 complex with an IC50 of ~25 nM. Vps34-IN-1 can suppress SGK3 activation by reducing PtdIns(3)P levels via lowering phosphorylation of T-loop and hydrophobic motifs. Vps34-IN-1 modulates autophagy[1][2][3]. Uses: Scientific research. Group: Signaling pathways. CAS No. 1383716-33-3. Pack Sizes: 10 mM * 1 mL; 5 mg; 10 mg; 50 mg; 100 mg. Product ID: HY-12795. MedChemExpress MCE
Vps34-PIK-III Vps34-PIK-III is an orally active and selective VPS34 inhibitor (IC50=18 nM). Vps34-PIK-III effectively inhibits autophagy and can be used as a molecular tool. vps34-PIK-III is also a PI3K inhibitor that inhibits the expression of genes in liver cancer stem cells (CSCs)[1][2][3]. Uses: Scientific research. Group: Signaling pathways. CAS No. 1383716-40-2. Pack Sizes: 10 mM * 1 mL; 2 mg; 5 mg; 10 mg; 25 mg; 50 mg; 100 mg. Product ID: HY-12794. MedChemExpress MCE
VR23 VR23 is a small molecule that potently inhibits the activities of trypsin-like proteasomes (IC50=1 nM), chymotrypsin-like proteasomes (IC50=50-100 nM), and caspase-like proteasomes (IC50=3 ?M). Uses: Scientific research. Group: Signaling pathways. CAS No. 1624602-30-7. Pack Sizes: 10 mM * 1 mL; 5 mg; 10 mg; 50 mg; 100 mg. Product ID: HY-18741. MedChemExpress MCE
VR23 ?98% (HPLC). Group: Fluorescence/luminescence spectroscopy. Alfa Chemistry Analytical Products 2
VrCRP VrCRP is a peptide isolated from V. radiata (a bruchid-resistant mungbean). It has activity against bacteria and fungi. Synonyms: Arg-Thr-Cys-Met-Ile-Lys-Lys-Glu-Gly-Trp-Gly-Lys-Cys-Leu-Ile-Asp-Thr-Thr-Cys-Ala-His-Ser-Cys-Lys-Asn-Arg-Gly-Tyr-Ile-Gly-Gly-Asp-Cys-Lys-Gly-Met-Thr-Arg-Thr-Cys-Tyr-Cys-Leu-Val-Asn-Cys. Molecular formula: C211H347N65O63S10. Mole weight: 5123.07. BOC Sciences 11
VrD1 VrD1 is an antimicrobial plant peptide isolated from Vigna radiata. It has activity against fungi. Synonyms: Arg-Thr-Cys-Met-Ile-Lys-Lys-Glu-Gly-Trp-Gly-Lys-Cys-Leu-Ile-Asp-Thr-Thr-Cys-Ala-His-Ser-Cys-Lys-Asn-Arg-Gly-Tyr-Ile-Gly-Gly-Asn-Cys-Lys-Gly-Met-Thr-Arg-Thr-Cys-Tyr-Cys-Leu-Val-Asn-Cys. BOC Sciences 11
VrD2 VrD2 is an plant antimicrobial peptide isolated from Vigna radiata. It has activity against gram-positive bacteria, gram-negative bacteria and fungi. Synonyms: Lys-Thr-Cys-Glu-Asn-Leu-Ala-Asn-Thr-Tyr-Arg-Gly-Pro-Cys-Phe-Thr-Thr-Gly-Ser-Cys-Asp-Asp-His-Cys-Lys-Asn-Lys-Glu-His-Leu-Arg-Ser-Gly-Arg-Cys-Arg-Asp-Asp-Phe-Arg-Cys-Trp-Cys-Thr-Arg-Asn-Cys. Molecular formula: C222H347N77O72S8. Mole weight: 5503.15. BOC Sciences 11
VRK1, active, GST tagged human recombinant, expressed in baculovirus infected Sf9 cells, ?70% (SDS-PAGE), buffered aqueous glycerol solution. Group: Fluorescence/luminescence spectroscopy. Alfa Chemistry Analytical Products 2
VRK1/CK1-IN-1 VRK1/CK1-IN-1 (compound 36) is a dual inhibitor of vaccinia-related kinase 1 (VRK1) and casein kinase 1 (CK1), with the Ki of 37.9 nM for VRK1 and IC50s of 17 nM and 15 nM for ? and ? isoforms of CK1, respectively[1]. Uses: Scientific research. Group: Signaling pathways. CAS No. 3050772-20-5. Pack Sizes: 10 mM * 1 mL; 5 mg; 10 mg; 25 mg. Product ID: HY-158975. MedChemExpress MCE
VRK2, active, GST tagged human recombinant, expressed in baculovirus infected Sf9 cells, ?70% (SDS-PAGE), buffered aqueous glycerol solution. Group: Fluorescence/luminescence spectroscopy. Alfa Chemistry Analytical Products 2
VRK-IN-1 VRK-IN-1 is a potent and selective inhibitor of vaccinia-related kinases 1 (VRK1), with an IC50 of 150 nM. VRK1 is human Ser/Thr protein kinases associated with increased cell division and neurological disorders[1]. Uses: Scientific research. Group: Signaling pathways. CAS No. 2378855-09-3. Pack Sizes: 10 mM * 1 mL; 5 mg; 10 mg; 25 mg; 50 mg; 100 mg. Product ID: HY-126542. MedChemExpress MCE
VRT-043198 VRT-043198, the agent metabolite of VX-765 (Belnacasan), is a potent, selective and blood-brain barrier permeable inhibitor of interleukin-converting enzyme/caspase-1 subfamily caspases. VRT-043198 exhibits Ki values of 0.8 nM and 0.6 nM for ICE/caspase-1 and caspase-4, respectively[1]. Uses: Scientific research. Group: Signaling pathways. CAS No. 244133-31-1. Pack Sizes: 10 mM * 1 mL; 5 mg; 10 mg; 25 mg; 50 mg; 100 mg. Product ID: HY-112226. MedChemExpress MCE
VRT-532 ?98% (HPLC). Group: Fluorescence/luminescence spectroscopy. Alfa Chemistry Analytical Products
VS-5584 VS-5584 is a pan-PI3K/mTOR kinase inhibitor with IC50s of 16 nM, 68 nM, 42 nM, 25 nM, and 37 nM for PI3K?, PI3K?, PI3K?, PI3K? and mTOR, respectively. VS-5584 simultaneously blocks mTORC2 as well as mTORC1. Uses: Scientific research. Group: Signaling pathways. Alternative Names: SB2343. CAS No. 1246560-33-7. Pack Sizes: 10 mM * 1 mL; 5 mg; 10 mg; 25 mg; 50 mg; 100 mg. Product ID: HY-16585. MedChemExpress MCE
VSe2 Crystal VSe2 Crystal. Uses: Designed for use in research and industrial production. Product Category: Graphene-like Materials Series. CAS No. 12299-51-3. Purity: 0.99995. Product ID: ACM12299513. Alfa Chemistry — ISO 9001:2015 Certified. Categories: Vanadium selenide (VSe2). Alfa Chemistry. 2
VSKQMEEEAVRLFIEWLKNGGPSSGAPPPS VSKQMEEEAVRLFIEWLKNGGPSSGAPPPS is the first N-terminal 1-28 residues of Exendin-4 peptide. Exendin-4 is a pure GLP-1 receptor agonist. Mole weight: 3241.7. BOC Sciences 11
Vsp I One unit of the enzyme is the amount required to hydrolyze 1 μg of Lambda DNA in 1 hour at 37°C in a total reaction volume of 50 μl. Applications: After 10-fold overdigestion with enzyme 70% of the dna fragments can be ligated.of these, 90% can be recut. in the presence of 10% peg ligation is better. Group: Restriction Enzymes. Purity: 1000U; 5000U. AT↑TAAT TAAT↓TA. Activity: 10000u.a./ml. Appearance: 10 X SE-buffer W. Storage: -20°C. Form: Liquid. Source: An E.coli strain, that carries the cloned gene VspI from Vibrio species 343. Pack: 10 mM Tris-HCl (pH 7.6); 50 mM NaCl; 0.1 mM EDTA; 1 mM DTT; 200 μg/ml BSA; 50% glycerol. Cat No: ET-1187RE. Creative Enzymes
VSPPLTLGQLLS VSPPLTLGQLLS is a small peptide FGFR3 inhibitor, peptide P3, inhibits FGFR3 phosphorylation. VSPPLTLGQLLS inhibits 9-cisRA-induced tracheal lymphangiogenesis and blocks lymphatic endothelial cell (LEC) proliferation, migration, and tubule formation [1] [2]. Uses: Scientific research. Group: Peptides. CAS No. 1206896-24-3. Pack Sizes: 5 mg; 10 mg. Product ID: HY-P3695. MedChemExpress MCE
VSV-G Peptide VSV-G Peptide, vesicular stomatitis virus G (VSV-G) protein fragment, is commonly engineered onto the N- or C- terminus of a protein of interest so that the tagged protein can be analyzed and visualized using immunochemical methods. Synonyms: H-Tyr-xiThr-Asp-xiIle-Glu-Met-Asn-Arg-Leu-Gly-Lys-OH; L-tyrosyl-(3xi)-L-threonyl-L-alpha-aspartyl-(3xi)-L-isoleucyl-L-alpha-glutamyl-L-methionyl-L-asparagyl-L-arginyl-L-leucyl-glycyl-L-lysine. Molecular formula: C57H94N16O19S. Mole weight: 1339.52. BOC Sciences
VT103 VT103, an analog of VT101, is an orally active and selective TEAD1 protein palmitoylation inhibitor. VT103 inhibits YAP/TAZ-TEAD promoted gene transcription, blocks TEAD auto-palmitoylation, and disrupts interaction between YAP/TAZ and TEAD. VT103 can be used for the research of cancer[1]. Uses: Scientific research. Group: Signaling pathways. CAS No. 2290608-13-6. Pack Sizes: 10 mM * 1 mL; 5 mg; 10 mg; 25 mg; 50 mg; 100 mg. Product ID: HY-134955. MedChemExpress MCE
VT104 VT104 is a potent and orally active YAP/TAZ inhibitor. VT104 prevents palmitoylation of endogenous TEAD1 and TEAD3 proteins. VT104 can be used in research of cancer[1][2]. Uses: Scientific research. Group: Signaling pathways. CAS No. 2417718-25-1. Pack Sizes: 10 mM * 1 mL; 1 mg; 5 mg; 10 mg; 25 mg; 50 mg; 100 mg; 250 mg; 500 mg; 1 g. Product ID: HY-134956. MedChemExpress MCE
VT107 VT-107, as an analogous to VT104, is an orally active and potent pan-TEAD auto-palmitoylation inhibitor. VT-107 can be used for the research of cancer[1]. Uses: Scientific research. Group: Signaling pathways. CAS No. 2417718-63-7. Pack Sizes: 10 mM * 1 mL; 5 mg; 10 mg; 25 mg; 50 mg; 100 mg; 250 mg; 500 mg; 1 g. Product ID: HY-134957. MedChemExpress MCE
VT-1598 VT-1598 is an orally active and selective fungal inhibitor targeting CYP51. VT-1598 shows anti-fungal activity against Candida auris [1] [2]. VT-1598 is a click chemistry reagent, it contains an Alkyne group and can undergo copper-catalyzed azide-alkyne cycloaddition (CuAAc) with molecules containing Azide groups. Uses: Scientific research. Group: Signaling pathways. CAS No. 2089320-99-8. Pack Sizes: 10 mM * 1 mL; 5 mg; 10 mg; 25 mg; 50 mg; 100 mg. Product ID: HY-123777. MedChemExpress MCE
VTP-27999 Hydrochloride VTP-27999 Hcl is an alkyl amine Renin inhibitor; VTP-27999 is useful for Hypertension and End-Organ Diseases. Uses: Scientific research. Group: Signaling pathways. CAS No. 1264191-73-2. Pack Sizes: 10 mM * 1 mL; 5 mg; 10 mg; 50 mg; 100 mg. Product ID: HY-76652. MedChemExpress MCE
VTP-27999 TFA VTP-27999 TFA is an alkyl amine Renin inhibitor; VTP-27999 TFA is useful for Hypertension and End-Organ Diseases. Uses: Scientific research. Group: Signaling pathways. CAS No. 1013937-63-7. Pack Sizes: 5 mg; 10 mg; 25 mg; 50 mg; 100 mg. Product ID: HY-50769. MedChemExpress MCE
VTP50469 VTP50469 is a potent, highly selective and orally active Menin-MLL interaction inhibitor with a Ki of 104 pM. VTP50469 has potently anti-leukemia activity[1][2]. Uses: Scientific research. Group: Signaling pathways. CAS No. 2169916-18-9. Pack Sizes: 10 mM * 1 mL; 1 mg; 5 mg; 10 mg; 25 mg; 50 mg; 100 mg. Product ID: HY-114162. MedChemExpress MCE
VTP50469 VTP50469 Inhibitor. Uses: Scientific use. Product Category: T13336. CAS No. 2169916-18-9. TARGETMOL CHEMICALS
VTP50469 fumarate VTP50469 fumarate is a potent, highly selective and orally active Menin-MLL interaction inhibitor with a Ki of 104 pM. VTP50469 fumarate has potently anti-leukemia activity[1][2]. Uses: Scientific research. Group: Signaling pathways. CAS No. 2169919-29-1. Pack Sizes: 10 mM * 1 mL; 5 mg; 10 mg; 50 mg; 100 mg. Product ID: HY-114162A. MedChemExpress MCE
VTX-27 Selective PKC inhibitor. VTX-27 is a potent and selective inhibitor of the PKCth enzyme, with over 1000-fold against classical isoforms and over 10,000-fold against atypical isoforms. Group: Biochemicals. Grades: Highly Purified. CAS No. 1321924-70-2. Pack Sizes: 1mg, 5mg. Molecular Formula: C20H24ClFN6O, Form: Supplied as a. US Biological Life Sciences. USBiological 4
Worldwide
VTX-27 VTX-27 is a selective protein kinase C ? (PKC ?) inhibitor, with Kis of 0.08 nM and 16 nM for PKC ? and PKC ?. Uses: Scientific research. Group: Signaling pathways. CAS No. 1321924-70-2. Pack Sizes: 10 mM * 1 mL; 2 mg; 5 mg; 10 mg; 25 mg; 50 mg; 100 mg. Product ID: HY-112782. MedChemExpress MCE
V type AAO Template(hole depth:260 nm) V type AAO Template(hole depth:260 nm). Uses: Designed for use in research and industrial production. Product Category: Inorganic Nanomaterials. CAS No. 11092-32-3. Product ID: ACM11092323-52. Alfa Chemistry — ISO 9001:2015 Certified. Categories: ALUMINUM OXIDE. Alfa Chemistry.
V type AAO Template(hole depth :500 nm) V type AAO Template(hole depth :500 nm). Uses: Designed for use in research and industrial production. Product Category: Inorganic Nanomaterials. CAS No. 11092-32-3. Product ID: ACM11092323-33. Alfa Chemistry — ISO 9001:2015 Certified. Categories: ALUMINUM OXIDE. Alfa Chemistry. 2
V type AAO Template(pore diameter: 450 nm) V type AAO Template(pore diameter: 450 nm). Uses: Designed for use in research and industrial production. Product Category: Inorganic Nanomaterials. CAS No. 11092-32-3. Product ID: ACM11092323-57. Alfa Chemistry — ISO 9001:2015 Certified. Categories: ALUMINUM OXIDE. Alfa Chemistry.
V type AAO Template(pore diameter: 90-40 nm) V type AAO Template(pore diameter: 90-40 nm). Uses: Designed for use in research and industrial production. Product Category: Inorganic Nanomaterials. CAS No. 11092-32-3. Product ID: ACM11092323-51. Alfa Chemistry — ISO 9001:2015 Certified. Categories: ALUMINUM OXIDE. Alfa Chemistry. 2
VU0029251 ?98% (HPLC), powder. Group: Fluorescence/luminescence spectroscopy. Alfa Chemistry Analytical Products 3
VU0071063 ?98% (HPLC). Group: Fluorescence/luminescence spectroscopy. Alfa Chemistry Analytical Products 3
VU0134992 hydrochloride VU0134992 hydrochloride is the first subtype-preferring, orally active and selective Kir4.1 potassium channel pore blocker, with an IC 50 of 0.97 μM. VU0134992 hydrochloride is 9-fold selective for homomeric Kir4.1 over Kir4.1/5.1 concatemeric channels (IC 50 =9 μM) at -120 mV [1]. Uses: Scientific research. Group: Signaling pathways. CAS No. 1052515-91-9. Pack Sizes: 10 mM * 1 mL; 5 mg; 10 mg; 50 mg; 100 mg. Product ID: HY-122560A. MedChemExpress MCE
VU0152100 ?98% (HPLC). Group: Fluorescence/luminescence spectroscopy. Alfa Chemistry Analytical Products
VU 0155041 VU 0155041. Group: Biochemicals. Grades: Purified. CAS No. 1093757-42-6. Pack Sizes: 10mg, 50mg. US Biological Life Sciences. USBiological 5
Worldwide

Would you like to list your products on USA Chemical Suppliers?

Our database is helping our users find suppliers everyday.

Add Your Products