A directory of where to buy chemicals in the USA, including: distributors, industrial manufacturers, bulk supplies and wholesalers of raw ingredients & finished goods.
Search for products or services, then visit the suppliers website for prices or more information.
| Product | Description | |
|---|---|---|
| KS 176 | KS 176. Group: Biochemicals. Grades: Purified. CAS No. 1253452-78-6. Pack Sizes: 10mg, 50mg. US Biological Life Sciences. |  Worldwide |
| KS-176 | ?98% (HPLC). Group: Fluorescence/luminescence spectroscopy. |  |
| KS2100 Hydrogenated rosin resin | KS2100 Hydrogenated rosin resin. |  |
| KS370G | KS370G is an orally active hypoglycemic and cardiovascular protective agent. KS370G improves left ventricular hypertrophy and function in pressure-overload mice heart. KS370G reduces renal obstructive nephropathy [1] [2]. Uses: Scientific research. Group: Signaling pathways. CAS No. 105955-01-9. Pack Sizes: 5 mg; 10 mg; 25 mg; 50 mg. Product ID: HY-114683. |  |
| KS 370G | ?98% (HPLC). Group: Fluorescence/luminescence spectroscopy. | |
| KS-501 | It is produced by the strain of Sporothrix sp. KAC-1989. KS-501 inhibited Ca2+ and calmodulin dependent cyclic-nucleotide phosphodiesterase with an IC50 of 1.8 μmol/L. Synonyms: KS 501; 3-Heptyl-5-hydroxyphenyl 2-heptyl-6-(hexofuranosyloxy)-4-hydroxybenzoate. CAS No. 120634-86-8. Molecular formula: C33H48O10. Mole weight: 604.73. | |
| KS 502 | It is produced by the strain of Sporothrix sp. KAC-1989. KS 502 inhibited Ca2+ and calmodulin dependent cyclic-nucleotide phosphodiesterase with an IC50 of 4.4 μmol/L. Synonyms: Benzoic acid, 2-(beta-D-galactofuranosyloxy)-6-heptyl-4-hydroxy-, 4-carboxy-3-heptyl-5-hydroxyphenyl ester. Grade: >98%. CAS No. 120634-85-7. Molecular formula: C34H48O12. Mole weight: 648.74. | |
| KS 504a | It is produced by the strain of Mollisia ventosa KAC-1148. KS 504a inhibited Ca2+ and calmodulin dependent cyclic-nucleotide phosphodiesterase with an IC50 of 122 μmol/L. Synonyms: KS-504a; KS-504b; BRN 4354490; 1-Oxaspiro(2.4)heptan-5-ol, 2,4,4,6,6-pentachloro-7-(dichloromethylene)-. CAS No. 122022-77-9. Molecular formula: C7H3Cl7O2. Mole weight: 367.27. | |
| KS-504d | It is produced by the strain of Mollisia ventosa KAC-1148. KS-504d inhibited Ca2+ and calmodulin dependent cyclic-nucleotide phosphodiesterase with an IC50 of >500 μmol/L. Synonyms: KS 504d; BRN 4322179; (+)-1-(Dichloromethyl)-5-(dichloromethylene)-2,2,4,4-tetrachloro-1,3-cyclopentanediol. CAS No. 122005-23-6. Molecular formula: C7H4Cl8O2. Mole weight: 403.73. | |
| KS-504e | It is produced by the strain of Mollisia ventosa KAC-1148. KS-504e inhibited Ca2+ and calmodulin dependent cyclic-nucleotide phosphodiesterase with an IC50 of 139 μmol/L. Synonyms: KS 504e; BRN 4321107; (+)-4-Hydroxy-3,3,5,5-tetrachloro-2-(trichloromethyl)-1-cyclopentene-1-carboxaldehyde; 1-Cyclopentene-1-carboxaldehyde, 3,3,5,5-tetrachloro-4-hydroxy-2-(trichloromethyl)-, (+)-. CAS No. 122006-32-0. Molecular formula: C7H3Cl7O2. Mole weight: 367.27. | |
| KS-619-1 | It is produced by the strain of Streptomyces californicus KS-619-1. KS-619-1 inhibited Ca2+ and CAM-PDE in bovine brain and heart with an IC50 of 2.0 and 1.5 μmol/L. Synonyms: KS 619-1; Benzo(a)naphthacene-2-carboxylic acid, 5,6,8,13-tetrahydro-1,7,9,11-tetrahydroxy-8,13-dioxo-3-(2-oxopropyl)-. CAS No. 103370-21-4. Molecular formula: C26H18O9. Mole weight: 474.41. | |
| Ksp22 I | One unit of the enzyme is the amount required to hydrolyze 1 μg of Lambda DNA in 1 hour at 37°C in a total reaction volume of 50 μl. Applications: After 20-fold overdigestion with enzyme more than 90% of the dna fragments can be ligated and recut. Group: Restriction Enzymes. Purity: 1000U; 5000U. T↑GATCA ACTAG↓T. Activity: 20000u.a./ml. Appearance: 10 X SE-buffer 2K, BSA. Storage: -20°C. Form: Liquid. Source: Kurthia species 22. Pack: 10 mM Tris-HCl (pH 7.5); 250 mM NaCl; 0.1 mM EDTA; 7 mM 2-mercaptoethanol; 200 μg/ml BSA, 50% glycerol. Cat No: ET-1126RE. |  |
| KSPWFTTL | KSPWFTTL is an immunodominant Kb-restricted epitope from the p15E transmembrane protein. KSPWFTTL can restore susceptibility of a tumor line to anti-AKR/Gross MuLV cytotoxic T lymphocytes [1] [2]. Uses: Scientific research. Group: Peptides. CAS No. 153049-05-9. Pack Sizes: 5 mg; 10 mg. Product ID: HY-P3333. | |
| KSQ-4279 | KSQ-4279 is a USP1 and PARP inhibitor. KSQ-4279 showed anti-proliferative effects in a subset of cell lines, often characterized by the presence of homologous recombination deficiencies (HRD), including mutations in BRCA1/2. The combination of KSQ-4279 with olaparib was able to induce strong and durable regressions across a number of ovarian and TNBC PDX models. Uses: Designed for use in research and industrial production. Additional or Alternative Names: KSQ-4279; KSQ 4279; KSQ4279. Product Category: Inhibitors. Appearance: Solid powder. CAS No. 2446480-97-1. Molecular formula: C27H25F3N8O. Mole weight: 534.55. Purity: >98%. IUPACName: 1H-Pyrazolo[3,4-d]pyrimidine, 6-(4-cyclopropyl-6-methoxy-5-pyrimidinyl)-1-[[4-[1-(1-methylethyl)-4-(trifluoromethyl)-1H-imidazol-2-yl]phenyl]methyl]-. Canonical SMILES: FC(C1=CN(C(C)C)C(C2=CC=C(CN3N=CC4=CN=C(C5=C(OC)N=CN=C5C6CC6)N=C43)C=C2)=N1)(F)F. Product ID: ACM2446480971. Alfa Chemistry ISO 9001:2015 Certified. |  |
| KSQ-4279 | KSQ-4279 (USP1-IN-1) is a potent USP1 inhibitor and a selective PARP1 inhibitor. KSQ-4279 is promising for research of cancers [1]. Uses: Scientific research. Group: Signaling pathways. Alternative Names: USP1-IN-1. CAS No. 2446480-97-1. Pack Sizes: 10 mM * 1 mL; 1 mg; 5 mg; 10 mg; 25 mg; 50 mg; 100 mg. Product ID: HY-145471. | |
| K-Strophanthoside | K-Strophanthoside. Uses: Designed for use in research and industrial production. Additional or Alternative Names: STROPHANTHOSIDE, K-;copyranosyl-(1-4)-2,6-dideoxy-3-o-methyl-beta-d-ribo-hexopyranosyl)oxy)-5,14-d;ihydroxy-19-oxo-;k-strofantozyd;k-strophanthidin-gamma;k-strophantosid;k-strophantoside;strophanthidin+cymarose+beta-glucose+alpha-glucose. Product Category: Heterocyclic Organic Compound. Appearance: White-beige powder. CAS No. 33279-57-1. Molecular formula: C42H64O19. Mole weight: 873. Purity: 0.98. Product ID: ACM33279571. Alfa Chemistry ISO 9001:2015 Certified. | |
| KT109 | KT109 is a potent and an isoform-selective inhibitor of diacylglycerol lipase-β (DAGLβ) with an IC 50 of 42 nM. KT109 has ~60-fold selectivity for DAGLβ over DAGL&alpha. KT109 shows inhibitory activity against PLA2G7 (IC 50 =1 μM). KT109 shows negligible activity against FAAH, MGLL, ABHD11, and cytosolic phospholipase A2 (cPLA2 or PLA2G4A). KT109 perturbs a lipid network involved in macrophage inflammatory responses and lowers 2-arachidonoylglycerol (2-AG), arachidonic acid and eicosanoids in mouse peritoneal macrophages [1]. Uses: Scientific research. Group: Signaling pathways. CAS No. 1402612-55-8. Pack Sizes: 10 mM * 1 mL; 5 mg; 10 mg; 25 mg; 50 mg; 100 mg. Product ID: HY-18540. | |
| KT109 | ?98% (HPLC). Group: Fluorescence/luminescence spectroscopy. | |
| KT172 | ?98% (HPLC). Group: Fluorescence/luminescence spectroscopy. | |
| KT172 | KT172 is a DAGLβ inhibitor with an IC 50 value of 11 nM. KT172 can be used for the research of metabolic and inflammatory [1]. Uses: Scientific research. Group: Signaling pathways. CAS No. 1402612-56-9. Pack Sizes: 1 mg; 5 mg; 10 mg. Product ID: HY-18541. | |
| KT182 | ?98% (HPLC). Group: Fluorescence/luminescence spectroscopy. | |
| KT185 | ?98% (HPLC). Group: Fluorescence/luminescence spectroscopy. | |
| KT195 | ?98% (HPLC). Group: Fluorescence/luminescence spectroscopy. | |
| KT203 | ?98% (HPLC). Group: Fluorescence/luminescence spectroscopy. | |
| KT-253 | KT-253 is a p53 stabilizer and a PROTAC degrader for MDM2 ( DC 50 =0.4 nM). KT-253 inhibits the proliferation of cancer cell RS4;11 with an IC 50 of 0.3 nM, arrests the cell cycle at G2/M phase, and induces apoptosis. KT-253 exhibits antitumor efficacy in mouse models [1]. (Pink: ligand for target protein MDM2 ligand 4 (HY-170452); Black: linker (HY-W001478); Blue: ligand for E3 ligase cereblon (HY-163927)). Uses: Scientific research. Group: Signaling pathways. CAS No. 2713618-08-5. Pack Sizes: 1 mg; 5 mg; 10 mg; 25 mg; 50 mg; 100 mg. Product ID: HY-170451. | |
| KT-333 | KT-333 is a molecular glues that degrades STAT3 protein. KT-333 mediates the selective degradation of STAT3 through the ubiquitin-proteasome system by binding to STAT3 protein and E3 ubiquitin ligase von Hippel-Lindau protein (VHL). KT-333 has strong selectivity for STAT3 protein degradation and good antitumor activity. KT-333 can be used in the study of hematologic malignancies such as large granular lymphocytic leukemia (LGL-L), peripheral T-cell lymphoma (PTCL), and cutaneous T-cell lymphoma (CTCL) [1]. Uses: Scientific research. Group: Signaling pathways. CAS No. 2502186-79-8. Pack Sizes: 1 mg; 5 mg; 10 mg. Product ID: HY-156730. | |
| KT-474 | KT-474 (KYM-001) is an orally active PROTAC IRAK4 degrader with antitumor activities [1]. KT-474 is a click chemistry reagent, it contains an Alkyne group and can undergo copper-catalyzed azide-alkyne cycloaddition (CuAAc) with molecules containing Azide groups. Uses: Scientific research. Group: Signaling pathways. Alternative Names: KYM-001; PROTAC IRAK4 degrader-7. CAS No. 2432994-31-3. Pack Sizes: 1 mg; 5 mg. Product ID: HY-145483. | |
| KT5720 | KT5720 is a potent, cell-permeable, specific, reversible and ATP-competitive PKA inhibitor ( IC 50 =3.3 μM). KT5720 is effective in reversing MDR1-mediated multidrug resistance. KT5720 also reduces the excitability of dorsal root ganglion (DRG) neurons by attenuating Hyperpolarization-activated cyclic nucleotide-gated (HCN) channel activity and reducing intracellular Ca2 + concentrations. KT5720 can be used in the study of haematological malignancies as well as HCN and DRG neuron-related diseases [1] [2] [3]. Uses: Scientific research. Group: Signaling pathways. CAS No. 108068-98-0. Pack Sizes: 50 μg; 100 μg. Product ID: HY-N6789. | |
| KT5720 | KT 5720, an anti-bacterial agent synthesized by the fungus Nocardiopsis sp, specifically blocks PKA signaling through competitive inhibition of ATP with a Ki value of 60 nM. Uses: Anti-bacterial agents. Synonyms: 2,3,9,10,11,12-hexahydro-10S-hydroxy-9-methyl-1-oxo-9R,12S-epoxy-1H-diindolo[1,2,3-fg:3',2',1'-kl]pyrrolo[3,4-i][1,6]benzodiazocine-10-carboxylic acid, hexyl ester; KT 5720; KT5720; KT-5720. Grade: 98%. CAS No. 108068-98-0. Molecular formula: C32H31N3O5. Mole weight: 537.60. | |
| KT 5720 | ?98% (HPLC), powder. Group: Fluorescence/luminescence spectroscopy. | |
| KT 5720 | KT 5720. Group: Biochemicals. Grades: Purified. CAS No. 108068-98-0. Pack Sizes: 100ug. US Biological Life Sciences. | Worldwide |
| KT5720 - CAS 108068-98-0 | A potent, specific, cell-permeable, reversible and ATP-competitive inhibitor of protein kinase A (Ki = 56 nM) that is prepared by a chemical modification of K-252a. Group: Fluorescence/luminescence spectroscopy. | |
| Kt5823 | KT5823, a selective the cGMP-dependent protein kinase (PKG) inhibitor with an Ki value of 0.23 μM, it also inhibits PKA and PKC with Ki values of 10 μM and 4 μM, respectively. KT5823 is a staurosporine-related protein kinase inhibitor, increases thyroid-stimulating hormone-induced (Na+/I- symporter) NIS expression, and iodide uptake in thyroid cells. KT5823 arrests cells after the G0/G1 boundary and causes increases in the levels of apoptotic DNA fragmentation. Uses: Designed for use in research and industrial production. Product Category: Inhibitors. CAS No. 126643-37-6. Molecular formula: C29H25N3O5. Mole weight: 495.5259. Purity: >98 %. Product ID: ACM126643376. Alfa Chemistry ISO 9001:2015 Certified. Categories: kt 5823. | |
| KT5823 | KT5823, a selective the cGMP-dependent protein kinase ( PKG ) inhibitor with an K i value of 0.23 μM, it also inhibits PKA and PKC with K i values of 10 μM and 4 μM, respectively. KT5823 is a Staurosporine -related protein kinase inhibitor, increases thyroid-stimulating hormone-induced (Na + /I - symporter) NIS expression, and iodide uptake in thyroid cells. KT5823 arrests cells after the G0/G1 boundary and causes increases in the levels of apoptotic DNA fragmentation [1] [2] [3] [4] [5]. Uses: Scientific research. Group: Signaling pathways. CAS No. 126643-37-6. Pack Sizes: 100 μg. Product ID: HY-N6791. | |
| KT5823 | KT 5823 is a cell-permeable, selective inhibitor of cGMP-dependent protein kinase (PKG) (Ki values are 0.23, 4 and > 10 μM for inhibition of PKG, PKC and PKA respectively). KT 5823 is often used in intact cells to assess the role of PKG in signaling, although there are cases where it poorly inhibits PKG in cells. Uses: Kt5823 induces apoptotic fragmentation of dna. Synonyms: KT 5823; KT-5823; KT5823; 2,3,9,10,11,12-hexahydro-10R-methoxy-2,9-dimethyl-1-oxo-9S,12R-epoxy-1H-diindolo[1,2,3-fg:3',2',1'-kl]pyrrolo[3,4-i][1,6]benzodiazocine-10-carboxylic acid, methyl ester. Grade: ≥98%. CAS No. 126643-37-6. Molecular formula: C29H25N3O5. Mole weight: 495.52. | |
| KT 5823 | ?85% (HPLC), lyophilized powder. Group: Fluorescence/luminescence spectroscopy. | |
| KT 5823 | KT 5823. Group: Biochemicals. Grades: Purified. CAS No. 126643-37-6. Pack Sizes: 100ug. US Biological Life Sciences. | Worldwide |
| KT5823 (2, 3, 9, 10, 11, 12- hexahydro- 10R- methoxy- 2, 9- dimethyl- 1- oxo- 9S, 12R- epoxy- 1H- diindolo[1, 2, 3- fg:3, 2, 1- kl]pyrrolo[3, 4- i][1, ]benzodiazocine- 10- carboxylic acid, methyl ester) | Cell-permeable. KT5823 is a derivative of K-252a that acts as a selective inhibitor of Protein kinase G (PKG) (Ki = 0.234um). Inhibits other kinases at much higher concentrations (Kis for PKA=4um and for MLCK=>10um). Group: Biochemicals. Grades: Highly Purified. CAS No. 126643-37-6. Pack Sizes: 50ug. US Biological Life Sciences. | Worldwide |
| KT5823 - CAS 126643-37-6 | Highly specific, cell-permeable, reversible, and ATP-competitive inhibitor of protein kinase G (Ki = 234 nM). Group: Fluorescence/luminescence spectroscopy. | |
| K+-transporting ATPase | A P-type ATPase that undergoes covalent phosphorylation during the transport cycle. A bacterial enzyme of di(heterotetrameric) structure that is involved in K+ import. The probable stoichiometry is one ion per ATP hydrolysed. Group: Enzymes. Synonyms: K+-translocating Kdp-ATPase; multi-subunit K+-transport ATPase. Enzyme Commission Number: EC 7.2.2.6 (Formerly EC 3.6.3.12). Storage: Store it at +4 ?C for short term. For long term storage, store it at -20 ?C?-80 ?C. Form: Liquid or lyophilized powder. EXWM-4649; K+-transporting ATPase; EC 3.6.3.12; K+-translocating Kdp-ATPase; multi-subunit K+-transport ATPase. Cat No: EXWM-4649. | |
| KTRNQMSFKETNGLEKIFQDHPLQKTYNYNVLMVPKQ | KTRNQMSFKETNGLEKIFQDHPLQKTYNYNVLMVPKQ. Synonyms: Lys-Thr-Arg-Asn-Gln-Met-Ser-Phe-Lys-Glu-Thr-Asn-Gly-Leu-Glu-Lys-Ile-Phe-Gln-Asp-His-Pro-Leu-Gln-Lys-Thr-Tyr-Asn-Tyr-Asn-Val-Leu-Met-Val-Pro-Lys-Gln. Molecular formula: C199H315N55O58S2. Mole weight: 4470.16. | |
| KU-0058948 | KU-0058948 is a poly (ADP-ribose) polymerase (PARP) inhibitor. Studies show that KU-0058948 a potent agonist that activates transfected extracellular signal-regulated kinase 8 (ERK8) in cells. KU-0058948 induces cell cycle arrest and apoptosis of primary myeloid leukemic cells and myeloid leukemic cell lines in vitro. Group: Biochemicals. Alternative Names: 4- [ [4-fluoro-3- [ (hexahydro-1H-1, 4-diazepin-1-yl) carbonyl] phenyl] methyl] -1 (2H) -phthalazinone; KU 0058948; KU0058948; 1- [5- [ (3, 4-dihydro-4-oxo-1-phthalazinyl) methyl] -2-fluorobenzoyl] hexahydro-1H-1, 4-diazepine. Grades: Highly Purified. CAS No. 763111-49-5. Pack Sizes: 10mg. US Biological Life Sciences. | Worldwide |
| KU 0060648 | Dual PI 3-K and DNA-PK inhibitor (IC50 values are <0.1, 0.5, 4 and 19 nM for PI 3-Kdelta, PI 3-Kbeta, PI 3-Kalpha and DNA-PK respectively). Inhibits proliferation of MCF7 cells in vitro and delays growth of MCF7 xenografts in mice. Also enhances CRISPR-Cas9-mediated homology- directed repair (HDR) efficiency, and attenuates nonhomologous end-joining (NHEJ). Group: Biochemicals. Alternative Names: 4-Ethyl-N-[4-[2-(4-morpholinyl)-4-o xo-4H-1-benzopyran-8-yl]-1-dibenzothienyl]-1-piper azineacetamide. Grades: Highly Purified. CAS No. 881375-00-4. Pack Sizes: 10mg. Molecular Formula: C??H??N?O?S, Molecular Weight: 582.71. US Biological Life Sciences. | Worldwide |
| KU-0060648 | ?98% (HPLC). Group: Fluorescence/luminescence spectroscopy. | |
| KU-0060648 | KU-0060648 is a dual inhibitor of PI3K and DNA-PK with IC 50 s of 4 nM, 0.5 nM, 0.1 nM, 0.594 nM and 8.6 nM for PI3Kα, PI3Kβ, PI3Kγ, PI3Kδ and DNA-PK, respectively [1]. Uses: Scientific research. Group: Signaling pathways. CAS No. 881375-00-4. Pack Sizes: 1 mg; 5 mg; 10 mg; 25 mg. Product ID: HY-13431. | |
| KU 0063794 | ?98% (HPLC). Group: Fluorescence/luminescence spectroscopy. | |
| KU-0063794 | KU-0063794 is a potent and specific mTOR inhibitor, inhibiting both the mTORC1 and mTORC2 complexes with IC 50 s of 10 nM. Uses: Scientific research. Group: Signaling pathways. CAS No. 938440-64-3. Pack Sizes: 10 mM * 1 mL; 5 mg; 10 mg; 50 mg; 100 mg. Product ID: HY-50710. | |
| KU14R | KU14R. Group: Biochemicals. Grades: Purified. CAS No. 189224-48-4. Pack Sizes: 10mg, 50mg. US Biological Life Sciences. | Worldwide |
| KU-55933 | KU-55933 is a potent ATM inhibitor with an IC50 and Ki of 12.9 and 2.2 nM, respectively, and is highly selective for ATM as compared to DNA-PK, PI3K/PI4K, ATR and mTOR. Uses: Scientific research. Group: Signaling pathways. CAS No. 587871-26-9. Pack Sizes: 10 mM * 1 mL; 5 mg; 10 mg; 25 mg; 50 mg; 100 mg; 200 mg. Product ID: HY-12016. | |
| KU-55933 | ?98% (HPLC). Group: Fluorescence/luminescence spectroscopy. | |
| KU-57788 | KU-57788 (NU7441) is a highly potent and selective DNA-PK inhibitor with an IC50 of 14 nM. KU-57788 is an NHEJ pathway inhibitor. KU-57788 also inhibits PI3K and mTOR with IC50s of 5.0 and 1.7 ?M, respectively[1]. Uses: Scientific research. Group: Signaling pathways. Alternative Names: NU7441. CAS No. 503468-95-9. Pack Sizes: 10 mM * 1 mL; 5 mg; 10 mg; 50 mg; 100 mg. Product ID: HY-11006. | |
| KU-60019 | KU-60019 is an improved ATM kinase-specific inhibitor with IC50 of 6.3 nM. Uses: Scientific research. Group: Signaling pathways. CAS No. 925701-46-8. Pack Sizes: 10 mM * 1 mL; 5 mg; 10 mg; 50 mg; 100 mg. Product ID: HY-12061. | |
| KU-60019 | ?98% (HPLC). Group: Fluorescence/luminescence spectroscopy. | |
| Ku70 | KU70 is a cell-penetrating peptide used to block the activity of KU70 antibody. Synonyms: H-Val-Pro-Met-Leu-Lys-Pro-Met-Leu-Lys-Glu-OH; L-valyl-L-prolyl-L-methionyl-L-leucyl-L-lysyl-L-prolyl-L-methionyl-L-leucyl-L-lysyl-L-glutamic acid. Grade: >98%. Molecular formula: C54H96N12O13S2. Mole weight: 1185.55. | |
| Kudzu Extract | Kudzu root extract is extracted from the plant in the genus pueraria in the pea family Fabaceae, subfamily faboideae. In traditional Chinese medicine, kudzu root extract puerarin is used in prescriptions for the treatment of thirst, headache, and stiff neck with pain due to high blood pressure. Kudzu root extract, also known as radix puerariae extract, contains a variety of phytochemicals, which are potent antioxidant compounds found naturally in plants, that help to prevent and treat human disease. Group: Others. Mole weight: 416.38. Kudzu Extract; Pueraria Edulis Pampan. Cat No: EXTC-013. | |
| Kudzu Root Extract (Standard) | Kudzu root has been known for centuries in traditional Chinese medicine as ge-gen. The first written mention of the plant as a medicine is in the ancient herbal text of Shen Nong (about A.D.100). In traditional Chinese medicine, kudzu root is used in prescriptions for the treatment of thirst, headache, and stiff neck with pain due to high blood pressure. It is also recommended for allergies, migraine headaches, inadequate measles eruptions in children, and diarrhea It is also used in modern Chinese medicine as a treatment for angina pectoris. Applications: Kudzu root extract is used as remedy for diaphoretic,antispasmodic,muscle relaxant,antipyretic.kudzu root extract is also used for fevers caused by heat in colds and influenza and for stiff neck and shoulders. Group: Others. CAS No. Puerarin: 3681-99-0Genistein: 446-72-0Daidzin: 552-66-9Daidzein: 486-66-8. Purity: 40.0% Isoflavones UV/HPLC. Mole weight: Puerarin: 416.37Genistein: 270.23Daidzin: 416.38Daidzein: 254.23. Kudzu Root Extract (Standard); Puerarin: 3681-99-0Genistein: 446-72-0Daidzin: 552-66-9Daidzein: 486-66-8; Puerarin: C21H20O9Genistein: C15H10O5Daidzin: C21H20O9Daidzein: C10H15O4. Cat No: EXTW-008. | |
| Kukoamine A | Kukoamine A. Group: Biochemicals. Grades: Plant Grade. CAS No. 75288-96-9. Pack Sizes: 10mg. Molecular Formula: C28H42N4O6, Molecular Weight: 530.66. US Biological Life Sciences. | Worldwide |
| Kukoamine B | Kukoamine B. Group: Biochemicals. Grades: Plant Grade. CAS No. 164991-67-7. Pack Sizes: 10mg. Molecular Formula: C28H42N4O6, Molecular Weight: 530.66. US Biological Life Sciences. | Worldwide |
| Kumbicin C | Kumbicin C is a bis-indolyl benzenoid fungal metabolite produced by A. kumbius FRR6049. Kumbicin C was found to inhibit the growth of mouse myeloma cells (IC50 = 0.74 μg/mL) and the Gram-positive bacterium Bacillus subtilis (MIC = 1.6 μg/mL). Synonyms: 5,8-di-1H-indol-3-yl-7-methoxy-2,2-dimethyl-2H-1-benzopyran-6-ol. Grade: ≥95%. CAS No. 1878151-58-6. Molecular formula: C28H24N2O3. Mole weight: 436.50. | |
| Kumquat Base | Kumquat Base. CAS No. MIXTURE. VIGON Item # 504913. Categories: Speciality Ingrdients Suppliers, Fragrances, Perfumers. |  America & Internationally |
| Kunitz-type serine protease inhibitor 1 | Kunitz-type serine protease inhibitor 1 is a Kunitz protease inhibitor isolated from Xanthosoma sagittifolium. It has activity against gram-negative bacteria. Synonyms: Pro-Val-Val-Asp-Thr-Thr-Gly-Asn-Asn-Pro-Leu-Gln-Gln-Gln-Glu-Glu-Tyr-Tyr-Val. Grade: 96.4%. Molecular formula: C96H144N24O35. Mole weight: 2194.34. | |
| kunzeaol synthase | Isolated from the root of the plant Thapsia garganica. The enzyme also produces germacrene D, bicyclogermacrene and traces of other sesquiterpenoids. See EC 4.2.3.77, (+)-germacrene D synthase and EC 4.2.3.100, bicyclogermacrene synthase. Group: Enzymes. Synonyms: TgTPS2 (gene name). Enzyme Commission Number: EC 4.2.3.143. Storage: Store it at +4 ?C for short term. For long term storage, store it at -20 ?C?-80 ?C. Form: Liquid or lyophilized powder. EXWM-5157; kunzeaol synthase; EC 4.2.3.143; TgTPS2 (gene name). Cat No: EXWM-5157. | |
| Kurarinone | ?98% (HPLC). Group: Fluorescence/luminescence spectroscopy. | |
| Kurarinone | Kurarinone is an orally active flavonoid isolated from matrine that inhibits the pathogenesis of experimental autoimmune encephalomyelitis by inhibiting cell differentiation of Th1 and Th17. Kurarinone has antitumor and anti-inflammatory activity [1] [2] [3]. Uses: Scientific research. Group: Natural products. CAS No. 34981-26-5. Pack Sizes: 10 mM * 1 mL; 5 mg; 10 mg; 25 mg. Product ID: HY-N2279. | |
| Kurarinone | Kurarinone. Group: Biochemicals. CAS No. 34981-26-5. Pack Sizes: 5mg. US Biological Life Sciences. | Worldwide |
| Kurarinone, 2'-O-methyl- | Kurarinone, 2'-O-methyl-. Group: Biochemicals. Grades: Plant Grade. CAS No. 270249-38-2. Pack Sizes: 5mg. Molecular Formula: C27H32O6, Molecular Weight: 452.55. US Biological Life Sciences. | Worldwide |
| Kurasoin A | It is produced by the strain of Paecilomyces sp. FO-3184, Kurasoin A has the effect of inhibiting the protein fannicyl transferase. Synonyms: (+)-Kurasoin A; (S)-3-Hydroxy-4-(4-hydroxyphenyl)-1-phenyl-2-butanone. CAS No. 182232-62-8. Molecular formula: C16H16O3. Mole weight: 256.30. | |
| Kurasoin B | It is produced by the strain of Paecilomyces sp. FO-3184, Kurasoin B has the effect of inhibiting the protein fannicyl transferase. Synonyms: (+)-Kurasoin B. Molecular formula: C18H17NO2. Mole weight: 279.33. | |
| Kuromanin chloride | Kuromanin chloride (Chrysontemin) is derived from mulberry leaves and has the effect of increasing blood sugar concentration and maintaining lipid metabolism balance to reduce obesity. Kuromanin chloride can inhibit CD38 enzymatic activities[1][2][3]. Uses: Scientific research. Group: Natural products. Alternative Names: Chrysontemin; Cyanidin 3-O-glucoside chloride. CAS No. 7084-24-4. Pack Sizes: 10 mM * 1 mL; 2 mg; 5 mg; 10 mg; 25 mg. Product ID: HY-N0640. | |
| KUS121 | KUS121, a valosin-containing protein (VCP, p97) modulator with significant neuroprotective effects, attenuates ischemic retinal cell death via suppressing endoplasmic reticulum stress [1] [2]. Uses: Scientific research. Group: Signaling pathways. CAS No. 1357164-52-3. Pack Sizes: 10 mM * 1 mL; 5 mg; 10 mg. Product ID: HY-138233. | |
Our database is helping our users find suppliers everyday.
