American Chemical Suppliers

A directory of where to buy chemicals in the USA, including: distributors, industrial manufacturers, bulk supplies and wholesalers of raw ingredients & finished goods.

Search for products or services, then visit the suppliers website for prices or more information.

Product
Kresoxim-methyl-d7 Kresoxim-methyl-d7. Group: Biochemicals. Alternative Names: (α E) -α - (methoxyimino) -2-[ (2-methylphenoxy) methyl]benzeneacetic Acid Methyl Ester-d7; BAS 490-02F-d7; BAS 490F-d7; Candit-d7; Cygnus-d7; Discus-d7; Discus (fungicide)-d7; RIL-FA 200-d7; Strob 1-d7; Stroby-d7; Stroby WG-d7. Grades: Highly Purified. Pack Sizes: 1mg. Molecular Formula: C18H12D7NO4, Molecular Weight: 320.39. US Biological Life Sciences. USBiological 3
Worldwide
Kresoxim-methyl Impurity 4 Kresoxim-methyl Impurity 4. Uses: For analytical and research use. Group: Impurity standards. CAS No. 141517-21-7. Molecular formula: C20H19F3N2O4. Mole weight: 408.38. Catalog: APB141517217. Alfa Chemistry Analytical Products 4
KRFK TFA KRFK TFA, a peptide derived from TSP-1, can activate TGF-?. KRFK TFA promotes TGF-?-mediated signaling and its downstream role, independent of thrombospondin (TSP) receptors such as CD47 and CD36. KRFK TFA can be used for chronic ocular surface inflammatory disorders reseach[1]. Uses: Scientific research. Group: Peptides. Pack Sizes: 5 mg; 10 mg; 25 mg; 50 mg; 100 mg. Product ID: HY-P3970A. MedChemExpress MCE
KRIBB11 KRIBB11 is an inhibitor of Heat shock factor 1 (HSF1), with IC50 of 1.2 ?M. Uses: Scientific research. Group: Signaling pathways. CAS No. 342639-96-7. Pack Sizes: 10 mM * 1 mL; 5 mg; 10 mg; 25 mg; 50 mg; 100 mg. Product ID: HY-100872. MedChemExpress MCE
KRIBB11 KRIBB11. Group: Biochemicals. Grades: Purified. CAS No. 342639-96-7. Pack Sizes: 10mg, 50mg. US Biological Life Sciences. USBiological 5
Worldwide
KRIBB11 trifluoroacetate salt ?98% (HPLC). Group: Fluorescence/luminescence spectroscopy. Alfa Chemistry Analytical Products
Krill oil United States Pharmacopeia (USP) Reference Standard. Group: Pharmacopeia & metrological institutes standards. Alfa Chemistry Analytical Products 2
KRM-III ?98% (HPLC). Group: Fluorescence/luminescence spectroscopy. Alfa Chemistry Analytical Products 3
KRN633 ?98% (HPLC). Group: Fluorescence/luminescence spectroscopy. Alfa Chemistry Analytical Products
Kroll's Reagent Excellent for titanium and alloys. Group: Etchants. Alfa Chemistry Materials 3
KRP-203 KRP-203. Group: Biochemicals. Alternative Names: 2-Amino-2- [2- [2-chloro-4- [ [3- (phenylmethoxy) phenyl] thio] phenyl] ethyl] -1, 3-propanediol hydrochloride. Grades: Highly Purified. CAS No. 509088-69-1. Pack Sizes: 50mg, 100mg. Molecular Formula: C24H27Cl2NO3S. US Biological Life Sciences. USBiological 7
Worldwide
KRpep-2d KRpep-2d is a K-Ras(G12D) selective inhibitory cyclic peptide that has the potential as the treatment of cancers expressing K-Ras(G12C) mutant. Synonyms: s8499. Molecular formula: C108H182N44O25S2. Mole weight: 2561.01. BOC Sciences
KRpep-2d KRpep-2d is a potent K-Ras inhibitor and inhibits proliferation of K-Ras-driven cancer cells. KRpep-2d can be used for cancer research [1]. Uses: Scientific research. Group: Peptides. CAS No. 2098181-84-9. Pack Sizes: 2 mg; 5 mg; 10 mg; 25 mg; 50 mg. Product ID: HY-P3277. MedChemExpress MCE
Kryptofix 22 dd Kryptofix 22 dd. Uses: Designed for use in research and industrial production. Additional or Alternative Names: Kryptofix 22dd, Kryptofix 22 DD, 36760_ALDRICH, 36760_FLUKA, MolPort-003-931-086, CID72806, EINECS 279-168-4, NSC339326, NSC 339326, NCGC00166067-01, 1,10-Didecyl-1,10-diaza-18-crown-6, 7,16-Didecyl-1,4,10,13-tetraoxa-7,16-diaza-cyclooctadecane, 7,16-Didecyl-1,4,10,13-tetraoxa-7,16-diazacyclooctadecane, 1,4,10,13-Tetraoxa-7,16-diazacyclooctadecane, 7,16-didecyl-, 79495-97-9. Product Category: Heterocyclic Organic Compound. CAS No. 79495-97-9. Molecular formula: C32H66N2O4. Mole weight: 542.88. Purity: 0.96. IUPACName: 7,16-didecyl-1,4,10,13-tetraoxa-7,16-diazacyclooctadecane. Canonical SMILES: CCCCCCCCCCN1CCOCCOCCN(CCOCCOCC1)CCCCCCCCCC. Density: 0.897g/cm³. ECNumber: 279-168-4. Product ID: ACM79495979. Alfa Chemistry — ISO 9001:2015 Certified. Alfa Chemistry. 4
Kryptofix(r) 211 Kryptofix(r) 211. Uses: Designed for use in research and industrial production. Additional or Alternative Names: cryptating agent 211. Product Category: Other Monomers. CAS No. 31250-06-3. Molecular formula: C14H28N2O4. Mole weight: 288.38 g/mol. Product ID: ACM-MO-31250063. Alfa Chemistry — ISO 9001:2015 Certified. Categories: 4,7,13,18-tetraoxa-1,10-diazabicyclo[8.5.5]icosane. Alfa Chemistry. 2
KS100 KS100 is a potent ALDH inhibitor with IC 50 s of 230, 1542, 193 nM for ALDH1A1, ALDH2, and ALDH3A1, respectively. KS100 shows antiproliferative and anticancer effects with low low toxic. KS100 significantly increases ROS activity, lipid peroxidation and toxic aldehyde accumulation. KS10600 induces apoptosis and cell cycle arrest at the G2/M phase [1]. Uses: Scientific research. Group: Signaling pathways. CAS No. 2408477-54-1. Pack Sizes: 5 mg; 10 mg; 25 mg; 50 mg; 100 mg. Product ID: HY-146682. MedChemExpress MCE
KS15 KS15 is an inhibitor of the interactions between cryptochromes (CRYs: CRY1 and CRY2) and the CLOCK:BMAL1 heterodimer. KS15 impairs the feedback actions of CRYs on E-box-dependent transcription (EC50=4.9 ?M) by CLOCK:BMAL1 heterodimer, an indispensable transcriptional regulator of the mammalian circadian clock. Anti-proliferative activity[1][2]. Uses: Scientific research. Group: Signaling pathways. CAS No. 1033781-20-2. Pack Sizes: 10 mM * 1 mL; 5 mg; 10 mg; 25 mg; 50 mg; 100 mg. Product ID: HY-115672. MedChemExpress MCE
KS 176 KS 176. Group: Biochemicals. Grades: Purified. CAS No. 1253452-78-6. Pack Sizes: 10mg, 50mg. US Biological Life Sciences. USBiological 5
Worldwide
KS-176 ?98% (HPLC). Group: Fluorescence/luminescence spectroscopy. Alfa Chemistry Analytical Products
KS2100 Hydrogenated rosin resin KS2100 Hydrogenated rosin resin. BOC Sciences 10
KS370G KS370G is an orally active hypoglycemic and cardiovascular protective agent. KS370G improves left ventricular hypertrophy and function in pressure-overload mice heart. KS370G reduces renal obstructive nephropathy [1] [2]. Uses: Scientific research. Group: Signaling pathways. CAS No. 105955-01-9. Pack Sizes: 5 mg; 10 mg; 25 mg; 50 mg. Product ID: HY-114683. MedChemExpress MCE
KS 370G ?98% (HPLC). Group: Fluorescence/luminescence spectroscopy. Alfa Chemistry Analytical Products 3
KS-501 It is produced by the strain of Sporothrix sp. KAC-1989. KS-501 inhibited Ca2+ and calmodulin dependent cyclic-nucleotide phosphodiesterase with an IC50 of 1.8 μmol/L. Synonyms: KS 501; 3-Heptyl-5-hydroxyphenyl 2-heptyl-6-(hexofuranosyloxy)-4-hydroxybenzoate. CAS No. 120634-86-8. Molecular formula: C33H48O10. Mole weight: 604.73. BOC Sciences 12
KS 502 It is produced by the strain of Sporothrix sp. KAC-1989. KS 502 inhibited Ca2+ and calmodulin dependent cyclic-nucleotide phosphodiesterase with an IC50 of 4.4 μmol/L. Synonyms: Benzoic acid, 2-(beta-D-galactofuranosyloxy)-6-heptyl-4-hydroxy-, 4-carboxy-3-heptyl-5-hydroxyphenyl ester. Grade: >98%. CAS No. 120634-85-7. Molecular formula: C34H48O12. Mole weight: 648.74. BOC Sciences 12
KS 504a It is produced by the strain of Mollisia ventosa KAC-1148. KS 504a inhibited Ca2+ and calmodulin dependent cyclic-nucleotide phosphodiesterase with an IC50 of 122 μmol/L. Synonyms: KS-504a; KS-504b; BRN 4354490; 1-Oxaspiro(2.4)heptan-5-ol, 2,4,4,6,6-pentachloro-7-(dichloromethylene)-. CAS No. 122022-77-9. Molecular formula: C7H3Cl7O2. Mole weight: 367.27. BOC Sciences 12
KS-504d It is produced by the strain of Mollisia ventosa KAC-1148. KS-504d inhibited Ca2+ and calmodulin dependent cyclic-nucleotide phosphodiesterase with an IC50 of >500 μmol/L. Synonyms: KS 504d; BRN 4322179; (+)-1-(Dichloromethyl)-5-(dichloromethylene)-2,2,4,4-tetrachloro-1,3-cyclopentanediol. CAS No. 122005-23-6. Molecular formula: C7H4Cl8O2. Mole weight: 403.73. BOC Sciences 12
KS-504e It is produced by the strain of Mollisia ventosa KAC-1148. KS-504e inhibited Ca2+ and calmodulin dependent cyclic-nucleotide phosphodiesterase with an IC50 of 139 μmol/L. Synonyms: KS 504e; BRN 4321107; (+)-4-Hydroxy-3,3,5,5-tetrachloro-2-(trichloromethyl)-1-cyclopentene-1-carboxaldehyde; 1-Cyclopentene-1-carboxaldehyde, 3,3,5,5-tetrachloro-4-hydroxy-2-(trichloromethyl)-, (+)-. CAS No. 122006-32-0. Molecular formula: C7H3Cl7O2. Mole weight: 367.27. BOC Sciences 12
KS-619-1 It is produced by the strain of Streptomyces californicus KS-619-1. KS-619-1 inhibited Ca2+ and CAM-PDE in bovine brain and heart with an IC50 of 2.0 and 1.5 μmol/L. Synonyms: KS 619-1; Benzo(a)naphthacene-2-carboxylic acid, 5,6,8,13-tetrahydro-1,7,9,11-tetrahydroxy-8,13-dioxo-3-(2-oxopropyl)-. CAS No. 103370-21-4. Molecular formula: C26H18O9. Mole weight: 474.41. BOC Sciences 12
Ksp22 I One unit of the enzyme is the amount required to hydrolyze 1 μg of Lambda DNA in 1 hour at 37°C in a total reaction volume of 50 μl. Applications: After 20-fold overdigestion with enzyme more than 90% of the dna fragments can be ligated and recut. Group: Restriction Enzymes. Purity: 1000U; 5000U. T↑GATCA ACTAG↓T. Activity: 20000u.a./ml. Appearance: 10 X SE-buffer 2K, BSA. Storage: -20°C. Form: Liquid. Source: Kurthia species 22. Pack: 10 mM Tris-HCl (pH 7.5); 250 mM NaCl; 0.1 mM EDTA; 7 mM 2-mercaptoethanol; 200 μg/ml BSA, 50% glycerol. Cat No: ET-1126RE. Creative Enzymes
KSPWFTTL KSPWFTTL is an immunodominant Kb-restricted epitope from the p15E transmembrane protein. KSPWFTTL can restore susceptibility of a tumor line to anti-AKR/Gross MuLV cytotoxic T lymphocytes [1] [2]. Uses: Scientific research. Group: Peptides. CAS No. 153049-05-9. Pack Sizes: 5 mg; 10 mg. Product ID: HY-P3333. MedChemExpress MCE
KSQ-4279 KSQ-4279 is a USP1 and PARP inhibitor. KSQ-4279 showed anti-proliferative effects in a subset of cell lines, often characterized by the presence of homologous recombination deficiencies (HRD), including mutations in BRCA1/2. The combination of KSQ-4279 with olaparib was able to induce strong and durable regressions across a number of ovarian and TNBC PDX models. Uses: Designed for use in research and industrial production. Additional or Alternative Names: KSQ-4279; KSQ 4279; KSQ4279. Product Category: Inhibitors. Appearance: Solid powder. CAS No. 2446480-97-1. Molecular formula: C27H25F3N8O. Mole weight: 534.55. Purity: >98%. IUPACName: 1H-Pyrazolo[3,4-d]pyrimidine, 6-(4-cyclopropyl-6-methoxy-5-pyrimidinyl)-1-[[4-[1-(1-methylethyl)-4-(trifluoromethyl)-1H-imidazol-2-yl]phenyl]methyl]-. Canonical SMILES: FC(C1=CN(C(C)C)C(C2=CC=C(CN3N=CC4=CN=C(C5=C(OC)N=CN=C5C6CC6)N=C43)C=C2)=N1)(F)F. Product ID: ACM2446480971. Alfa Chemistry — ISO 9001:2015 Certified. Alfa Chemistry.
KSQ-4279 KSQ-4279 (USP1-IN-1) is a potent USP1 inhibitor and a selective PARP1 inhibitor. KSQ-4279 is promising for research of cancers [1]. Uses: Scientific research. Group: Signaling pathways. Alternative Names: USP1-IN-1. CAS No. 2446480-97-1. Pack Sizes: 10 mM * 1 mL; 1 mg; 5 mg; 10 mg; 25 mg; 50 mg; 100 mg. Product ID: HY-145471. MedChemExpress MCE
K-Strophanthoside K-Strophanthoside. Uses: Designed for use in research and industrial production. Additional or Alternative Names: STROPHANTHOSIDE, K-;copyranosyl-(1-4)-2,6-dideoxy-3-o-methyl-beta-d-ribo-hexopyranosyl)oxy)-5,14-d;ihydroxy-19-oxo-;k-strofantozyd;k-strophanthidin-gamma;k-strophantosid;k-strophantoside;strophanthidin+cymarose+beta-glucose+alpha-glucose. Product Category: Heterocyclic Organic Compound. Appearance: White-beige powder. CAS No. 33279-57-1. Molecular formula: C42H64O19. Mole weight: 873. Purity: 0.98. Product ID: ACM33279571. Alfa Chemistry — ISO 9001:2015 Certified. Alfa Chemistry. 3
KT109 ?98% (HPLC). Group: Fluorescence/luminescence spectroscopy. Alfa Chemistry Analytical Products 2
KT109 KT109 is a potent and an isoform-selective inhibitor of diacylglycerol lipase-β (DAGLβ) with an IC 50 of 42 nM. KT109 has ~60-fold selectivity for DAGLβ over DAGL&alpha. KT109 shows inhibitory activity against PLA2G7 (IC 50 =1 μM). KT109 shows negligible activity against FAAH, MGLL, ABHD11, and cytosolic phospholipase A2 (cPLA2 or PLA2G4A). KT109 perturbs a lipid network involved in macrophage inflammatory responses and lowers 2-arachidonoylglycerol (2-AG), arachidonic acid and eicosanoids in mouse peritoneal macrophages [1]. Uses: Scientific research. Group: Signaling pathways. CAS No. 1402612-55-8. Pack Sizes: 10 mM * 1 mL; 5 mg; 10 mg; 25 mg; 50 mg; 100 mg. Product ID: HY-18540. MedChemExpress MCE
KT172 KT172 is a DAGLβ inhibitor with an IC 50 value of 11 nM. KT172 can be used for the research of metabolic and inflammatory [1]. Uses: Scientific research. Group: Signaling pathways. CAS No. 1402612-56-9. Pack Sizes: 1 mg; 5 mg; 10 mg. Product ID: HY-18541. MedChemExpress MCE
KT172 ?98% (HPLC). Group: Fluorescence/luminescence spectroscopy. Alfa Chemistry Analytical Products 2
KT182 ?98% (HPLC). Group: Fluorescence/luminescence spectroscopy. Alfa Chemistry Analytical Products 2
KT185 ?98% (HPLC). Group: Fluorescence/luminescence spectroscopy. Alfa Chemistry Analytical Products 2
KT195 ?98% (HPLC). Group: Fluorescence/luminescence spectroscopy. Alfa Chemistry Analytical Products 2
KT203 ?98% (HPLC). Group: Fluorescence/luminescence spectroscopy. Alfa Chemistry Analytical Products 2
KT-253 KT-253 is a p53 stabilizer and a PROTAC degrader for MDM2 ( DC 50 =0.4 nM). KT-253 inhibits the proliferation of cancer cell RS4;11 with an IC 50 of 0.3 nM, arrests the cell cycle at G2/M phase, and induces apoptosis. KT-253 exhibits antitumor efficacy in mouse models [1]. (Pink: ligand for target protein MDM2 ligand 4 (HY-170452); Black: linker (HY-W001478); Blue: ligand for E3 ligase cereblon (HY-163927)). Uses: Scientific research. Group: Signaling pathways. CAS No. 2713618-08-5. Pack Sizes: 1 mg; 5 mg; 10 mg; 25 mg; 50 mg; 100 mg. Product ID: HY-170451. MedChemExpress MCE
KT-333 KT-333 is a molecular glues that degrades STAT3 protein. KT-333 mediates the selective degradation of STAT3 through the ubiquitin-proteasome system by binding to STAT3 protein and E3 ubiquitin ligase von Hippel-Lindau protein (VHL). KT-333 has strong selectivity for STAT3 protein degradation and good antitumor activity. KT-333 can be used in the study of hematologic malignancies such as large granular lymphocytic leukemia (LGL-L), peripheral T-cell lymphoma (PTCL), and cutaneous T-cell lymphoma (CTCL) [1]. Uses: Scientific research. Group: Signaling pathways. CAS No. 2502186-79-8. Pack Sizes: 1 mg; 5 mg; 10 mg. Product ID: HY-156730. MedChemExpress MCE
KT-474 KT-474 (KYM-001) is an orally active PROTAC IRAK4 degrader with antitumor activities [1]. KT-474 is a click chemistry reagent, it contains an Alkyne group and can undergo copper-catalyzed azide-alkyne cycloaddition (CuAAc) with molecules containing Azide groups. Uses: Scientific research. Group: Signaling pathways. Alternative Names: KYM-001; PROTAC IRAK4 degrader-7. CAS No. 2432994-31-3. Pack Sizes: 1 mg; 5 mg. Product ID: HY-145483. MedChemExpress MCE
KT5720 KT5720 is a potent, cell-permeable, specific, reversible and ATP-competitive PKA inhibitor ( IC 50 =3.3 μM). KT5720 is effective in reversing MDR1-mediated multidrug resistance. KT5720 also reduces the excitability of dorsal root ganglion (DRG) neurons by attenuating Hyperpolarization-activated cyclic nucleotide-gated (HCN) channel activity and reducing intracellular Ca2 + concentrations. KT5720 can be used in the study of haematological malignancies as well as HCN and DRG neuron-related diseases [1] [2] [3]. Uses: Scientific research. Group: Signaling pathways. CAS No. 108068-98-0. Pack Sizes: 50 μg; 100 μg. Product ID: HY-N6789. MedChemExpress MCE
KT5720 KT 5720, an anti-bacterial agent synthesized by the fungus Nocardiopsis sp, specifically blocks PKA signaling through competitive inhibition of ATP with a Ki value of 60 nM. Uses: Anti-bacterial agents. Synonyms: 2,3,9,10,11,12-hexahydro-10S-hydroxy-9-methyl-1-oxo-9R,12S-epoxy-1H-diindolo[1,2,3-fg:3',2',1'-kl]pyrrolo[3,4-i][1,6]benzodiazocine-10-carboxylic acid, hexyl ester; KT 5720; KT5720; KT-5720. Grade: 98%. CAS No. 108068-98-0. Molecular formula: C32H31N3O5. Mole weight: 537.60. BOC Sciences
KT 5720 KT 5720. Group: Biochemicals. Grades: Purified. CAS No. 108068-98-0. Pack Sizes: 100ug. US Biological Life Sciences. USBiological 5
Worldwide
KT 5720 ?98% (HPLC), powder. Group: Fluorescence/luminescence spectroscopy. Alfa Chemistry Analytical Products 3
KT5720 - CAS 108068-98-0 A potent, specific, cell-permeable, reversible and ATP-competitive inhibitor of protein kinase A (Ki = 56 nM) that is prepared by a chemical modification of K-252a. Group: Fluorescence/luminescence spectroscopy. Alfa Chemistry Analytical Products 3
Kt5823 KT5823, a selective the cGMP-dependent protein kinase (PKG) inhibitor with an Ki value of 0.23 μM, it also inhibits PKA and PKC with Ki values of 10 μM and 4 μM, respectively. KT5823 is a staurosporine-related protein kinase inhibitor, increases thyroid-stimulating hormone-induced (Na+/I- symporter) NIS expression, and iodide uptake in thyroid cells. KT5823 arrests cells after the G0/G1 boundary and causes increases in the levels of apoptotic DNA fragmentation. Uses: Designed for use in research and industrial production. Product Category: Inhibitors. CAS No. 126643-37-6. Molecular formula: C29H25N3O5. Mole weight: 495.5259. Purity: >98 %. Product ID: ACM126643376. Alfa Chemistry — ISO 9001:2015 Certified. Categories: kt 5823. Alfa Chemistry.
KT5823 KT5823, a selective the cGMP-dependent protein kinase ( PKG ) inhibitor with an K i value of 0.23 μM, it also inhibits PKA and PKC with K i values of 10 μM and 4 μM, respectively. KT5823 is a Staurosporine -related protein kinase inhibitor, increases thyroid-stimulating hormone-induced (Na + /I - symporter) NIS expression, and iodide uptake in thyroid cells. KT5823 arrests cells after the G0/G1 boundary and causes increases in the levels of apoptotic DNA fragmentation [1] [2] [3] [4] [5]. Uses: Scientific research. Group: Signaling pathways. CAS No. 126643-37-6. Pack Sizes: 100 μg. Product ID: HY-N6791. MedChemExpress MCE
KT5823 KT 5823 is a cell-permeable, selective inhibitor of cGMP-dependent protein kinase (PKG) (Ki values are 0.23, 4 and > 10 μM for inhibition of PKG, PKC and PKA respectively). KT 5823 is often used in intact cells to assess the role of PKG in signaling, although there are cases where it poorly inhibits PKG in cells. Uses: Kt5823 induces apoptotic fragmentation of dna. Synonyms: KT 5823; KT-5823; KT5823; 2,3,9,10,11,12-hexahydro-10R-methoxy-2,9-dimethyl-1-oxo-9S,12R-epoxy-1H-diindolo[1,2,3-fg:3',2',1'-kl]pyrrolo[3,4-i][1,6]benzodiazocine-10-carboxylic acid, methyl ester. Grade: ≥98%. CAS No. 126643-37-6. Molecular formula: C29H25N3O5. Mole weight: 495.52. BOC Sciences
KT 5823 ?85% (HPLC), lyophilized powder. Group: Fluorescence/luminescence spectroscopy. Alfa Chemistry Analytical Products
KT 5823 KT 5823. Group: Biochemicals. Grades: Purified. CAS No. 126643-37-6. Pack Sizes: 100ug. US Biological Life Sciences. USBiological 5
Worldwide
KT5823 (2, 3, 9, 10, 11, 12- hexahydro- 10R- methoxy- 2, 9- dimethyl- 1- oxo- 9S, 12R- epoxy- 1H- diindolo[1, 2, 3- fg:3’, 2’, 1’- kl]pyrrolo[3, 4- i][1, ]benzodiazocine- 10- carboxylic acid, methyl ester) Cell-permeable. KT5823 is a derivative of K-252a that acts as a selective inhibitor of Protein kinase G (PKG) (Ki = 0.234um). Inhibits other kinases at much higher concentrations (Ki’s for PKA=4um and for MLCK=>10um). Group: Biochemicals. Grades: Highly Purified. CAS No. 126643-37-6. Pack Sizes: 50ug. US Biological Life Sciences. USBiological 4
Worldwide
KT5823 - CAS 126643-37-6 Highly specific, cell-permeable, reversible, and ATP-competitive inhibitor of protein kinase G (Ki = 234 nM). Group: Fluorescence/luminescence spectroscopy. Alfa Chemistry Analytical Products
K+-transporting ATPase A P-type ATPase that undergoes covalent phosphorylation during the transport cycle. A bacterial enzyme of di(heterotetrameric) structure that is involved in K+ import. The probable stoichiometry is one ion per ATP hydrolysed. Group: Enzymes. Synonyms: K+-translocating Kdp-ATPase; multi-subunit K+-transport ATPase. Enzyme Commission Number: EC 7.2.2.6 (Formerly EC 3.6.3.12). Storage: Store it at +4 ?C for short term. For long term storage, store it at -20 ?C?-80 ?C. Form: Liquid or lyophilized powder. EXWM-4649; K+-transporting ATPase; EC 3.6.3.12; K+-translocating Kdp-ATPase; multi-subunit K+-transport ATPase. Cat No: EXWM-4649. Creative Enzymes
KTRNQMSFKETNGLEKIFQDHPLQKTYNYNVLMVPKQ KTRNQMSFKETNGLEKIFQDHPLQKTYNYNVLMVPKQ. Synonyms: Lys-Thr-Arg-Asn-Gln-Met-Ser-Phe-Lys-Glu-Thr-Asn-Gly-Leu-Glu-Lys-Ile-Phe-Gln-Asp-His-Pro-Leu-Gln-Lys-Thr-Tyr-Asn-Tyr-Asn-Val-Leu-Met-Val-Pro-Lys-Gln. Molecular formula: C199H315N55O58S2. Mole weight: 4470.16. BOC Sciences 10
KU-0058948 KU-0058948 is a poly (ADP-ribose) polymerase (PARP) inhibitor. Studies show that KU-0058948 a potent agonist that activates transfected extracellular signal-regulated kinase 8 (ERK8) in cells. KU-0058948 induces cell cycle arrest and apoptosis of primary myeloid leukemic cells and myeloid leukemic cell lines in vitro. Group: Biochemicals. Alternative Names: 4- [ [4-fluoro-3- [ (hexahydro-1H-1, 4-diazepin-1-yl) carbonyl] phenyl] methyl] -1 (2H) -phthalazinone; KU 0058948; KU0058948; 1- [5- [ (3, 4-dihydro-4-oxo-1-phthalazinyl) methyl] -2-fluorobenzoyl] hexahydro-1H-1, 4-diazepine. Grades: Highly Purified. CAS No. 763111-49-5. Pack Sizes: 10mg. US Biological Life Sciences. USBiological 2
Worldwide
KU 0060648 Dual PI 3-K and DNA-PK inhibitor (IC50 values are <0.1, 0.5, 4 and 19 nM for PI 3-Kdelta, PI 3-Kbeta, PI 3-Kalpha and DNA-PK respectively). Inhibits proliferation of MCF7 cells in vitro and delays growth of MCF7 xenografts in mice. Also enhances CRISPR-Cas9-mediated homology- directed repair (HDR) efficiency, and attenuates nonhomologous end-joining (NHEJ). Group: Biochemicals. Alternative Names: 4-Ethyl-N-[4-[2-(4-morpholinyl)-4-o xo-4H-1-benzopyran-8-yl]-1-dibenzothienyl]-1-piper azineacetamide. Grades: Highly Purified. CAS No. 881375-00-4. Pack Sizes: 10mg. Molecular Formula: C??H??N?O?S, Molecular Weight: 582.71. US Biological Life Sciences. USBiological 5
Worldwide
KU-0060648 KU-0060648 is a dual inhibitor of PI3K and DNA-PK with IC 50 s of 4 nM, 0.5 nM, 0.1 nM, 0.594 nM and 8.6 nM for PI3Kα, PI3Kβ, PI3Kγ, PI3Kδ and DNA-PK, respectively [1]. Uses: Scientific research. Group: Signaling pathways. CAS No. 881375-00-4. Pack Sizes: 1 mg; 5 mg; 10 mg; 25 mg. Product ID: HY-13431. MedChemExpress MCE
KU-0060648 ?98% (HPLC). Group: Fluorescence/luminescence spectroscopy. Alfa Chemistry Analytical Products 3
KU 0063794 ?98% (HPLC). Group: Fluorescence/luminescence spectroscopy. Alfa Chemistry Analytical Products 3
KU-0063794 KU-0063794 is a potent and specific mTOR inhibitor, inhibiting both the mTORC1 and mTORC2 complexes with IC 50 s of 10 nM. Uses: Scientific research. Group: Signaling pathways. CAS No. 938440-64-3. Pack Sizes: 10 mM * 1 mL; 5 mg; 10 mg; 50 mg; 100 mg. Product ID: HY-50710. MedChemExpress MCE
KU14R KU14R. Group: Biochemicals. Grades: Purified. CAS No. 189224-48-4. Pack Sizes: 10mg, 50mg. US Biological Life Sciences. USBiological 5
Worldwide
KU-55933 KU-55933 is a potent ATM inhibitor with an IC50 and Ki of 12.9 and 2.2 nM, respectively, and is highly selective for ATM as compared to DNA-PK, PI3K/PI4K, ATR and mTOR. Uses: Scientific research. Group: Signaling pathways. CAS No. 587871-26-9. Pack Sizes: 10 mM * 1 mL; 5 mg; 10 mg; 25 mg; 50 mg; 100 mg; 200 mg. Product ID: HY-12016. MedChemExpress MCE
KU-55933 ?98% (HPLC). Group: Fluorescence/luminescence spectroscopy. Alfa Chemistry Analytical Products
KU-57788 KU-57788 (NU7441) is a highly potent and selective DNA-PK inhibitor with an IC50 of 14 nM. KU-57788 is an NHEJ pathway inhibitor. KU-57788 also inhibits PI3K and mTOR with IC50s of 5.0 and 1.7 ?M, respectively[1]. Uses: Scientific research. Group: Signaling pathways. Alternative Names: NU7441. CAS No. 503468-95-9. Pack Sizes: 10 mM * 1 mL; 5 mg; 10 mg; 50 mg; 100 mg. Product ID: HY-11006. MedChemExpress MCE
KU-60019 KU-60019 is an improved ATM kinase-specific inhibitor with IC50 of 6.3 nM. Uses: Scientific research. Group: Signaling pathways. CAS No. 925701-46-8. Pack Sizes: 10 mM * 1 mL; 5 mg; 10 mg; 50 mg; 100 mg. Product ID: HY-12061. MedChemExpress MCE
KU-60019 ?98% (HPLC). Group: Fluorescence/luminescence spectroscopy. Alfa Chemistry Analytical Products 3

Would you like to list your products on USA Chemical Suppliers?

Our database is helping our users find suppliers everyday.

Add Your Products